Citrus Sinensis ID: 040805
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 540 | ||||||
| 21914823 | 538 | vicilin-like protein [Anacardium occiden | 0.955 | 0.959 | 0.572 | 1e-179 | |
| 21666498 | 536 | vicilin-like protein [Anacardium occiden | 0.955 | 0.962 | 0.570 | 1e-179 | |
| 133711974 | 519 | vicilin [Pistacia vera] | 0.927 | 0.965 | 0.598 | 1e-178 | |
| 255567546 | 560 | nucleolar protein nop56, putative [Ricin | 0.944 | 0.910 | 0.516 | 1e-141 | |
| 19338630 | 448 | 48-kDa glycoprotein precursor [Corylus a | 0.811 | 0.977 | 0.505 | 1e-131 | |
| 13183177 | 585 | 7S globulin [Sesamum indicum] | 0.887 | 0.818 | 0.48 | 1e-127 | |
| 296085227 | 1361 | unnamed protein product [Vitis vinifera] | 0.912 | 0.362 | 0.453 | 1e-120 | |
| 359479703 | 520 | PREDICTED: vicilin-like antimicrobial pe | 0.912 | 0.948 | 0.453 | 1e-120 | |
| 359479651 | 562 | PREDICTED: vicilin-like antimicrobial pe | 0.925 | 0.889 | 0.421 | 1e-114 | |
| 75207036 | 666 | RecName: Full=Vicilin-like antimicrobial | 0.938 | 0.761 | 0.418 | 1e-108 |
| >gi|21914823|gb|AAM73730.2|AF395894_1 vicilin-like protein [Anacardium occidentale] | Back alignment and taxonomy information |
|---|
Score = 635 bits (1639), Expect = e-179, Method: Compositional matrix adjust.
Identities = 317/554 (57%), Positives = 415/554 (74%), Gaps = 38/554 (6%)
Query: 4 KLCFTLFTLSVLVLCAGLALATKDPELKQCKHQCRARQQYDEKQKEQCARTCEEYYKEKE 63
K F+LF +SVLVLC G ALA DPELKQCKHQC+ ++QYDE+QKEQC + CE+YYKEK+
Sbjct: 6 KFSFSLFLVSVLVLCLGFALAKIDPELKQCKHQCKVQRQYDEQQKEQCVKECEKYYKEKK 65
Query: 64 QRERHREGESEEEKEWG-GRHEWMNPGEPAEKHLRQCQRECDRQEEGGQQRALCRFRCQE 122
RER EEE+EWG G + + EPAEKHL QC R+C+RQE GGQQ+ LCRFRCQE
Sbjct: 66 GREREH---EEEEEEWGTGGVDEPSTHEPAEKHLSQCMRQCERQE-GGQQKQLCRFRCQE 121
Query: 123 KYRREKEGEGGQHNTQEEEEEE----------------EGDEESSRVTSQHGRVAFLPKF 166
+Y++E+ GQHN + E++E+ E ++ +++V ++ G+V LPKF
Sbjct: 122 RYKKER----GQHNYKREDDEDEDEDEAEEEDENPYVFEDEDFTTKVKTEQGKVVLLPKF 177
Query: 167 TQRSKLLRGLEKYRLGILIANPQTFVTPTHLDADAVFFVSWGQGTITVIRENNRESYNVK 226
TQ+SKLL LEKYRL +L+ANPQ FV P+H+DAD++FFVSWG+GTIT I EN RES NV+
Sbjct: 178 TQKSKLLHALEKYRLAVLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVR 237
Query: 227 RGDIIRVPSGNTFYVTNTDDDEKLYIVKFIKSINLPGQYEAFYGAGGENPESFLRAFSWE 286
+GDI+ + SG FY+ N D++EKLY+V+F++ +NLPG +E F+G GGENPESF RAFSWE
Sbjct: 238 QGDIVSISSGTPFYIANNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWE 297
Query: 287 ILESAFKTKRDSLERVLFQQDQGAMVKASKQQIRALSRSQEGPSIWPFAGESRGTFNLFG 346
ILE+A KT +D+LE++ +QDQG ++KASK+QIRA+SR EGP IWPF ES G+F LF
Sbjct: 298 ILEAALKTSKDTLEKLFEKQDQGTIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFK 357
Query: 347 KRPSHSNNFGELFEADSNDFRPLEDLDITVSYANISKGAMAAPFYNSRSTKVAVVVAGDG 406
K PS SN +G+LFEA+ D+ PLE LD+ VSYANI+KG M+ PFYNSR+TK+A+VV+G+G
Sbjct: 358 KDPSQSNKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEG 417
Query: 407 YIEIACPHVSRSSSERRHQGSSTREEGSATYHKVSSRIRTDSAYIVPAGHPVVTVASQNN 466
+EIACPH+S S S +Y K+ +RIR D+ +IVPAGHP TVAS N
Sbjct: 418 CVEIACPHLSSSKSS------------HPSYKKLRARIRKDTVFIVPAGHPFATVASGNE 465
Query: 467 NLEVVCFEINAEGNIRFPLAGRNKIFKVMESEAKELAFNTRADEVERVFGNQDQDWFFKG 526
NLE+VCFE+NAEGNIR+ LAG+ I KVME EAKELAF +EV++VFG QD+++FF+G
Sbjct: 466 NLEIVCFEVNAEGNIRYTLAGKKNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQG 525
Query: 527 PSRWHQQQQGRAYE 540
P W ++++GRA E
Sbjct: 526 PE-WRKEKEGRADE 538
|
Source: Anacardium occidentale Species: Anacardium occidentale Genus: Anacardium Family: Anacardiaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|21666498|gb|AAM73729.1|AF395893_1 vicilin-like protein [Anacardium occidentale] | Back alignment and taxonomy information |
|---|
| >gi|133711974|gb|ABO36677.1| vicilin [Pistacia vera] | Back alignment and taxonomy information |
|---|
| >gi|255567546|ref|XP_002524752.1| nucleolar protein nop56, putative [Ricinus communis] gi|223535936|gb|EEF37595.1| nucleolar protein nop56, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|19338630|gb|AAL86739.1|AF441864_1 48-kDa glycoprotein precursor [Corylus avellana] | Back alignment and taxonomy information |
|---|
| >gi|13183177|gb|AAK15089.1|AF240006_1 7S globulin [Sesamum indicum] | Back alignment and taxonomy information |
|---|
| >gi|296085227|emb|CBI28722.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359479703|ref|XP_003632338.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359479651|ref|XP_003632318.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|75207036|sp|Q9SPL5.1|AMP21_MACIN RecName: Full=Vicilin-like antimicrobial peptides 2-1; AltName: Full=MiAMP2; Contains: RecName: Full=Antimicrobial peptide 2a; AltName: Full=MiAMP2a; Contains: RecName: Full=Antimicrobial peptide 2b; AltName: Full=MiAMP2b; Contains: RecName: Full=Antimicrobial peptide 2c-1; AltName: Full=MiAMP2c-1; Contains: RecName: Full=Antimicrobial peptide 2c-2; AltName: Full=MiAMP2c-2; Contains: RecName: Full=Antimicrobial peptide 2c-3; AltName: Full=MiAMP2c-3; Contains: RecName: Full=Antimicrobial peptide 2d; AltName: Full=MiAMP2d; Flags: Precursor gi|5852872|gb|AAD54244.1|AF161883_1 vicilin precursor [Macadamia integrifolia] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 540 | ||||||
| UNIPROTKB|Q9SPL4 | 666 | AMP2-2 "Vicilin-like antimicro | 0.716 | 0.581 | 0.470 | 8.1e-104 | |
| UNIPROTKB|Q9SPL3 | 625 | AMP2-3 "Vicilin-like antimicro | 0.716 | 0.619 | 0.468 | 3.1e-102 | |
| UNIPROTKB|Q9SPL5 | 666 | AMP2-1 "Vicilin-like antimicro | 0.716 | 0.581 | 0.465 | 8e-102 | |
| TAIR|locus:2094404 | 486 | PAP85 [Arabidopsis thaliana (t | 0.698 | 0.775 | 0.329 | 4.3e-54 | |
| TAIR|locus:2056568 | 511 | AT2G28490 [Arabidopsis thalian | 0.253 | 0.268 | 0.309 | 9.7e-23 | |
| TAIR|locus:2046273 | 707 | AT2G18540 "AT2G18540" [Arabido | 0.611 | 0.466 | 0.230 | 3.8e-18 | |
| TAIR|locus:2115390 | 522 | AT4G36700 "AT4G36700" [Arabido | 0.307 | 0.318 | 0.227 | 2.8e-14 | |
| UNIPROTKB|Q9XHP0 | 459 | Q9XHP0 "11S globulin seed stor | 0.205 | 0.241 | 0.238 | 8e-07 | |
| TAIR|locus:2065516 | 356 | AT2G28680 "AT2G28680" [Arabido | 0.375 | 0.570 | 0.219 | 0.00026 | |
| TAIR|locus:2026545 | 356 | AT1G07750 "AT1G07750" [Arabido | 0.220 | 0.334 | 0.261 | 0.00039 |
| UNIPROTKB|Q9SPL4 AMP2-2 "Vicilin-like antimicrobial peptides 2-2" [Macadamia integrifolia (taxid:60698)] | Back alignment and assigned GO terms |
|---|
Score = 929 (332.1 bits), Expect = 8.1e-104, Sum P(3) = 8.1e-104
Identities = 185/393 (47%), Positives = 261/393 (66%)
Query: 150 SSRVTSQHGRVAFLPKFTQRSKLLRGLEKYRLGILIANPQTFVTPTHLDADAVFFVSWGQ 209
S+R ++ G ++ L F RSKLLR L+ YRL +L ANP FV PTHLDADA+ V+ G+
Sbjct: 260 STRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLDADAILLVTGGR 319
Query: 210 GTITVIRENNRESYNVKRGDIIRVPSGNTFYVTNTDDDEKLYIVKFIKSINLPGQYEAFY 269
G + +I +NRESYN++ GD+IR+P+G TFY+ N D++E+L+I KF+++I+ PGQY+ F+
Sbjct: 320 GALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQTISTPGQYKEFF 379
Query: 270 GAGGENPESFLRAFSWEILESAFKTKRDSLERVLFQQDQGAMVKASKQQIRALSRSQEGP 329
AGG+NPE +L FS EILE+A T+ + L VL QQ +G ++ AS++QIR L+R
Sbjct: 380 PAGGQNPEPYLSTFSKEILEAALNTQAERLRGVLGQQREGVIISASQEQIRELTRDDSES 439
Query: 330 SIWPF--AGES-RGTFNLFGKRPSHSNNFGELFEADSNDFRPLEDLDITVSYANISKGAM 386
W GES RG +NLF KRP +SN +G+ +E D+R L+D+D++V ANI++G+M
Sbjct: 440 RRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQLQDMDVSVFIANITQGSM 499
Query: 387 AAPFYNSRSTKVAVVVAGDGYIEIACPHVSRSSSERRHQGSSTREEGSATYHKVSSRIRT 446
PF+N+RSTKV VV +G+ +E+ACPH+S RR G EE Y +V +R+
Sbjct: 500 MGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRRG-GKRHEEEEDVHYEQVKARLSK 558
Query: 447 DSAYIVPAGHPVVTVASQNNNLEVVCFEINAEGNIRFPLAGRNK-IFKVMESEAKELAFN 505
A +VP GHPVV V+S N NL + F INA+ N LAGR + + + +E +A ELAF
Sbjct: 559 REAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFA 618
Query: 506 TRADEVERVFGNQDQDWFFKGPSRWHQQQQGRA 538
EVE +F +QD+ FF GP R HQQQ R+
Sbjct: 619 APRKEVEELFNSQDESIFFPGP-RQHQQQSSRS 650
|
|
| UNIPROTKB|Q9SPL3 AMP2-3 "Vicilin-like antimicrobial peptides 2-3" [Macadamia integrifolia (taxid:60698)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9SPL5 AMP2-1 "Vicilin-like antimicrobial peptides 2-1" [Macadamia integrifolia (taxid:60698)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2094404 PAP85 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2056568 AT2G28490 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046273 AT2G18540 "AT2G18540" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2115390 AT4G36700 "AT4G36700" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9XHP0 Q9XHP0 "11S globulin seed storage protein 2" [Sesamum indicum (taxid:4182)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2065516 AT2G28680 "AT2G28680" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2026545 AT1G07750 "AT1G07750" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00023755001 | SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (520 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 540 | |||
| smart00835 | 146 | smart00835, Cupin_1, Cupin | 1e-41 | |
| pfam00190 | 139 | pfam00190, Cupin_1, Cupin | 1e-22 | |
| pfam00190 | 139 | pfam00190, Cupin_1, Cupin | 7e-16 | |
| smart00835 | 146 | smart00835, Cupin_1, Cupin | 9e-10 | |
| pfam04702 | 147 | pfam04702, Vicilin_N, Vicilin N terminal region | 2e-06 | |
| PLN00212 | 493 | PLN00212, PLN00212, glutelin; Provisional | 9e-04 | |
| COG0662 | 127 | COG0662, {ManC}, Mannose-6-phosphate isomerase [Ca | 0.002 | |
| pfam11699 | 85 | pfam11699, Mif2, Mif2/CENP-C like | 0.002 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 0.002 |
| >gnl|CDD|214845 smart00835, Cupin_1, Cupin | Back alignment and domain information |
|---|
Score = 146 bits (370), Expect = 1e-41
Identities = 54/168 (32%), Positives = 75/168 (44%), Gaps = 22/168 (13%)
Query: 345 FGKRPSHSNNFGELFEADSNDFRPLEDLDITVSYANISKGAMAAPFYNSRSTKVAVVVAG 404
RP SN G L EAD +F L L I+ + N+ G M P Y+ R+T++ VV G
Sbjct: 1 LEPRPDFSNEGGRLREADPTNFPALNGLGISAARVNLEPGGMLPPHYHPRATELLYVVRG 60
Query: 405 DGYIEIACPHVSRSSSERRHQGSSTREEGSATYHKVSSRIRTDSAYIVPAGHPVVTVASQ 464
+G + + P+ +R+R ++VP GHP V S
Sbjct: 61 EGRVGVVDPN---------------------GNKVYDARLREGDVFVVPQGHPHFQVNSG 99
Query: 465 NNNLEVVCFEINAEGNIRFPLAGRNKIFKVMESEAKELAFNTRADEVE 512
+ NLE V F N N RF LAGRN + + + E AF A+EV
Sbjct: 100 DENLEFVAFNTNDP-NRRFFLAGRNSVLRGLPPEVLAAAFGVSAEEVR 146
|
This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel). This family contains 11S and 7S plant seed storage proteins, and germins. Plant seed storage proteins provide the major nitrogen source for the developing plant. Length = 146 |
| >gnl|CDD|215780 pfam00190, Cupin_1, Cupin | Back alignment and domain information |
|---|
| >gnl|CDD|215780 pfam00190, Cupin_1, Cupin | Back alignment and domain information |
|---|
| >gnl|CDD|214845 smart00835, Cupin_1, Cupin | Back alignment and domain information |
|---|
| >gnl|CDD|218218 pfam04702, Vicilin_N, Vicilin N terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|215106 PLN00212, PLN00212, glutelin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223734 COG0662, {ManC}, Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|152135 pfam11699, Mif2, Mif2/CENP-C like | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 540 | |||
| PLN00212 | 493 | glutelin; Provisional | 100.0 | |
| TIGR03404 | 367 | bicupin_oxalic bicupin, oxalate decarboxylase fami | 100.0 | |
| PLN00212 | 493 | glutelin; Provisional | 99.94 | |
| PF00190 | 144 | Cupin_1: Cupin; InterPro: IPR006045 This family re | 99.94 | |
| smart00835 | 146 | Cupin_1 Cupin. This family represents the conserve | 99.88 | |
| PF00190 | 144 | Cupin_1: Cupin; InterPro: IPR006045 This family re | 99.87 | |
| TIGR03404 | 367 | bicupin_oxalic bicupin, oxalate decarboxylase fami | 99.81 | |
| smart00835 | 146 | Cupin_1 Cupin. This family represents the conserve | 99.78 | |
| COG2140 | 209 | Thermophilic glucose-6-phosphate isomerase and rel | 99.71 | |
| TIGR03214 | 260 | ura-cupin putative allantoin catabolism protein. T | 99.56 | |
| PRK11171 | 266 | hypothetical protein; Provisional | 99.52 | |
| PF04702 | 147 | Vicilin_N: Vicilin N terminal region; InterPro: IP | 99.29 | |
| COG2140 | 209 | Thermophilic glucose-6-phosphate isomerase and rel | 99.27 | |
| COG0662 | 127 | {ManC} Mannose-6-phosphate isomerase [Carbohydrate | 99.22 | |
| PF04702 | 147 | Vicilin_N: Vicilin N terminal region; InterPro: IP | 99.14 | |
| PF07883 | 71 | Cupin_2: Cupin domain; InterPro: IPR013096 This fa | 99.12 | |
| TIGR02272 | 335 | gentisate_1_2 gentisate 1,2-dioxygenase. This fami | 99.07 | |
| PRK13290 | 125 | ectC L-ectoine synthase; Reviewed | 98.92 | |
| PRK04190 | 191 | glucose-6-phosphate isomerase; Provisional | 98.91 | |
| PRK04190 | 191 | glucose-6-phosphate isomerase; Provisional | 98.9 | |
| TIGR03214 | 260 | ura-cupin putative allantoin catabolism protein. T | 98.9 | |
| COG1917 | 131 | Uncharacterized conserved protein, contains double | 98.9 | |
| COG3837 | 161 | Uncharacterized conserved protein, contains double | 98.85 | |
| PF07883 | 71 | Cupin_2: Cupin domain; InterPro: IPR013096 This fa | 98.79 | |
| COG3435 | 351 | Gentisate 1,2-dioxygenase [Secondary metabolites b | 98.74 | |
| COG0662 | 127 | {ManC} Mannose-6-phosphate isomerase [Carbohydrate | 98.64 | |
| PF01050 | 151 | MannoseP_isomer: Mannose-6-phosphate isomerase; In | 98.57 | |
| PRK09943 | 185 | DNA-binding transcriptional repressor PuuR; Provis | 98.57 | |
| PRK11171 | 266 | hypothetical protein; Provisional | 98.56 | |
| TIGR01479 | 468 | GMP_PMI mannose-1-phosphate guanylyltransferase/ma | 98.52 | |
| COG1917 | 131 | Uncharacterized conserved protein, contains double | 98.51 | |
| PRK15460 | 478 | cpsB mannose-1-phosphate guanyltransferase; Provis | 98.48 | |
| PRK13290 | 125 | ectC L-ectoine synthase; Reviewed | 98.47 | |
| COG3837 | 161 | Uncharacterized conserved protein, contains double | 98.39 | |
| PF02041 | 167 | Auxin_BP: Auxin binding protein; InterPro: IPR0005 | 98.37 | |
| COG4101 | 142 | Predicted mannose-6-phosphate isomerase [Carbohydr | 98.36 | |
| PRK09943 | 185 | DNA-binding transcriptional repressor PuuR; Provis | 98.23 | |
| PF11699 | 85 | CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B. | 98.19 | |
| PF03079 | 157 | ARD: ARD/ARD' family; InterPro: IPR004313 The two | 98.18 | |
| PF01050 | 151 | MannoseP_isomer: Mannose-6-phosphate isomerase; In | 98.17 | |
| PF06560 | 182 | GPI: Glucose-6-phosphate isomerase (GPI); InterPro | 98.14 | |
| TIGR01479 | 468 | GMP_PMI mannose-1-phosphate guanylyltransferase/ma | 98.12 | |
| PF06560 | 182 | GPI: Glucose-6-phosphate isomerase (GPI); InterPro | 98.08 | |
| PRK15457 | 233 | ethanolamine utilization protein EutQ; Provisional | 98.06 | |
| COG3257 | 264 | GlxB Uncharacterized protein, possibly involved in | 98.05 | |
| PRK13264 | 177 | 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | 98.03 | |
| COG4297 | 163 | Uncharacterized protein containing double-stranded | 98.02 | |
| PF02311 | 136 | AraC_binding: AraC-like ligand binding domain; Int | 98.0 | |
| TIGR03037 | 159 | anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | 97.99 | |
| PRK15460 | 478 | cpsB mannose-1-phosphate guanyltransferase; Provis | 97.99 | |
| COG4101 | 142 | Predicted mannose-6-phosphate isomerase [Carbohydr | 97.9 | |
| COG1791 | 181 | Uncharacterized conserved protein, contains double | 97.89 | |
| PF05899 | 74 | Cupin_3: Protein of unknown function (DUF861); Int | 97.78 | |
| PF03079 | 157 | ARD: ARD/ARD' family; InterPro: IPR004313 The two | 97.62 | |
| PRK10371 | 302 | DNA-binding transcriptional regulator MelR; Provis | 97.53 | |
| PF06249 | 152 | EutQ: Ethanolamine utilisation protein EutQ; Inter | 97.49 | |
| PRK13264 | 177 | 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | 97.49 | |
| PF02311 | 136 | AraC_binding: AraC-like ligand binding domain; Int | 97.41 | |
| PRK10296 | 278 | DNA-binding transcriptional regulator ChbR; Provis | 97.4 | |
| TIGR02451 | 215 | anti_sig_ChrR anti-sigma factor, putative, ChrR fa | 97.33 | |
| PF11699 | 85 | CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B. | 97.32 | |
| PRK15457 | 233 | ethanolamine utilization protein EutQ; Provisional | 97.26 | |
| TIGR03037 | 159 | anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | 97.26 | |
| COG1791 | 181 | Uncharacterized conserved protein, contains double | 97.26 | |
| PRK13500 | 312 | transcriptional activator RhaR; Provisional | 97.26 | |
| PF06339 | 126 | Ectoine_synth: Ectoine synthase; InterPro: IPR0104 | 97.25 | |
| PF12973 | 91 | Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ | 97.24 | |
| PF02041 | 167 | Auxin_BP: Auxin binding protein; InterPro: IPR0005 | 97.15 | |
| PRK13501 | 290 | transcriptional activator RhaR; Provisional | 97.14 | |
| COG4297 | 163 | Uncharacterized protein containing double-stranded | 97.14 | |
| COG4766 | 176 | EutQ Ethanolamine utilization protein [Amino acid | 97.08 | |
| TIGR02272 | 335 | gentisate_1_2 gentisate 1,2-dioxygenase. This fami | 97.05 | |
| PRK13503 | 278 | transcriptional activator RhaS; Provisional | 96.98 | |
| COG3450 | 116 | Predicted enzyme of the cupin superfamily [General | 96.95 | |
| PF06052 | 151 | 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte | 96.95 | |
| PRK13502 | 282 | transcriptional activator RhaR; Provisional | 96.82 | |
| PF05523 | 131 | FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 | 96.82 | |
| TIGR02297 | 287 | HpaA 4-hydroxyphenylacetate catabolism regulatory | 96.79 | |
| PF06339 | 126 | Ectoine_synth: Ectoine synthase; InterPro: IPR0104 | 96.79 | |
| PF05523 | 131 | FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 | 96.75 | |
| PF05899 | 74 | Cupin_3: Protein of unknown function (DUF861); Int | 96.71 | |
| PRK13501 | 290 | transcriptional activator RhaR; Provisional | 96.62 | |
| PF12973 | 91 | Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ | 96.52 | |
| PRK15131 | 389 | mannose-6-phosphate isomerase; Provisional | 96.51 | |
| TIGR00218 | 302 | manA mannose-6-phosphate isomerase, class I. The n | 96.44 | |
| PRK10371 | 302 | DNA-binding transcriptional regulator MelR; Provis | 96.43 | |
| PRK10296 | 278 | DNA-binding transcriptional regulator ChbR; Provis | 96.42 | |
| PRK13500 | 312 | transcriptional activator RhaR; Provisional | 96.4 | |
| TIGR02297 | 287 | HpaA 4-hydroxyphenylacetate catabolism regulatory | 96.31 | |
| TIGR02451 | 215 | anti_sig_ChrR anti-sigma factor, putative, ChrR fa | 96.3 | |
| PF14499 | 251 | DUF4437: Domain of unknown function (DUF4437); PDB | 96.23 | |
| PRK13502 | 282 | transcriptional activator RhaR; Provisional | 96.22 | |
| KOG2107 | 179 | consensus Uncharacterized conserved protein, conta | 96.07 | |
| PRK10572 | 290 | DNA-binding transcriptional regulator AraC; Provis | 96.02 | |
| PF06249 | 152 | EutQ: Ethanolamine utilisation protein EutQ; Inter | 95.73 | |
| PF14499 | 251 | DUF4437: Domain of unknown function (DUF4437); PDB | 95.67 | |
| PRK13503 | 278 | transcriptional activator RhaS; Provisional | 95.65 | |
| COG3435 | 351 | Gentisate 1,2-dioxygenase [Secondary metabolites b | 95.55 | |
| PF12852 | 186 | Cupin_6: Cupin | 95.53 | |
| TIGR01221 | 176 | rmlC dTDP-4-dehydrorhamnose 3,5-epimerase. This en | 95.37 | |
| TIGR01015 | 429 | hmgA homogentisate 1,2-dioxygenase. Missing in hum | 95.36 | |
| COG1482 | 312 | ManA Phosphomannose isomerase [Carbohydrate transp | 95.36 | |
| PF13621 | 251 | Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU | 95.33 | |
| PRK05341 | 438 | homogentisate 1,2-dioxygenase; Provisional | 95.23 | |
| PF08007 | 319 | Cupin_4: Cupin superfamily protein; InterPro: IPR0 | 95.19 | |
| COG1898 | 173 | RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and rela | 95.08 | |
| PF00908 | 176 | dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimer | 95.01 | |
| COG3450 | 116 | Predicted enzyme of the cupin superfamily [General | 94.88 | |
| PF13621 | 251 | Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU | 94.81 | |
| COG1741 | 276 | Pirin-related protein [General function prediction | 94.72 | |
| KOG2107 | 179 | consensus Uncharacterized conserved protein, conta | 94.22 | |
| COG4766 | 176 | EutQ Ethanolamine utilization protein [Amino acid | 94.04 | |
| PLN02288 | 394 | mannose-6-phosphate isomerase | 94.04 | |
| PF08007 | 319 | Cupin_4: Cupin superfamily protein; InterPro: IPR0 | 93.38 | |
| PF00908 | 176 | dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimer | 93.21 | |
| TIGR01221 | 176 | rmlC dTDP-4-dehydrorhamnose 3,5-epimerase. This en | 93.12 | |
| PRK00924 | 276 | 5-keto-4-deoxyuronate isomerase; Provisional | 92.66 | |
| PF05995 | 175 | CDO_I: Cysteine dioxygenase type I; InterPro: IPR0 | 92.44 | |
| PF04209 | 424 | HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR | 92.23 | |
| PF04209 | 424 | HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR | 91.86 | |
| PF05118 | 163 | Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxyl | 91.84 | |
| PF02373 | 114 | JmjC: JmjC domain, hydroxylase; InterPro: IPR01312 | 91.69 | |
| KOG2757 | 411 | consensus Mannose-6-phosphate isomerase [Carbohydr | 91.67 | |
| COG3257 | 264 | GlxB Uncharacterized protein, possibly involved in | 91.56 | |
| PF06052 | 151 | 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte | 90.91 | |
| KOG2757 | 411 | consensus Mannose-6-phosphate isomerase [Carbohydr | 90.81 | |
| PRK15131 | 389 | mannose-6-phosphate isomerase; Provisional | 90.81 | |
| PF13759 | 101 | 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB | 90.7 | |
| PF12852 | 186 | Cupin_6: Cupin | 90.47 | |
| TIGR02466 | 201 | conserved hypothetical protein. This family consis | 90.43 | |
| KOG3706 | 629 | consensus Uncharacterized conserved protein [Funct | 90.3 | |
| COG1898 | 173 | RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and rela | 89.92 | |
| PF14861 | 31 | Antimicrobial21: Plant antimicrobial peptide | 89.88 | |
| PRK05341 | 438 | homogentisate 1,2-dioxygenase; Provisional | 88.79 | |
| PLN02288 | 394 | mannose-6-phosphate isomerase | 88.47 | |
| PRK09685 | 302 | DNA-binding transcriptional activator FeaR; Provis | 87.9 | |
| TIGR01015 | 429 | hmgA homogentisate 1,2-dioxygenase. Missing in hum | 87.87 | |
| PLN02658 | 435 | homogentisate 1,2-dioxygenase | 87.85 | |
| PF05726 | 104 | Pirin_C: Pirin C-terminal cupin domain; InterPro: | 87.73 | |
| PLN02658 | 435 | homogentisate 1,2-dioxygenase | 87.4 | |
| PF11142 | 63 | DUF2917: Protein of unknown function (DUF2917); In | 86.54 | |
| KOG3995 | 279 | consensus 3-hydroxyanthranilate oxygenase HAAO [Am | 85.27 | |
| TIGR00218 | 302 | manA mannose-6-phosphate isomerase, class I. The n | 84.67 | |
| COG3542 | 162 | Uncharacterized conserved protein [Function unknow | 84.41 | |
| COG2850 | 383 | Uncharacterized conserved protein [Function unknow | 84.2 | |
| PF06865 | 94 | DUF1255: Protein of unknown function (DUF1255); In | 83.57 | |
| KOG3706 | 629 | consensus Uncharacterized conserved protein [Funct | 83.16 | |
| PRK10579 | 94 | hypothetical protein; Provisional | 82.64 | |
| PF06172 | 139 | Cupin_5: Cupin superfamily (DUF985); InterPro: IPR | 82.6 | |
| PF05118 | 163 | Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxyl | 81.73 | |
| PF05726 | 104 | Pirin_C: Pirin C-terminal cupin domain; InterPro: | 81.41 | |
| PF09313 | 82 | DUF1971: Domain of unknown function (DUF1971); Int | 80.91 | |
| PF02678 | 107 | Pirin: Pirin; InterPro: IPR003829 This entry repre | 80.86 | |
| PF02373 | 114 | JmjC: JmjC domain, hydroxylase; InterPro: IPR01312 | 80.66 |
| >PLN00212 glutelin; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.1e-70 Score=588.18 Aligned_cols=347 Identities=18% Similarity=0.336 Sum_probs=301.2
Q ss_pred ceeecCCceEEEeccCcccccccc--ccccceeeeeeeCCCccccccccCCCeEEEEEeeEEEEEEEecCCceEE-----
Q 040805 151 SRVTSQHGRVAFLPKFTQRSKLLR--GLEKYRLGILIANPQTFVTPTHLDADAVFFVSWGQGTITVIRENNRESY----- 223 (540)
Q Consensus 151 ~~~~~e~G~i~~l~~f~~~~~~L~--Gi~~~rl~~~~l~Pggl~~Ph~~~A~ei~yV~~G~g~ig~V~~~~~~~~----- 223 (540)
.+|++|+|.++.| |+++++|+ |++.+|+ +|+|+|+++|||++|++++||++|+|++|+|.|||+++|
T Consensus 56 ~ri~se~G~~E~~---~~~~~q~~caGv~~~R~---~i~p~gL~lP~y~na~~liyV~qG~G~~G~v~pGcpeT~~~~~~ 129 (493)
T PLN00212 56 RKVRSEAGVTEYF---DEKNEQFQCTGVFVIRR---VIEPQGLLLPRYSNTPGLVYIIQGRGSMGLTFPGCPATYQQQFQ 129 (493)
T ss_pred hhhcccCceeeec---CCCChhhcccceEEEEE---EecCCcccCccccCCCeEEEEEeCeEEEEEEeCCCcchhhhhcc
Confidence 4889999999885 78899999 9998888 999999999999999999999999999999999988774
Q ss_pred ---------------------eeCCCcEEEECCCCeEEEEeCCCCccEEEEEEeecCCC----CCcccccccCCCCC---
Q 040805 224 ---------------------NVKRGDIIRVPSGNTFYVTNTDDDEKLYIVKFIKSINL----PGQYEAFYGAGGEN--- 275 (540)
Q Consensus 224 ---------------------~l~~GDv~~iPaG~~h~~~N~g~~e~l~~v~i~~~~~~----pg~~~~f~LaG~~~--- 275 (540)
+|++||||+||||++||++|+| ++++++|++++++|. +..++.|||||+.+
T Consensus 130 ~~~~~~~~~~~~~~d~hqkv~~lr~GDViaiPaG~~hw~yN~G-d~~~v~v~~~d~~n~~Nqld~~~r~F~LaG~~~~~~ 208 (493)
T PLN00212 130 QFLTEGQSQSQKFRDEHQKIHQFRQGDVVALPAGVAHWFYNDG-DAPVVALYVYDINNNANQLEPRQREFLLAGNNNRQQ 208 (493)
T ss_pred cccccccccccccccccccceEeccCCEEEECCCCeEEEEeCC-CCcEEEEEEEeccccccccCCCcceeeccCCCcccc
Confidence 8999999999999999999998 568999999988774 22457999999975
Q ss_pred -----------cccccccCCHHHHHHhcCCCHHHHHHHhccCC-CCcEEEccchhhhccCCCCC----------------
Q 040805 276 -----------PESFLRAFSWEILESAFKTKRDSLERVLFQQD-QGAMVKASKQQIRALSRSQE---------------- 327 (540)
Q Consensus 276 -----------~~s~l~~f~~evLa~Af~v~~~~v~~l~~~q~-~g~Iv~~~~e~l~~l~~~~~---------------- 327 (540)
+.|||+||++++|++||||+.+++++|+++++ .|.||+++. .++.++|..+
T Consensus 209 ~~~~~~~~~~~~~nifsGF~~e~La~Afnv~~e~~~klq~~~d~rG~IVrv~~-~l~~~~P~~~~~~e~~~~~~~~~~~~ 287 (493)
T PLN00212 209 QVYGRSIEQHSGQNIFSGFSTELLSEALGINAQVAKRLQSQNDQRGEIIRVKN-GLQLLQPTLTQQQEQAQQQQQRLYQQ 287 (493)
T ss_pred ccccccccccccCchhhcCCHHHHHHHHCCCHHHHHHHhccccCCccEEEECC-CcccCCCchhhhhHHHHhhhhccccc
Confidence 35799999999999999999999999998875 599999975 4554444320
Q ss_pred ------CCCcCC-CCCCCC-ceeEcC------CCCCcccCCCceEEEecCCCCCCCccccceEEEEEEcCCCcccccccC
Q 040805 328 ------GPSIWP-FAGESR-GTFNLF------GKRPSHSNNFGELFEADSNDFRPLEDLDITVSYANISKGAMAAPFYNS 393 (540)
Q Consensus 328 ------~~s~~~-~~~~~~-~~fnL~------~~~P~~~n~~G~~~~~~~~~~p~L~~l~isv~~~~L~pggm~~PH~h~ 393 (540)
..+.|. .+..++ -+++|. +..|+|++.+|+++++++.+||+|+.++|++.+++|.||||++||||+
T Consensus 288 ~~~~~~~~~~~~~ngleEt~c~~rlr~Ni~~p~~ad~y~~~~G~it~v~~~~~P~L~~L~LSa~rv~L~~gam~~PHwn~ 367 (493)
T PLN00212 288 VQYQQSQQTSGRWNGLDENFCTIKVRLNIENPSRADTYNPRAGRITRLNSQKFPILNLIQMSATRVNLYQNALLSPFWNV 367 (493)
T ss_pred chhhhccccccCCCCccccccccccccccCCccccCccCCCceEEEEechhhCccccccCeeEEEEEEcCCcccCCeecC
Confidence 000011 111111 144444 346689999999999999999999999999999999999999999999
Q ss_pred CCcEEEEEEeceEEEEEEcCCCCCCcccccccCCCccccCCccceEEeeeeCCCcEEEECCCCeEEEEecCCCCEEEEEE
Q 040805 394 RSTKVAVVVAGDGYIEIACPHVSRSSSERRHQGSSTREEGSATYHKVSSRIRTDSAYIVPAGHPVVTVASQNNNLEVVCF 473 (540)
Q Consensus 394 ~A~ei~yV~~G~g~v~vv~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~GDV~vVPaG~~h~~~n~~~e~l~~v~F 473 (540)
||++|+||++|+|+++||++++. ++|+.+|++|||||||+||+|++.|+ ++++.|++|
T Consensus 368 nA~eI~yV~rG~g~vqvV~~~g~---------------------~vf~~~L~~GdvfVVPqg~~v~~~A~-~egfe~v~F 425 (493)
T PLN00212 368 NAHSVVYITQGRARVQVVSNNGK---------------------TVFNGVLRPGQLLIIPQHYAVLKKAE-REGCQYIAF 425 (493)
T ss_pred CCCEEEEEeecceEEEEEcCCCC---------------------EEEEEEEcCCCEEEECCCCeEEEeec-CCceEEEEe
Confidence 99999999999999999998763 68999999999999999999999887 678999999
Q ss_pred EecCCCCccccccccccccccCCHHHHHHHcCCCHHHHHHhhcCCCCceEEcCCC
Q 040805 474 EINAEGNIRFPLAGRNKIFKVMESEAKELAFNTRADEVERVFGNQDQDWFFKGPS 528 (540)
Q Consensus 474 ~~~a~~~~~~~LAG~~svl~~~~~evla~AF~vs~e~v~kl~~~q~e~~f~~~~~ 528 (540)
++++ ++..++|||++|+|++||.+||++||+++.++|++|+.++++++|+.+|.
T Consensus 426 ~tna-~~~~s~laG~~Sv~~alp~eVla~Af~is~eea~~lk~n~~~e~~~~~p~ 479 (493)
T PLN00212 426 KTNA-NAMVSHIAGKNSIFRALPVDVIANAYRISREEARRLKNNRGDELGAFTPR 479 (493)
T ss_pred ecCC-CccccccccHHHHHHhCCHHHHHHHcCCCHHHHHHHHhcccCceeecCCC
Confidence 9998 67899999999999999999999999999999999999987776666664
|
|
| >TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family | Back alignment and domain information |
|---|
| >PLN00212 glutelin; Provisional | Back alignment and domain information |
|---|
| >PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >smart00835 Cupin_1 Cupin | Back alignment and domain information |
|---|
| >PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family | Back alignment and domain information |
|---|
| >smart00835 Cupin_1 Cupin | Back alignment and domain information |
|---|
| >COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03214 ura-cupin putative allantoin catabolism protein | Back alignment and domain information |
|---|
| >PRK11171 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF04702 Vicilin_N: Vicilin N terminal region; InterPro: IPR006792 This region is found in plant seed storage proteins, N-terminal to the Cupin domain (IPR006045 from INTERPRO) | Back alignment and domain information |
|---|
| >COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF04702 Vicilin_N: Vicilin N terminal region; InterPro: IPR006792 This region is found in plant seed storage proteins, N-terminal to the Cupin domain (IPR006045 from INTERPRO) | Back alignment and domain information |
|---|
| >PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PRK13290 ectC L-ectoine synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK04190 glucose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK04190 glucose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR03214 ura-cupin putative allantoin catabolism protein | Back alignment and domain information |
|---|
| >COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 | Back alignment and domain information |
|---|
| >PRK09943 DNA-binding transcriptional repressor PuuR; Provisional | Back alignment and domain information |
|---|
| >PRK11171 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13290 ectC L-ectoine synthase; Reviewed | Back alignment and domain information |
|---|
| >COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) | Back alignment and domain information |
|---|
| >COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09943 DNA-binding transcriptional repressor PuuR; Provisional | Back alignment and domain information |
|---|
| >PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B | Back alignment and domain information |
|---|
| >PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] | Back alignment and domain information |
|---|
| >PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 | Back alignment and domain information |
|---|
| >PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 | Back alignment and domain information |
|---|
| >TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 | Back alignment and domain information |
|---|
| >PRK15457 ethanolamine utilization protein EutQ; Provisional | Back alignment and domain information |
|---|
| >COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC | Back alignment and domain information |
|---|
| >TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | Back alignment and domain information |
|---|
| >PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown | Back alignment and domain information |
|---|
| >PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] | Back alignment and domain information |
|---|
| >PRK10371 DNA-binding transcriptional regulator MelR; Provisional | Back alignment and domain information |
|---|
| >PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine | Back alignment and domain information |
|---|
| >PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC | Back alignment and domain information |
|---|
| >PRK10296 DNA-binding transcriptional regulator ChbR; Provisional | Back alignment and domain information |
|---|
| >TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family | Back alignment and domain information |
|---|
| >PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B | Back alignment and domain information |
|---|
| >PRK15457 ethanolamine utilization protein EutQ; Provisional | Back alignment and domain information |
|---|
| >TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | Back alignment and domain information |
|---|
| >COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK13500 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins | Back alignment and domain information |
|---|
| >PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A | Back alignment and domain information |
|---|
| >PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) | Back alignment and domain information |
|---|
| >PRK13501 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown] | Back alignment and domain information |
|---|
| >COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PRK13503 transcriptional activator RhaS; Provisional | Back alignment and domain information |
|---|
| >COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 | Back alignment and domain information |
|---|
| >PRK13502 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] | Back alignment and domain information |
|---|
| >TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA | Back alignment and domain information |
|---|
| >PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins | Back alignment and domain information |
|---|
| >PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] | Back alignment and domain information |
|---|
| >PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown | Back alignment and domain information |
|---|
| >PRK13501 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A | Back alignment and domain information |
|---|
| >PRK15131 mannose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR00218 manA mannose-6-phosphate isomerase, class I | Back alignment and domain information |
|---|
| >PRK10371 DNA-binding transcriptional regulator MelR; Provisional | Back alignment and domain information |
|---|
| >PRK10296 DNA-binding transcriptional regulator ChbR; Provisional | Back alignment and domain information |
|---|
| >PRK13500 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA | Back alignment and domain information |
|---|
| >TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family | Back alignment and domain information |
|---|
| >PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A | Back alignment and domain information |
|---|
| >PRK13502 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK10572 DNA-binding transcriptional regulator AraC; Provisional | Back alignment and domain information |
|---|
| >PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine | Back alignment and domain information |
|---|
| >PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A | Back alignment and domain information |
|---|
| >PRK13503 transcriptional activator RhaS; Provisional | Back alignment and domain information |
|---|
| >COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF12852 Cupin_6: Cupin | Back alignment and domain information |
|---|
| >TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase | Back alignment and domain information |
|---|
| >TIGR01015 hmgA homogentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >COG1482 ManA Phosphomannose isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A | Back alignment and domain information |
|---|
| >PRK05341 homogentisate 1,2-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors | Back alignment and domain information |
|---|
| >COG1898 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF00908 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5 | Back alignment and domain information |
|---|
| >COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A | Back alignment and domain information |
|---|
| >COG1741 Pirin-related protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02288 mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors | Back alignment and domain information |
|---|
| >PF00908 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5 | Back alignment and domain information |
|---|
| >TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase | Back alignment and domain information |
|---|
| >PRK00924 5-keto-4-deoxyuronate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF05995 CDO_I: Cysteine dioxygenase type I; InterPro: IPR010300 Cysteine dioxygenase type I (1 | Back alignment and domain information |
|---|
| >PF04209 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR005708 Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism | Back alignment and domain information |
|---|
| >PF04209 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR005708 Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism | Back alignment and domain information |
|---|
| >PF05118 Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxylase; InterPro: IPR007803 The alpha-ketoglutarate-dependent dioxygenase aspartyl (asparaginyl) beta-hydroxylase (1 | Back alignment and domain information |
|---|
| >PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [] | Back alignment and domain information |
|---|
| >KOG2757 consensus Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] | Back alignment and domain information |
|---|
| >PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 | Back alignment and domain information |
|---|
| >KOG2757 consensus Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15131 mannose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF13759 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A | Back alignment and domain information |
|---|
| >PF12852 Cupin_6: Cupin | Back alignment and domain information |
|---|
| >TIGR02466 conserved hypothetical protein | Back alignment and domain information |
|---|
| >KOG3706 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG1898 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF14861 Antimicrobial21: Plant antimicrobial peptide | Back alignment and domain information |
|---|
| >PRK05341 homogentisate 1,2-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >PLN02288 mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >PRK09685 DNA-binding transcriptional activator FeaR; Provisional | Back alignment and domain information |
|---|
| >TIGR01015 hmgA homogentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PLN02658 homogentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PF05726 Pirin_C: Pirin C-terminal cupin domain; InterPro: IPR008778 This entry represents C-terminal domain of Pirin proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >PLN02658 homogentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PF11142 DUF2917: Protein of unknown function (DUF2917); InterPro: IPR021317 This bacterial family of proteins appears to be restricted to Proteobacteria | Back alignment and domain information |
|---|
| >KOG3995 consensus 3-hydroxyanthranilate oxygenase HAAO [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00218 manA mannose-6-phosphate isomerase, class I | Back alignment and domain information |
|---|
| >COG3542 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG2850 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06865 DUF1255: Protein of unknown function (DUF1255); InterPro: IPR009664 This family consists of several conserved hypothetical bacterial proteins of around 95 residues in length | Back alignment and domain information |
|---|
| >KOG3706 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK10579 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF06172 Cupin_5: Cupin superfamily (DUF985); InterPro: IPR009327 This is a family of uncharacterised proteins found in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >PF05118 Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxylase; InterPro: IPR007803 The alpha-ketoglutarate-dependent dioxygenase aspartyl (asparaginyl) beta-hydroxylase (1 | Back alignment and domain information |
|---|
| >PF05726 Pirin_C: Pirin C-terminal cupin domain; InterPro: IPR008778 This entry represents C-terminal domain of Pirin proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >PF09313 DUF1971: Domain of unknown function (DUF1971); InterPro: IPR015392 This uncharacterised domain is predominantly found in bacterial Tellurite resistance proteins | Back alignment and domain information |
|---|
| >PF02678 Pirin: Pirin; InterPro: IPR003829 This entry represents N-terminal domain of Pirin proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 540 | ||||
| 1ipk_A | 416 | Crystal Structures Of Recombinant And Native Soybea | 6e-57 | ||
| 1ipj_A | 416 | Crystal Structures Of Recombinant And Native Soybea | 2e-56 | ||
| 3smh_A | 418 | Crystal Structure Of Major Peanut Allergen Ara H 1 | 6e-56 | ||
| 3s7e_A | 418 | Crystal Structure Of Ara H 1 Length = 418 | 8e-56 | ||
| 1uij_A | 416 | Crystal Structure Of Soybean Beta-Conglycinin Beta | 2e-55 | ||
| 1uik_A | 418 | Crystal Structure Of Soybean Beta-Conglycinin Alpha | 3e-55 | ||
| 2eaa_A | 433 | Crystal Structure Of Adzuki Bean 7s Globulin-3 Leng | 1e-50 | ||
| 2ea7_A | 434 | Crystal Structure Of Adzuki Bean 7s Globulin-1 Leng | 3e-48 | ||
| 2cau_A | 445 | Canavalin From Jack Bean Length = 445 | 9e-47 | ||
| 2cv6_A | 424 | Crystal Structure Of 8salpha Globulin, The Major Se | 6e-42 | ||
| 2phl_A | 397 | The Structure Of Phaseolin At 2.2 Angstroms Resolut | 1e-33 | ||
| 1cau_A | 181 | Determination Of Three Crystal Structures Of Canava | 1e-23 | ||
| 1dgr_A | 178 | Refined Crystal Structure Of Canavalin From Jack Be | 5e-23 | ||
| 1cau_B | 184 | Determination Of Three Crystal Structures Of Canava | 1e-14 | ||
| 1dgr_X | 79 | Refined Crystal Structure Of Canavalin From Jack Be | 2e-07 | ||
| 1fxz_A | 476 | Crystal Structure Of Soybean Proglycinin A1ab1b Hom | 7e-05 | ||
| 1ud1_A | 476 | Crystal Structure Of Proglycinin Mutant C88s Length | 7e-05 | ||
| 1ucx_A | 476 | Crystal Structure Of Proglycinin C12g Mutant Length | 7e-05 | ||
| 3kgl_A | 466 | Crystal Structure Of Procruciferin, 11s Globulin Fr | 4e-04 |
| >pdb|1IPK|A Chain A, Crystal Structures Of Recombinant And Native Soybean Beta- Conglycinin Beta Homotrimers Length = 416 | Back alignment and structure |
|
| >pdb|1IPJ|A Chain A, Crystal Structures Of Recombinant And Native Soybean Beta-Conglycinin Beta Homotrimers Complexes With N-Acetyl-D-Glucosamine Length = 416 | Back alignment and structure |
| >pdb|3SMH|A Chain A, Crystal Structure Of Major Peanut Allergen Ara H 1 Length = 418 | Back alignment and structure |
| >pdb|3S7E|A Chain A, Crystal Structure Of Ara H 1 Length = 418 | Back alignment and structure |
| >pdb|1UIJ|A Chain A, Crystal Structure Of Soybean Beta-Conglycinin Beta Homotrimer (I122mK124W) Length = 416 | Back alignment and structure |
| >pdb|1UIK|A Chain A, Crystal Structure Of Soybean Beta-Conglycinin Alpha Prime Homotrimer Length = 418 | Back alignment and structure |
| >pdb|2EAA|A Chain A, Crystal Structure Of Adzuki Bean 7s Globulin-3 Length = 433 | Back alignment and structure |
| >pdb|2EA7|A Chain A, Crystal Structure Of Adzuki Bean 7s Globulin-1 Length = 434 | Back alignment and structure |
| >pdb|2CAU|A Chain A, Canavalin From Jack Bean Length = 445 | Back alignment and structure |
| >pdb|2CV6|A Chain A, Crystal Structure Of 8salpha Globulin, The Major Seed Storage Protein Of Mungbean Length = 424 | Back alignment and structure |
| >pdb|2PHL|A Chain A, The Structure Of Phaseolin At 2.2 Angstroms Resolution: Implications For A Common Vicilin(Slash)legumin Structure And The Genetic Engineering Of Seed Storage Proteins Length = 397 | Back alignment and structure |
| >pdb|1CAU|A Chain A, Determination Of Three Crystal Structures Of Canavalin By Molecular Replacement Length = 181 | Back alignment and structure |
| >pdb|1DGR|A Chain A, Refined Crystal Structure Of Canavalin From Jack Bean Length = 178 | Back alignment and structure |
| >pdb|1CAU|B Chain B, Determination Of Three Crystal Structures Of Canavalin By Molecular Replacement Length = 184 | Back alignment and structure |
| >pdb|1DGR|X Chain X, Refined Crystal Structure Of Canavalin From Jack Bean Length = 79 | Back alignment and structure |
| >pdb|1FXZ|A Chain A, Crystal Structure Of Soybean Proglycinin A1ab1b Homotrimer Length = 476 | Back alignment and structure |
| >pdb|1UD1|A Chain A, Crystal Structure Of Proglycinin Mutant C88s Length = 476 | Back alignment and structure |
| >pdb|1UCX|A Chain A, Crystal Structure Of Proglycinin C12g Mutant Length = 476 | Back alignment and structure |
| >pdb|3KGL|A Chain A, Crystal Structure Of Procruciferin, 11s Globulin From Brassica Napus Length = 466 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 540 | |||
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 5e-93 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 5e-91 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 4e-08 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 1e-87 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 2e-07 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 1e-86 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 5e-08 | |
| 2phl_A | 397 | Phaseolin; plant SEED storage protein(vicilin); HE | 9e-79 | |
| 1dgw_A | 178 | Canavalin; duplicated swiss-roll beta barrels, loo | 6e-51 | |
| 1dgw_A | 178 | Canavalin; duplicated swiss-roll beta barrels, loo | 5e-05 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 2e-49 | |
| 3kgl_A | 466 | Cruciferin; 11S SEED globulin, rapeseed, SEED stor | 3e-47 | |
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 1e-46 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 9e-40 | |
| 3fz3_A | 531 | Prunin; TREE NUT allergen, allergy, amandin, almon | 2e-35 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 2e-34 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 4e-06 | |
| 1dgw_X | 79 | Canavalin; duplicated swiss-roll beta barrels, loo | 4e-27 | |
| 1dgw_Y | 93 | Canavalin; duplicated swiss-roll beta barrels, loo | 4e-25 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 4e-24 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 1e-08 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 9e-18 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 3e-16 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 5e-08 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 1e-07 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 5e-15 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 7e-07 | |
| 3cew_A | 125 | Uncharacterized cupin protein; all beta-protein, j | 1e-05 | |
| 1lr5_A | 163 | Auxin binding protein 1; beta jellyroll, double st | 2e-05 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 8e-05 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 1e-04 | |
| 1v70_A | 105 | Probable antibiotics synthesis protein; structural | 2e-04 | |
| 2gu9_A | 113 | Tetracenomycin polyketide synthesis protein; X-RAY | 2e-04 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 2e-04 | |
| 1x82_A | 190 | Glucose-6-phosphate isomerase; cupin superfamily, | 5e-04 | |
| 3nw4_A | 368 | Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc | 7e-04 | |
| 1o4t_A | 133 | Putative oxalate decarboxylase; double-stranded be | 7e-04 |
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Length = 418 | Back alignment and structure |
|---|
Score = 289 bits (740), Expect = 5e-93
Identities = 128/408 (31%), Positives = 209/408 (51%), Gaps = 30/408 (7%)
Query: 147 DEESSRVTSQHGRVAFLPKFTQRSKLLRGLEKYRLGILIANPQTFVTPTHLDADAVFFVS 206
S+R +Q+GR+ L +F QRS+ + L+ +R+ + A P T V P H DAD + +
Sbjct: 12 RRFSTRYGNQNGRIRVLQRFDQRSRQFQNLQNHRIVQIEAKPNTLVLPKHADADNILVIQ 71
Query: 207 WGQGTITVIRENNRESYNVKRGDIIRVPSGNTFYVTNTDDDEKLYIVKFIKSINLPGQYE 266
GQ T+TV NNR+S+N+ G +R+PSG Y+ N D++ L + K +N PGQ+E
Sbjct: 72 QGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKISMPVNTPGQFE 131
Query: 267 AFYGAGGENPESFLRAFSWEILESAFKTKRDSLERVLF---------------------Q 305
F+ A + S+L+ FS LE+AF + + + RVL +
Sbjct: 132 DFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEERGQRRWSTRSSE 191
Query: 306 QDQGAMVKASKQQIRALSRSQEGPSIW--PFAGESRGTFNLFGKRPSHSNNFGELFEADS 363
++G +VK SK+ + L++ + S G+ NL P SNNFG+LFE
Sbjct: 192 NNEGVIVKVSKEHVEELTKHAKSVSKKGSEEEGDITNPINLREGEPDLSNNFGKLFEVKP 251
Query: 364 NDFRP-LEDLDITVSYANISKGAMAAPFYNSRSTKVAVVVAGDGYIEIACPHVSRSSSER 422
+ P L+DLD+ ++ I +GA+ P +NS++ + VV G G +E+ + R
Sbjct: 252 DKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLELVAVRKEQQQRGR 311
Query: 423 RHQGSST---REEGSATYHKVSSRIRTDSAYIVPAGHPVVTVASQNNNLEVVCFEINAEG 479
R + E + + ++R++ +I+PA HPV AS + L ++ F INAE
Sbjct: 312 REEEEDEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINAS--SELHLLGFGINAEN 369
Query: 480 NIRFPLAG-RNKIFKVMESEAKELAFNTRADEVERVFGNQDQDWFFKG 526
N R LAG ++ + +E +AK+LAF ++VE++ NQ + F
Sbjct: 370 NHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQKESHFVSA 417
|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Length = 416 | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Length = 416 | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Length = 434 | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Length = 434 | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Length = 445 | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Length = 445 | Back alignment and structure |
|---|
| >2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Length = 397 | Back alignment and structure |
|---|
| >1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Length = 178 | Back alignment and structure |
|---|
| >1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Length = 178 | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Length = 459 | Back alignment and structure |
|---|
| >3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Length = 466 | Back alignment and structure |
|---|
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Length = 465 | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Length = 476 | Back alignment and structure |
|---|
| >3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Length = 531 | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Length = 510 | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Length = 510 | Back alignment and structure |
|---|
| >1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X Length = 79 | Back alignment and structure |
|---|
| >1dgw_Y Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_Y Length = 93 | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Length = 496 | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Length = 496 | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Length = 361 | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Length = 361 | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Length = 361 | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385 | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385 | Back alignment and structure |
|---|
| >3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Length = 125 | Back alignment and structure |
|---|
| >1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Length = 163 | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Length = 337 | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Length = 354 | Back alignment and structure |
|---|
| >1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Length = 105 | Back alignment and structure |
|---|
| >2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Length = 113 | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Length = 394 | Back alignment and structure |
|---|
| >1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Length = 190 | Back alignment and structure |
|---|
| >3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* Length = 368 | Back alignment and structure |
|---|
| >1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Length = 133 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 540 | |||
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 100.0 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 100.0 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 100.0 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 100.0 | |
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 100.0 | |
| 3kgl_A | 466 | Cruciferin; 11S SEED globulin, rapeseed, SEED stor | 100.0 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 100.0 | |
| 2phl_A | 397 | Phaseolin; plant SEED storage protein(vicilin); HE | 100.0 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 100.0 | |
| 3fz3_A | 531 | Prunin; TREE NUT allergen, allergy, amandin, almon | 100.0 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 100.0 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 100.0 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 100.0 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 100.0 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 100.0 | |
| 1dgw_A | 178 | Canavalin; duplicated swiss-roll beta barrels, loo | 100.0 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 99.96 | |
| 3kgl_A | 466 | Cruciferin; 11S SEED globulin, rapeseed, SEED stor | 99.95 | |
| 1dgw_A | 178 | Canavalin; duplicated swiss-roll beta barrels, loo | 99.95 | |
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 99.95 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 99.94 | |
| 3fz3_A | 531 | Prunin; TREE NUT allergen, allergy, amandin, almon | 99.94 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 99.94 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 99.93 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 99.93 | |
| 2phl_A | 397 | Phaseolin; plant SEED storage protein(vicilin); HE | 99.92 | |
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 99.92 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 99.91 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 99.9 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 99.89 | |
| 1fi2_A | 201 | Oxalate oxidase, germin; beta-jellyroll, oxidoredu | 99.89 | |
| 1dgw_Y | 93 | Canavalin; duplicated swiss-roll beta barrels, loo | 99.88 | |
| 1dgw_X | 79 | Canavalin; duplicated swiss-roll beta barrels, loo | 99.87 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 99.84 | |
| 1juh_A | 350 | Quercetin 2,3-dioxygenase; cupin, glycoprotein, be | 99.81 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 99.79 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 99.78 | |
| 1fi2_A | 201 | Oxalate oxidase, germin; beta-jellyroll, oxidoredu | 99.75 | |
| 1rc6_A | 261 | Hypothetical protein YLBA; structural genomics, NY | 99.7 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 99.69 | |
| 1sef_A | 274 | Conserved hypothetical protein; structural genomic | 99.66 | |
| 3rns_A | 227 | Cupin 2 conserved barrel domain protein; structura | 99.64 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 99.64 | |
| 4e2q_A | 266 | Ureidoglycine aminohydrolase; BI-cupin, manganese | 99.63 | |
| 3h7j_A | 243 | Bacilysin biosynthesis protein BACB; YWFC, bacilys | 99.61 | |
| 1sq4_A | 278 | GLXB, glyoxylate-induced protein; structural genom | 99.58 | |
| 3nw4_A | 368 | Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc | 99.57 | |
| 1sfn_A | 246 | Conserved hypothetical protein; structural genomic | 99.53 | |
| 1dgw_Y | 93 | Canavalin; duplicated swiss-roll beta barrels, loo | 99.38 | |
| 1lr5_A | 163 | Auxin binding protein 1; beta jellyroll, double st | 99.19 | |
| 3l2h_A | 162 | Putative sugar phosphate isomerase; AFE_0303, stru | 99.12 | |
| 3h8u_A | 125 | Uncharacterized conserved protein with double-STR | 99.11 | |
| 3ibm_A | 167 | Cupin 2, conserved barrel domain protein; cupin 2 | 99.09 | |
| 1v70_A | 105 | Probable antibiotics synthesis protein; structural | 99.06 | |
| 2b8m_A | 117 | Hypothetical protein MJ0764; structural genomics, | 99.06 | |
| 2gu9_A | 113 | Tetracenomycin polyketide synthesis protein; X-RAY | 99.05 | |
| 3ht1_A | 145 | REMF protein; cupin fold, Zn-binding, antibiotic b | 99.03 | |
| 3kgz_A | 156 | Cupin 2 conserved barrel domain protein; metallopr | 98.99 | |
| 2oa2_A | 148 | BH2720 protein; 10175341, structural genomics, joi | 98.98 | |
| 2fqp_A | 97 | Hypothetical protein BP2299; double-stranded beta- | 98.98 | |
| 3jzv_A | 166 | Uncharacterized protein RRU_A2000; structural geno | 98.98 | |
| 4e2g_A | 126 | Cupin 2 conserved barrel domain protein; MCSG, PSI | 98.98 | |
| 3fjs_A | 114 | Uncharacterized protein with RMLC-like cupin fold; | 98.98 | |
| 3i7d_A | 163 | Sugar phosphate isomerase; YP_168127.1, structural | 98.97 | |
| 1x82_A | 190 | Glucose-6-phosphate isomerase; cupin superfamily, | 98.96 | |
| 2l37_A | 43 | Ribosome-inactivating protein luffin P1; hydrolase | 98.95 | |
| 2f4p_A | 147 | Hypothetical protein TM1010; double-stranded beta- | 98.94 | |
| 4i4a_A | 128 | Similar to unknown protein; structural genomics, P | 98.94 | |
| 1dgw_X | 79 | Canavalin; duplicated swiss-roll beta barrels, loo | 98.92 | |
| 2pfw_A | 116 | Cupin 2, conserved barrel domain protein; cupin do | 98.91 | |
| 3myx_A | 238 | Uncharacterized protein pspto_0244; protein of unk | 98.9 | |
| 3h8u_A | 125 | Uncharacterized conserved protein with double-STR | 98.89 | |
| 3cew_A | 125 | Uncharacterized cupin protein; all beta-protein, j | 98.89 | |
| 2oa2_A | 148 | BH2720 protein; 10175341, structural genomics, joi | 98.88 | |
| 1vj2_A | 126 | Novel manganese-containing cupin TM1459; structura | 98.88 | |
| 1x82_A | 190 | Glucose-6-phosphate isomerase; cupin superfamily, | 98.87 | |
| 1yhf_A | 115 | Hypothetical protein SPY1581; structural genomics, | 98.87 | |
| 1v70_A | 105 | Probable antibiotics synthesis protein; structural | 98.87 | |
| 1o4t_A | 133 | Putative oxalate decarboxylase; double-stranded be | 98.87 | |
| 2bnm_A | 198 | Epoxidase; oxidoreductase, cupin, HTH, cation-depe | 98.86 | |
| 3l2h_A | 162 | Putative sugar phosphate isomerase; AFE_0303, stru | 98.85 | |
| 3lwc_A | 119 | Uncharacterized protein; structural genomics, unkn | 98.85 | |
| 3lag_A | 98 | Uncharacterized protein RPA4178; functionally unkn | 98.84 | |
| 1y9q_A | 192 | Transcriptional regulator, HTH_3 family; transcrip | 98.83 | |
| 2opk_A | 112 | Hypothetical protein; putative mannose-6-phosphate | 98.82 | |
| 2vpv_A | 166 | Protein MIF2, MIF2P; nucleus, mitosis, centromere, | 98.81 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 98.8 | |
| 4e2q_A | 266 | Ureidoglycine aminohydrolase; BI-cupin, manganese | 98.8 | |
| 2o8q_A | 134 | Hypothetical protein; cpuin-like fold, structural | 98.8 | |
| 2gu9_A | 113 | Tetracenomycin polyketide synthesis protein; X-RAY | 98.8 | |
| 3es1_A | 172 | Cupin 2, conserved barrel domain protein; YP_00116 | 98.79 | |
| 2ozj_A | 114 | Cupin 2, conserved barrel; cupin superfamily prote | 98.77 | |
| 2ozi_A | 98 | Hypothetical protein RPA4178; APC6210, putative pr | 98.77 | |
| 1lr5_A | 163 | Auxin binding protein 1; beta jellyroll, double st | 98.76 | |
| 3h7j_A | 243 | Bacilysin biosynthesis protein BACB; YWFC, bacilys | 98.75 | |
| 2xlg_A | 239 | SLL1785 protein, CUCA; metal binding protein, cupi | 98.75 | |
| 4axo_A | 151 | EUTQ, ethanolamine utilization protein; structural | 98.75 | |
| 2q30_A | 110 | Uncharacterized protein; double-stranded beta-heli | 98.74 | |
| 2xlg_A | 239 | SLL1785 protein, CUCA; metal binding protein, cupi | 98.72 | |
| 3lag_A | 98 | Uncharacterized protein RPA4178; functionally unkn | 98.72 | |
| 1sef_A | 274 | Conserved hypothetical protein; structural genomic | 98.71 | |
| 4h7l_A | 157 | Uncharacterized protein; structural genomics, PSI- | 98.71 | |
| 1rc6_A | 261 | Hypothetical protein YLBA; structural genomics, NY | 98.7 | |
| 2fqp_A | 97 | Hypothetical protein BP2299; double-stranded beta- | 98.7 | |
| 2pyt_A | 133 | Ethanolamine utilization protein EUTQ; structural | 98.69 | |
| 2bnm_A | 198 | Epoxidase; oxidoreductase, cupin, HTH, cation-depe | 98.69 | |
| 3ibm_A | 167 | Cupin 2, conserved barrel domain protein; cupin 2 | 98.69 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 98.68 | |
| 2b8m_A | 117 | Hypothetical protein MJ0764; structural genomics, | 98.67 | |
| 4i4a_A | 128 | Similar to unknown protein; structural genomics, P | 98.65 | |
| 4e2g_A | 126 | Cupin 2 conserved barrel domain protein; MCSG, PSI | 98.64 | |
| 1o4t_A | 133 | Putative oxalate decarboxylase; double-stranded be | 98.64 | |
| 3i7d_A | 163 | Sugar phosphate isomerase; YP_168127.1, structural | 98.62 | |
| 3cew_A | 125 | Uncharacterized cupin protein; all beta-protein, j | 98.61 | |
| 3kgz_A | 156 | Cupin 2 conserved barrel domain protein; metallopr | 98.61 | |
| 3jzv_A | 166 | Uncharacterized protein RRU_A2000; structural geno | 98.6 | |
| 3ht1_A | 145 | REMF protein; cupin fold, Zn-binding, antibiotic b | 98.59 | |
| 1sfn_A | 246 | Conserved hypothetical protein; structural genomic | 98.58 | |
| 1y9q_A | 192 | Transcriptional regulator, HTH_3 family; transcrip | 98.57 | |
| 1vj2_A | 126 | Novel manganese-containing cupin TM1459; structura | 98.57 | |
| 2l37_A | 43 | Ribosome-inactivating protein luffin P1; hydrolase | 98.57 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 98.56 | |
| 2f4p_A | 147 | Hypothetical protein TM1010; double-stranded beta- | 98.56 | |
| 1sq4_A | 278 | GLXB, glyoxylate-induced protein; structural genom | 98.56 | |
| 3rns_A | 227 | Cupin 2 conserved barrel domain protein; structura | 98.55 | |
| 3fjs_A | 114 | Uncharacterized protein with RMLC-like cupin fold; | 98.54 | |
| 2pfw_A | 116 | Cupin 2, conserved barrel domain protein; cupin do | 98.53 | |
| 3d82_A | 102 | Cupin 2, conserved barrel domain protein; structur | 98.5 | |
| 2i45_A | 107 | Hypothetical protein; neisseria meningitidis cupin | 98.5 | |
| 1vr3_A | 191 | Acireductone dioxygenase; 13543033, structural gen | 98.5 | |
| 2ozi_A | 98 | Hypothetical protein RPA4178; APC6210, putative pr | 98.5 | |
| 3lwc_A | 119 | Uncharacterized protein; structural genomics, unkn | 98.49 | |
| 4b29_A | 217 | Dimethylsulfoniopropionate lyase; hydrolase, dimet | 98.49 | |
| 1o5u_A | 101 | Novel thermotoga maritima enzyme TM1112; cupin, st | 98.48 | |
| 1yhf_A | 115 | Hypothetical protein SPY1581; structural genomics, | 98.48 | |
| 2q30_A | 110 | Uncharacterized protein; double-stranded beta-heli | 98.48 | |
| 2o8q_A | 134 | Hypothetical protein; cpuin-like fold, structural | 98.45 | |
| 1zrr_A | 179 | E-2/E-2' protein; nickel, cupin, beta helix, methi | 98.38 | |
| 1vr3_A | 191 | Acireductone dioxygenase; 13543033, structural gen | 98.33 | |
| 2qnk_A | 286 | 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol | 98.31 | |
| 4h7l_A | 157 | Uncharacterized protein; structural genomics, PSI- | 98.31 | |
| 3bcw_A | 123 | Uncharacterized protein; structural genomics, join | 98.29 | |
| 2vpv_A | 166 | Protein MIF2, MIF2P; nucleus, mitosis, centromere, | 98.28 | |
| 3o14_A | 223 | Anti-ecfsigma factor, CHRR; cupin, structural geno | 98.27 | |
| 2ozj_A | 114 | Cupin 2, conserved barrel; cupin superfamily prote | 98.25 | |
| 2i45_A | 107 | Hypothetical protein; neisseria meningitidis cupin | 98.24 | |
| 3d82_A | 102 | Cupin 2, conserved barrel domain protein; structur | 98.21 | |
| 2opk_A | 112 | Hypothetical protein; putative mannose-6-phosphate | 98.19 | |
| 2pyt_A | 133 | Ethanolamine utilization protein EUTQ; structural | 98.17 | |
| 3nw4_A | 368 | Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc | 98.17 | |
| 1juh_A | 350 | Quercetin 2,3-dioxygenase; cupin, glycoprotein, be | 98.17 | |
| 3es1_A | 172 | Cupin 2, conserved barrel domain protein; YP_00116 | 98.14 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 98.09 | |
| 2arc_A | 164 | ARAC, arabinose operon regulatory protein; transcr | 98.05 | |
| 4axo_A | 151 | EUTQ, ethanolamine utilization protein; structural | 98.05 | |
| 1yfu_A | 174 | 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid | 98.04 | |
| 1zrr_A | 179 | E-2/E-2' protein; nickel, cupin, beta helix, methi | 98.02 | |
| 2o1q_A | 145 | Putative acetyl/propionyl-COA carboxylase, alpha; | 97.93 | |
| 4b29_A | 217 | Dimethylsulfoniopropionate lyase; hydrolase, dimet | 97.87 | |
| 1zvf_A | 176 | 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b | 97.79 | |
| 1o5u_A | 101 | Novel thermotoga maritima enzyme TM1112; cupin, st | 97.79 | |
| 2q1z_B | 195 | Anti-sigma factor CHRR, transcriptional activator; | 97.78 | |
| 1yud_A | 170 | Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, p | 97.78 | |
| 3cjx_A | 165 | Protein of unknown function with A cupin-like FOL; | 97.71 | |
| 3ebr_A | 159 | Uncharacterized RMLC-like cupin; structural genomi | 97.67 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 97.67 | |
| 3bcw_A | 123 | Uncharacterized protein; structural genomics, join | 97.67 | |
| 3d0j_A | 140 | Uncharacterized protein CA_C3497; beta-barrel, str | 97.65 | |
| 3es4_A | 116 | Uncharacterized protein DUF861 with A RMLC-like C; | 97.61 | |
| 3ebr_A | 159 | Uncharacterized RMLC-like cupin; structural genomi | 97.56 | |
| 3eqe_A | 171 | Putative cystein deoxygenase; YUBC, SR112, NESG, s | 97.47 | |
| 3myx_A | 238 | Uncharacterized protein pspto_0244; protein of unk | 97.4 | |
| 2vec_A | 256 | YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe | 97.4 | |
| 2y0o_A | 175 | Probable D-lyxose ketol-isomerase; carbohydrate me | 97.28 | |
| 1yfu_A | 174 | 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid | 97.25 | |
| 2q1z_B | 195 | Anti-sigma factor CHRR, transcriptional activator; | 97.22 | |
| 2y0o_A | 175 | Probable D-lyxose ketol-isomerase; carbohydrate me | 97.11 | |
| 2o1q_A | 145 | Putative acetyl/propionyl-COA carboxylase, alpha; | 97.06 | |
| 1tq5_A | 242 | Protein YHHW; bicupin, pirin, montreal-kingston ba | 97.05 | |
| 2arc_A | 164 | ARAC, arabinose operon regulatory protein; transcr | 97.04 | |
| 2gm6_A | 208 | Cysteine dioxygenase type I; structural genomics, | 97.01 | |
| 3d0j_A | 140 | Uncharacterized protein CA_C3497; beta-barrel, str | 96.95 | |
| 3cjx_A | 165 | Protein of unknown function with A cupin-like FOL; | 96.87 | |
| 3ejk_A | 174 | DTDP sugar isomerase; YP_390184.1, structural geno | 96.84 | |
| 3ejk_A | 174 | DTDP sugar isomerase; YP_390184.1, structural geno | 96.82 | |
| 2qjv_A | 270 | Uncharacterized IOLB-like protein; structural geno | 96.58 | |
| 3gbg_A | 276 | TCP pilus virulence regulatory protein; cupin, hel | 96.55 | |
| 3eqe_A | 171 | Putative cystein deoxygenase; YUBC, SR112, NESG, s | 96.52 | |
| 3bal_A | 153 | Acetylacetone-cleaving enzyme; jelly roll, tetrame | 96.48 | |
| 1zvf_A | 176 | 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b | 96.46 | |
| 1yud_A | 170 | Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, p | 96.42 | |
| 3eln_A | 200 | Cysteine dioxygenase type 1; peroxysulfenate, non- | 96.23 | |
| 1qwr_A | 319 | Mannose-6-phosphate isomerase; structural genomics | 96.14 | |
| 2pa7_A | 141 | DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug | 96.13 | |
| 2qnk_A | 286 | 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol | 96.09 | |
| 4gjz_A | 235 | Lysine-specific demethylase 8; JMJC, beta barrel, | 96.07 | |
| 3es4_A | 116 | Uncharacterized protein DUF861 with A RMLC-like C; | 96.01 | |
| 3uss_A | 211 | Putative uncharacterized protein; cupin, three his | 95.93 | |
| 1pmi_A | 440 | PMI, phosphomannose isomerase; aldose-ketose isome | 95.9 | |
| 2pa7_A | 141 | DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug | 95.89 | |
| 2gm6_A | 208 | Cysteine dioxygenase type I; structural genomics, | 95.83 | |
| 3bal_A | 153 | Acetylacetone-cleaving enzyme; jelly roll, tetrame | 95.8 | |
| 3o14_A | 223 | Anti-ecfsigma factor, CHRR; cupin, structural geno | 95.74 | |
| 1vrb_A | 342 | Putative asparaginyl hydroxylase; 2636534, structu | 95.42 | |
| 2wfp_A | 394 | Mannose-6-phosphate isomerase; APO-structure, meta | 95.41 | |
| 4gjz_A | 235 | Lysine-specific demethylase 8; JMJC, beta barrel, | 95.1 | |
| 3gbg_A | 276 | TCP pilus virulence regulatory protein; cupin, hel | 95.1 | |
| 1vrb_A | 342 | Putative asparaginyl hydroxylase; 2636534, structu | 94.98 | |
| 1zx5_A | 300 | Mannosephosphate isomerase, putative; STRU genomic | 94.93 | |
| 2xdv_A | 442 | MYC-induced nuclear antigen; ribosome biogenesis, | 94.83 | |
| 1wlt_A | 196 | 176AA long hypothetical DTDP-4-dehydrorhamnose 3, | 94.82 | |
| 1nxm_A | 197 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell | 94.7 | |
| 1oi6_A | 205 | PCZA361.16; epimerase, vancomycin group antibiotic | 94.66 | |
| 2p17_A | 277 | Pirin-like protein; GK1651, structural genomics, s | 94.55 | |
| 3eln_A | 200 | Cysteine dioxygenase type 1; peroxysulfenate, non- | 94.54 | |
| 3d8c_A | 349 | Hypoxia-inducible factor 1 alpha inhibitor; FIH, H | 94.39 | |
| 3d8c_A | 349 | Hypoxia-inducible factor 1 alpha inhibitor; FIH, H | 94.34 | |
| 3ryk_A | 205 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 94.33 | |
| 2c0z_A | 216 | NOVW; isomerase, epimerase, antibiotic biosynthesi | 94.3 | |
| 1upi_A | 225 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 94.1 | |
| 3al5_A | 338 | HTYW5, JMJC domain-containing protein C2ORF60; tRN | 94.05 | |
| 2xdv_A | 442 | MYC-induced nuclear antigen; ribosome biogenesis, | 94.02 | |
| 1j1l_A | 290 | Pirin; beta sandwich, cupin, iron, metatl binding | 94.0 | |
| 2ixk_A | 184 | DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l | 93.97 | |
| 3al5_A | 338 | HTYW5, JMJC domain-containing protein C2ORF60; tRN | 93.95 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 93.87 | |
| 4diq_A | 489 | Lysine-specific demethylase NO66; structural genom | 93.86 | |
| 1dzr_A | 183 | DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, | 93.8 | |
| 4diq_A | 489 | Lysine-specific demethylase NO66; structural genom | 93.79 | |
| 1ep0_A | 185 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race | 93.65 | |
| 1ep0_A | 185 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race | 93.52 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 93.46 | |
| 1nxm_A | 197 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell | 93.45 | |
| 2yu1_A | 451 | JMJC domain-containing histone demethylation PROT; | 93.41 | |
| 3k3o_A | 371 | PHF8, PHD finger protein 8; histone demethylase, c | 93.39 | |
| 3pua_A | 392 | GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe | 93.32 | |
| 2l2r_A | 37 | Antimicrobial peptide ecamp1; disulfide-stabilized | 93.24 | |
| 2ixk_A | 184 | DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l | 93.23 | |
| 3ryk_A | 205 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 93.06 | |
| 1xru_A | 282 | 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomer; | 93.03 | |
| 1dzr_A | 183 | DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, | 92.91 | |
| 4hn1_A | 201 | Putative 3-epimerase in D-allose pathway; 3'-monoe | 92.9 | |
| 1wlt_A | 196 | 176AA long hypothetical DTDP-4-dehydrorhamnose 3, | 92.89 | |
| 3k2o_A | 336 | Bifunctional arginine demethylase and lysyl-hydro | 92.89 | |
| 3kv9_A | 397 | JMJC domain-containing histone demethylation prote | 92.85 | |
| 1oi6_A | 205 | PCZA361.16; epimerase, vancomycin group antibiotic | 92.69 | |
| 3loi_A | 172 | Putative uncharacterized protein; beta barrel, unk | 92.19 | |
| 3k2o_A | 336 | Bifunctional arginine demethylase and lysyl-hydro | 92.07 | |
| 1upi_A | 225 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 91.74 | |
| 2c0z_A | 216 | NOVW; isomerase, epimerase, antibiotic biosynthesi | 91.55 | |
| 4hn1_A | 201 | Putative 3-epimerase in D-allose pathway; 3'-monoe | 91.44 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 91.3 | |
| 1e5r_A | 290 | Proline oxidase; oxidoreductase, oxygenase, 2-oxog | 90.87 | |
| 2yu1_A | 451 | JMJC domain-containing histone demethylation PROT; | 90.67 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 90.36 | |
| 3m3i_A | 225 | Putative uncharacterized protein; PFAM:PF06172, st | 90.26 | |
| 1pmi_A | 440 | PMI, phosphomannose isomerase; aldose-ketose isome | 89.88 | |
| 3rcq_A | 197 | Aspartyl/asparaginyl beta-hydroxylase; structural | 89.44 | |
| 1xe7_A | 203 | YML079WP, hypothetical 22.5 kDa protein in TUB1-CP | 89.44 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 89.29 | |
| 1eyb_A | 471 | Homogentisate 1,2-dioxygenase; jelly roll, beta sa | 88.93 | |
| 1eyb_A | 471 | Homogentisate 1,2-dioxygenase; jelly roll, beta sa | 88.71 | |
| 3kv9_A | 397 | JMJC domain-containing histone demethylation prote | 88.64 | |
| 2cmy_B | 34 | Beta trypsin, veronica hederifolia trypsin inhibit | 88.57 | |
| 2wfp_A | 394 | Mannose-6-phosphate isomerase; APO-structure, meta | 88.48 | |
| 3k3o_A | 371 | PHF8, PHD finger protein 8; histone demethylase, c | 88.46 | |
| 2qjv_A | 270 | Uncharacterized IOLB-like protein; structural geno | 88.44 | |
| 2qdr_A | 303 | Uncharacterized protein; double-stranded beta-heli | 87.86 | |
| 3pua_A | 392 | GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe | 87.78 | |
| 3uss_A | 211 | Putative uncharacterized protein; cupin, three his | 87.56 | |
| 2oyz_A | 94 | UPF0345 protein VPA0057; unknown function, structu | 87.13 | |
| 1qwr_A | 319 | Mannose-6-phosphate isomerase; structural genomics | 86.87 | |
| 1znp_A | 154 | Hypothetical protein ATU3615; NESG, ATR55, Q8U9W0, | 86.8 | |
| 3loi_A | 172 | Putative uncharacterized protein; beta barrel, unk | 86.57 | |
| 2rg4_A | 216 | Uncharacterized protein; rhodobacterales, oceanico | 86.5 | |
| 3hqx_A | 111 | UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MC | 84.4 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 84.32 | |
| 2lqx_A | 41 | Trypsin inhibitor BWI-2C; helical hairpin, hydrola | 84.6 | |
| 3bb6_A | 127 | Uncharacterized protein YEAR; structural genomics, | 83.55 | |
| 1e5r_A | 290 | Proline oxidase; oxidoreductase, oxygenase, 2-oxog | 83.19 | |
| 3rcq_A | 197 | Aspartyl/asparaginyl beta-hydroxylase; structural | 82.38 | |
| 3kmh_A | 246 | D-lyxose isomerase; cupin beta-barrel, structural | 82.11 | |
| 1zx5_A | 300 | Mannosephosphate isomerase, putative; STRU genomic | 81.32 | |
| 3bb6_A | 127 | Uncharacterized protein YEAR; structural genomics, | 81.0 | |
| 1znp_A | 154 | Hypothetical protein ATU3615; NESG, ATR55, Q8U9W0, | 80.98 | |
| 3m3i_A | 225 | Putative uncharacterized protein; PFAM:PF06172, st | 80.69 | |
| 2vec_A | 256 | YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe | 80.63 |
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A | Back alignment and structure |
|---|
Probab=100.00 E-value=6.7e-82 Score=671.38 Aligned_cols=379 Identities=34% Similarity=0.596 Sum_probs=336.0
Q ss_pred cCCcccceeecCCceEEEeccCccccccccccccceeeeeeeCCCccccccccCCCeEEEEEeeEEEEEEEecCCceEEe
Q 040805 145 EGDEESSRVTSQHGRVAFLPKFTQRSKLLRGLEKYRLGILIANPQTFVTPTHLDADAVFFVSWGQGTITVIRENNRESYN 224 (540)
Q Consensus 145 ~~~~f~~~~~~e~G~i~~l~~f~~~~~~L~Gi~~~rl~~~~l~Pggl~~Ph~~~A~ei~yV~~G~g~ig~V~~~~~~~~~ 224 (540)
++++|+++|+|++|+|++|++||+++++|+||.+|+++.++|+|||+++|||++|++|+||++|+|++|+|++++..+++
T Consensus 10 ~~~~f~~~~~se~G~i~~l~~f~~~s~~l~~l~~~~l~~~~l~p~gl~~Phh~~A~ei~yV~~G~g~~g~V~~~~~~~~~ 89 (418)
T 3s7i_A 10 PSRRFSTRYGNQNGRIRVLQRFDQRSRQFQNLQNHRIVQIEAKPNTLVLPKHADADNILVIQQGQATVTVANGNNRKSFN 89 (418)
T ss_dssp CGGGEEEEEECSSEEEEEECCHHHHCGGGGGGTTCEEEEEEECTTEEEEEEEESEEEEEEEEESEEEEEEECSSCEEEEE
T ss_pred ccccccceEEcCCcEEEEecccCCcchhcccccceEEEEEEecCCceeeeeeCCCCeEEEEEEeeEEEEEEecCCEEEEE
Confidence 67889999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eCCCcEEEECCCCeEEEEeCCCCccEEEEEEeecCCCCCcccccccCCCCCcccccccCCHHHHHHhcCCCHHHHHHHhc
Q 040805 225 VKRGDIIRVPSGNTFYVTNTDDDEKLYIVKFIKSINLPGQYEAFYGAGGENPESFLRAFSWEILESAFKTKRDSLERVLF 304 (540)
Q Consensus 225 l~~GDv~~iPaG~~h~~~N~g~~e~l~~v~i~~~~~~pg~~~~f~LaG~~~~~s~l~~f~~evLa~Af~v~~~~v~~l~~ 304 (540)
|++||||+||+|++||++|+|+++.|+|+++.+++++||.+..|||||+.++.+||++||++||++||+|+.+++++|+.
T Consensus 90 l~~GDv~~~P~G~~h~~~N~g~~~~l~i~~l~~~s~~pg~~~~f~laG~~~~~s~~~gf~~evLa~af~v~~~~v~kl~~ 169 (418)
T 3s7i_A 90 LDEGHALRIPSGFISYILNRHDNQNLRVAKISMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLL 169 (418)
T ss_dssp EETTEEEEECTTCEEEEEECCSSCCEEEEEEEEESSBTTBCCEECSSCCSSCCCGGGGSCHHHHHHHHTSCHHHHHHHTT
T ss_pred ecCCCEEEECCCCeEEEEecCCCccEEEEEeecCcCCCCccceeeccCCcchhHHhhcCCHHHHHHHHCcCHHHHHhhhc
Confidence 99999999999999999999877899999999999999999999999999889999999999999999999999999994
Q ss_pred c---------------------CCCCcEEEccchhhhccCCCCCCCCcCCCC----CCCCceeEcCCCCCcccCCCceEE
Q 040805 305 Q---------------------QDQGAMVKASKQQIRALSRSQEGPSIWPFA----GESRGTFNLFGKRPSHSNNFGELF 359 (540)
Q Consensus 305 ~---------------------q~~g~Iv~~~~e~l~~l~~~~~~~s~~~~~----~~~~~~fnL~~~~P~~~n~~G~~~ 359 (540)
. +..|.||++++++++.|+++.. +.++.+ ...+++|||.+++|+|+|.+|+++
T Consensus 170 ~~~~~~~~~~~~~~~~~~~~~~q~~g~Iv~~~~~~~~~l~~~~~--~~~~~~~~~~~~~~~~~nl~~~~p~~~n~~G~~~ 247 (418)
T 3s7i_A 170 EENAGGEQEERGQRRWSTRSSENNEGVIVKVSKEHVEELTKHAK--SVSKKGSEEEGDITNPINLREGEPDLSNNFGKLF 247 (418)
T ss_dssp SCC--------------------CCCSEEECCHHHHHHHHTTCB--C--------CTTCCCCEETTCSCCSEEETTEEEE
T ss_pred ccccccccccccccccccccccccCCceEEcChhhhhhcccccc--ccCCCCcCcccCCCcccccccCCCceeCCCCeEE
Confidence 4 3469999999999998987632 211111 124789999999999999999999
Q ss_pred EecCCCC-CCCccccceEEEEEEcCCCcccccccCCCcEEEEEEeceEEEEEEcCCCCCCcccccccC---CCccccCCc
Q 040805 360 EADSNDF-RPLEDLDITVSYANISKGAMAAPFYNSRSTKVAVVVAGDGYIEIACPHVSRSSSERRHQG---SSTREEGSA 435 (540)
Q Consensus 360 ~~~~~~~-p~L~~l~isv~~~~L~pggm~~PH~h~~A~ei~yV~~G~g~v~vv~p~~~~~~~~~~~~~---~~~~~~~~~ 435 (540)
.+++.+| |+|+++||++++++|.||||++|||||||++|+||++|+|+++||+|++..+++++++++ ++++++...
T Consensus 248 ~~~~~~~~p~L~~~gis~~r~~l~pgg~~~PH~~p~A~ei~yV~~G~g~v~vv~~~~~~~~~~~~~~~~~~~~~~~~~~~ 327 (418)
T 3s7i_A 248 EVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLELVAVRKEQQQRGRREEEEDEDEEEEGSNR 327 (418)
T ss_dssp EECSBTTBHHHHHHTCEEEEEEECTTEEEEEEEESSCEEEEEEEECCEEEEEEEEEEC-------------------CCE
T ss_pred EechHHcchhhccCCeeEEEEEecCCceeCceecCCCCEEEEEEeCeEEEEEEeCCCccccccccccccccccccccccc
Confidence 9999999 999999999999999999999999999999999999999999999998864322221111 111222345
Q ss_pred cceEEeeeeCCCcEEEECCCCeEEEEecCCCCEEEEEEEecCCCCcccccccc-ccccccCCHHHHHHHcCCCHHHHHHh
Q 040805 436 TYHKVSSRIRTDSAYIVPAGHPVVTVASQNNNLEVVCFEINAEGNIRFPLAGR-NKIFKVMESEAKELAFNTRADEVERV 514 (540)
Q Consensus 436 ~~~~~~~~l~~GDV~vVPaG~~h~~~n~~~e~l~~v~F~~~a~~~~~~~LAG~-~svl~~~~~evla~AF~vs~e~v~kl 514 (540)
.|++++.+|++|||||||+||+||++|++ +|+|++|++++++|.+++|||+ +|||++||++||++||+++.++|++|
T Consensus 328 ~~~~~~~~l~~GDV~vvP~G~~~~~~~~~--~l~~v~f~~~~~~~~~~~LAG~~~sv~~~~~~evla~af~v~~~~v~~L 405 (418)
T 3s7i_A 328 EVRRYTARLKEGDVFIMPAAHPVAINASS--ELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKL 405 (418)
T ss_dssp EEEEEEEEECTTCEEEECTTCCEEEEESS--CEEEEEEEESCTTCCEEESSSSTTBHHHHSCHHHHHHHSSSCHHHHHHH
T ss_pred cceEEEeeeCCCCEEEECCCCEEEEECCC--CEEEEEEEcCCCCCcceEccCchhhhhhcCCHHHHHHHhCCCHHHHHHH
Confidence 67899999999999999999999999874 5999999999989999999998 59999999999999999999999999
Q ss_pred hcCCCCceEEcCC
Q 040805 515 FGNQDQDWFFKGP 527 (540)
Q Consensus 515 ~~~q~e~~f~~~~ 527 (540)
+.+|++++|+++.
T Consensus 406 ~~~q~e~~~~~~~ 418 (418)
T 3s7i_A 406 IKNQKESHFVSAR 418 (418)
T ss_dssp HHTCCSCSEEECC
T ss_pred HhcCCcceeecCC
Confidence 9999999999863
|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* | Back alignment and structure |
|---|
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} | Back alignment and structure |
|---|
| >3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} | Back alignment and structure |
|---|
| >2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A | Back alignment and structure |
|---|
| >3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A | Back alignment and structure |
|---|
| >1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} | Back alignment and structure |
|---|
| >3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} | Back alignment and structure |
|---|
| >1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A | Back alignment and structure |
|---|
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} | Back alignment and structure |
|---|
| >2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A | Back alignment and structure |
|---|
| >3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} | Back alignment and structure |
|---|
| >2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* | Back alignment and structure |
|---|
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* | Back alignment and structure |
|---|
| >1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A | Back alignment and structure |
|---|
| >1dgw_Y Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_Y | Back alignment and structure |
|---|
| >1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* | Back alignment and structure |
|---|
| >1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A | Back alignment and structure |
|---|
| >1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A | Back alignment and structure |
|---|
| >4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A | Back alignment and structure |
|---|
| >3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* | Back alignment and structure |
|---|
| >1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A | Back alignment and structure |
|---|
| >1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >1dgw_Y Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_Y | Back alignment and structure |
|---|
| >1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* | Back alignment and structure |
|---|
| >3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} | Back alignment and structure |
|---|
| >3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} | Back alignment and structure |
|---|
| >1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A | Back alignment and structure |
|---|
| >2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 | Back alignment and structure |
|---|
| >2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A | Back alignment and structure |
|---|
| >3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A | Back alignment and structure |
|---|
| >3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} | Back alignment and structure |
|---|
| >3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* | Back alignment and structure |
|---|
| >2l37_A Ribosome-inactivating protein luffin P1; hydrolase; NMR {Luffa aegyptiaca} | Back alignment and structure |
|---|
| >2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} | Back alignment and structure |
|---|
| >1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X | Back alignment and structure |
|---|
| >2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 | Back alignment and structure |
|---|
| >1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* | Back alignment and structure |
|---|
| >1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A | Back alignment and structure |
|---|
| >1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A | Back alignment and structure |
|---|
| >3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} | Back alignment and structure |
|---|
| >3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} | Back alignment and structure |
|---|
| >3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 | Back alignment and structure |
|---|
| >2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A | Back alignment and structure |
|---|
| >2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A | Back alignment and structure |
|---|
| >3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} | Back alignment and structure |
|---|
| >1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* | Back alignment and structure |
|---|
| >3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* | Back alignment and structure |
|---|
| >2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A | Back alignment and structure |
|---|
| >4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} | Back alignment and structure |
|---|
| >2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A | Back alignment and structure |
|---|
| >3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} | Back alignment and structure |
|---|
| >2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 | Back alignment and structure |
|---|
| >2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A | Back alignment and structure |
|---|
| >3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 | Back alignment and structure |
|---|
| >4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} | Back alignment and structure |
|---|
| >4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A | Back alignment and structure |
|---|
| >1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 | Back alignment and structure |
|---|
| >1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 | Back alignment and structure |
|---|
| >2l37_A Ribosome-inactivating protein luffin P1; hydrolase; NMR {Luffa aegyptiaca} | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* | Back alignment and structure |
|---|
| >2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} | Back alignment and structure |
|---|
| >2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 | Back alignment and structure |
|---|
| >3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} | Back alignment and structure |
|---|
| >4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} | Back alignment and structure |
|---|
| >1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A | Back alignment and structure |
|---|
| >1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A | Back alignment and structure |
|---|
| >1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 | Back alignment and structure |
|---|
| >2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A | Back alignment and structure |
|---|
| >4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} | Back alignment and structure |
|---|
| >2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} | Back alignment and structure |
|---|
| >2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 | Back alignment and structure |
|---|
| >3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A | Back alignment and structure |
|---|
| >1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* | Back alignment and structure |
|---|
| >3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A | Back alignment and structure |
|---|
| >4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} | Back alignment and structure |
|---|
| >1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* | Back alignment and structure |
|---|
| >1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A | Back alignment and structure |
|---|
| >2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 | Back alignment and structure |
|---|
| >4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} | Back alignment and structure |
|---|
| >1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 | Back alignment and structure |
|---|
| >1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A | Back alignment and structure |
|---|
| >1yud_A Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Shewanella oneidensis} SCOP: b.82.1.16 | Back alignment and structure |
|---|
| >3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* | Back alignment and structure |
|---|
| >2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 | Back alignment and structure |
|---|
| >1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12 | Back alignment and structure |
|---|
| >2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A | Back alignment and structure |
|---|
| >2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii} | Back alignment and structure |
|---|
| >1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 | Back alignment and structure |
|---|
| >1yud_A Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Shewanella oneidensis} SCOP: b.82.1.16 | Back alignment and structure |
|---|
| >3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A | Back alignment and structure |
|---|
| >1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* | Back alignment and structure |
|---|
| >2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A | Back alignment and structure |
|---|
| >4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* | Back alignment and structure |
|---|
| >3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >1pmi_A PMI, phosphomannose isomerase; aldose-ketose isomerase; 1.70A {Candida albicans} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* | Back alignment and structure |
|---|
| >2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii} | Back alignment and structure |
|---|
| >3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 | Back alignment and structure |
|---|
| >2wfp_A Mannose-6-phosphate isomerase; APO-structure, metal-binding; 1.67A {Salmonella typhimurium} PDB: 3h1w_A 3h1m_A 3h1y_A* | Back alignment and structure |
|---|
| >4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* | Back alignment and structure |
|---|
| >3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 | Back alignment and structure |
|---|
| >1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} | Back alignment and structure |
|---|
| >1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A | Back alignment and structure |
|---|
| >1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A* | Back alignment and structure |
|---|
| >1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A | Back alignment and structure |
|---|
| >2p17_A Pirin-like protein; GK1651, structural genomics, south collaboratory for structural genomics, protein structure in secsg; 1.52A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A | Back alignment and structure |
|---|
| >3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... | Back alignment and structure |
|---|
| >3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... | Back alignment and structure |
|---|
| >3ryk_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, STRU genomics, infectious diseases; HET: TYD; 1.63A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1 | Back alignment and structure |
|---|
| >1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A* | Back alignment and structure |
|---|
| >3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* | Back alignment and structure |
|---|
| >2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} | Back alignment and structure |
|---|
| >1j1l_A Pirin; beta sandwich, cupin, iron, metatl binding protein; 2.10A {Homo sapiens} SCOP: b.82.1.12 PDB: 3acl_A* | Back alignment and structure |
|---|
| >2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* | Back alignment and structure |
|---|
| >3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1dzr_A DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 3\,5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A* | Back alignment and structure |
|---|
| >4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* | Back alignment and structure |
|---|
| >1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A* | Back alignment and structure |
|---|
| >2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A | Back alignment and structure |
|---|
| >3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* | Back alignment and structure |
|---|
| >3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* | Back alignment and structure |
|---|
| >2l2r_A Antimicrobial peptide ecamp1; disulfide-stabilized helical hairpin, antifungal peptide, antimicrobial protein; NMR {Echinochloa crus-galli} | Back alignment and structure |
|---|
| >2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* | Back alignment and structure |
|---|
| >3ryk_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, STRU genomics, infectious diseases; HET: TYD; 1.63A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1xru_A 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomer; beta barrel, cupin, isomerase; HET: 1PE; 1.94A {Escherichia coli} SCOP: b.82.1.13 PDB: 1x8m_A | Back alignment and structure |
|---|
| >1dzr_A DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 3\,5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A* | Back alignment and structure |
|---|
| >4hn1_A Putative 3-epimerase in D-allose pathway; 3'-monoepimerase, natural product, deoxysugar, chalcomycin, mycinose, cupin fold; HET: TYD THM; 1.60A {Streptomyces bikiniensis} PDB: 4hmz_A* 4hn0_A | Back alignment and structure |
|---|
| >1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A | Back alignment and structure |
|---|
| >3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* | Back alignment and structure |
|---|
| >3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* 3u78_A* | Back alignment and structure |
|---|
| >1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A | Back alignment and structure |
|---|
| >3loi_A Putative uncharacterized protein; beta barrel, unknown function; 2.10A {Branchiostoma belcheri tsingtauense} SCOP: b.82.1.0 PDB: 3lzz_A* | Back alignment and structure |
|---|
| >3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* | Back alignment and structure |
|---|
| >1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A* | Back alignment and structure |
|---|
| >2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1 | Back alignment and structure |
|---|
| >4hn1_A Putative 3-epimerase in D-allose pathway; 3'-monoepimerase, natural product, deoxysugar, chalcomycin, mycinose, cupin fold; HET: TYD THM; 1.60A {Streptomyces bikiniensis} PDB: 4hmz_A* 4hn0_A | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >1e5r_A Proline oxidase; oxidoreductase, oxygenase, 2-oxoglutarate dependent oxygenase; 2.30A {Streptomyces SP} SCOP: b.82.2.4 PDB: 1e5s_A | Back alignment and structure |
|---|
| >2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >3m3i_A Putative uncharacterized protein; PFAM:PF06172, structural genomics, structural genomics of pathogenic protozoa consortium, SGPP; 2.35A {Leishmania major} | Back alignment and structure |
|---|
| >1pmi_A PMI, phosphomannose isomerase; aldose-ketose isomerase; 1.70A {Candida albicans} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >3rcq_A Aspartyl/asparaginyl beta-hydroxylase; structural genomics, structural genomics consortium, SGC, oxidoreductase, human; HET: OGA; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1xe7_A YML079WP, hypothetical 22.5 kDa protein in TUB1-CPR3 intergenic region; jelly roll motif, cupin superfamily, structural genomics; HET: GUN; 1.75A {Saccharomyces cerevisiae} SCOP: b.82.1.16 PDB: 1xe8_A* | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >1eyb_A Homogentisate 1,2-dioxygenase; jelly roll, beta sandwich, oxidoreductase; 1.90A {Homo sapiens} SCOP: b.82.1.4 PDB: 1ey2_A | Back alignment and structure |
|---|
| >1eyb_A Homogentisate 1,2-dioxygenase; jelly roll, beta sandwich, oxidoreductase; 1.90A {Homo sapiens} SCOP: b.82.1.4 PDB: 1ey2_A | Back alignment and structure |
|---|
| >3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* 3u78_A* | Back alignment and structure |
|---|
| >2cmy_B Beta trypsin, veronica hederifolia trypsin inhibitor; acyl-enzyme intermediate, serine protease inhibitor, zymogen protease, digestion; 2.25A {Veronica hederifolia} SCOP: g.2.4.1 | Back alignment and structure |
|---|
| >2wfp_A Mannose-6-phosphate isomerase; APO-structure, metal-binding; 1.67A {Salmonella typhimurium} PDB: 3h1w_A 3h1m_A 3h1y_A* | Back alignment and structure |
|---|
| >3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* | Back alignment and structure |
|---|
| >2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >2qdr_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE EPE; 2.60A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* | Back alignment and structure |
|---|
| >3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >2oyz_A UPF0345 protein VPA0057; unknown function, structural genomi 2, protein structure initiative, midwest center for structu genomics, MCSG; 1.71A {Vibrio parahaemolyticus} SCOP: b.82.1.22 | Back alignment and structure |
|---|
| >1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >1znp_A Hypothetical protein ATU3615; NESG, ATR55, Q8U9W0, structural genomics, PSI, protein struc initiative; 2.50A {Agrobacterium tumefaciens str} SCOP: b.82.1.16 | Back alignment and structure |
|---|
| >3loi_A Putative uncharacterized protein; beta barrel, unknown function; 2.10A {Branchiostoma belcheri tsingtauense} SCOP: b.82.1.0 PDB: 3lzz_A* | Back alignment and structure |
|---|
| >2rg4_A Uncharacterized protein; rhodobacterales, oceanicola granulosus HTCC2516, Q2CBJ1_9RHO structural genomics, PSI-2; 1.90A {Oceanicola granulosus} PDB: 3bvc_A | Back alignment and structure |
|---|
| >3hqx_A UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MCSG, structural genomics, protein STRU initiative, midwest center for structural genomics; 1.66A {Acinetobacter SP} SCOP: b.82.1.0 | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >2lqx_A Trypsin inhibitor BWI-2C; helical hairpin, hydrolase inhibitor; NMR {Fagopyrum esculentum} | Back alignment and structure |
|---|
| >3bb6_A Uncharacterized protein YEAR; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Escherichia coli} SCOP: b.82.2.13 | Back alignment and structure |
|---|
| >1e5r_A Proline oxidase; oxidoreductase, oxygenase, 2-oxoglutarate dependent oxygenase; 2.30A {Streptomyces SP} SCOP: b.82.2.4 PDB: 1e5s_A | Back alignment and structure |
|---|
| >3rcq_A Aspartyl/asparaginyl beta-hydroxylase; structural genomics, structural genomics consortium, SGC, oxidoreductase, human; HET: OGA; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3kmh_A D-lyxose isomerase; cupin beta-barrel, structural genomics, montreal-kingston BA structural genomics initiative, BSGI; 1.58A {Escherichia coli O157} PDB: 3mpb_A* | Back alignment and structure |
|---|
| >1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >3bb6_A Uncharacterized protein YEAR; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Escherichia coli} SCOP: b.82.2.13 | Back alignment and structure |
|---|
| >1znp_A Hypothetical protein ATU3615; NESG, ATR55, Q8U9W0, structural genomics, PSI, protein struc initiative; 2.50A {Agrobacterium tumefaciens str} SCOP: b.82.1.16 | Back alignment and structure |
|---|
| >3m3i_A Putative uncharacterized protein; PFAM:PF06172, structural genomics, structural genomics of pathogenic protozoa consortium, SGPP; 2.35A {Leishmania major} | Back alignment and structure |
|---|
| >2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 540 | ||||
| d1uika1 | 203 | b.82.1.2 (A:148-350) Seed storage 7S protein {Soyb | 7e-50 | |
| d1uika1 | 203 | b.82.1.2 (A:148-350) Seed storage 7S protein {Soyb | 8e-14 | |
| d2phla1 | 200 | b.82.1.2 (A:11-210) Seed storage 7S protein {Frenc | 6e-45 | |
| d2phla1 | 200 | b.82.1.2 (A:11-210) Seed storage 7S protein {Frenc | 2e-17 | |
| d1dgwa_ | 178 | b.82.1.2 (A:) Seed storage 7S protein {Jack bean ( | 2e-43 | |
| d1dgwa_ | 178 | b.82.1.2 (A:) Seed storage 7S protein {Jack bean ( | 5e-16 | |
| d1uija1 | 170 | b.82.1.2 (A:6-175) Seed storage 7S protein {Soybea | 1e-42 | |
| d1uija1 | 170 | b.82.1.2 (A:6-175) Seed storage 7S protein {Soybea | 4e-14 | |
| d1uika2 | 185 | b.82.1.2 (A:351-535) Seed storage 7S protein {Soyb | 2e-36 | |
| d1uika2 | 185 | b.82.1.2 (A:351-535) Seed storage 7S protein {Soyb | 4e-15 | |
| d1j58a_ | 372 | b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B | 8e-33 | |
| d2phla2 | 162 | b.82.1.2 (A:220-381) Seed storage 7S protein {Fren | 5e-32 | |
| d2phla2 | 162 | b.82.1.2 (A:220-381) Seed storage 7S protein {Fren | 3e-23 | |
| g1dgw.1 | 168 | b.82.1.2 (X:,Y:) Seed storage 7S protein {Jack bea | 8e-29 | |
| g1dgw.1 | 168 | b.82.1.2 (X:,Y:) Seed storage 7S protein {Jack bea | 3e-17 | |
| d1fxza2 | 174 | b.82.1.2 (A:297-470) Seed storage 7S protein {Soyb | 2e-24 | |
| d1fxza2 | 174 | b.82.1.2 (A:297-470) Seed storage 7S protein {Soyb | 5e-14 | |
| d1od5a2 | 173 | b.82.1.2 (A:321-493) Seed storage 7S protein {Soyb | 7e-20 | |
| d1od5a2 | 173 | b.82.1.2 (A:321-493) Seed storage 7S protein {Soyb | 4e-13 | |
| d1od5a1 | 245 | b.82.1.2 (A:7-251) Seed storage 7S protein {Soybea | 1e-18 | |
| d1od5a1 | 245 | b.82.1.2 (A:7-251) Seed storage 7S protein {Soybea | 5e-15 | |
| d1fxza1 | 239 | b.82.1.2 (A:10-248) Seed storage 7S protein {Soybe | 2e-17 | |
| d1fxza1 | 239 | b.82.1.2 (A:10-248) Seed storage 7S protein {Soybe | 4e-17 | |
| d1juha_ | 348 | b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergill | 2e-13 | |
| d1juha_ | 348 | b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergill | 2e-05 | |
| d2et1a1 | 201 | b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare | 7e-10 | |
| d2et1a1 | 201 | b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare | 3e-08 | |
| d1y3ta1 | 330 | b.82.1.5 (A:5-334) Hypothetical protein YxaG {Baci | 2e-07 | |
| d1lr5a_ | 160 | b.82.1.2 (A:) Auxin binding protein {Maize (Zea ma | 3e-06 | |
| d2phda1 | 351 | b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Ps | 8e-05 | |
| d3bu7a1 | 355 | b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Si | 3e-04 | |
| d2pyta1 | 128 | b.82.1.24 (A:100-227) Ethanolamine utilization pro | 7e-04 | |
| d1zrra1 | 179 | b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebs | 0.002 | |
| d1x82a_ | 190 | b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI { | 0.003 | |
| d2d40a1 | 308 | b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Es | 0.004 |
| >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 203 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Double-stranded beta-helix superfamily: RmlC-like cupins family: Germin/Seed storage 7S protein domain: Seed storage 7S protein species: Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]
Score = 168 bits (427), Expect = 7e-50
Identities = 64/192 (33%), Positives = 114/192 (59%), Gaps = 11/192 (5%)
Query: 150 SSRVTSQHGRVAFLPKFTQRSKLLRGLEKYRLGILIANPQTFVTPTHLDADAVFFVSWGQ 209
+ +Q+G V L +F +RS+ L+ L YR+ + P T + P H DAD + + G
Sbjct: 11 QTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGT 70
Query: 210 GTITVIRENNRESYNVKRGDIIRVPSGNTFYVTNTDDDEKLYIVKFIKSINLPGQYEAFY 269
+T++ ++R+SYN++ GD +RVP+G T+YV N D+DE L ++ +N PG++E+F+
Sbjct: 71 AILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFF 130
Query: 270 GAGGENPESFLRAFSWEILESAFKTKRDSLERVLFQQD-----------QGAMVKASKQQ 318
+ + +S+L+ FS ILE+++ TK + + +VLF ++ + +V+ SK+Q
Sbjct: 131 LSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQ 190
Query: 319 IRALSRSQEGPS 330
IR LS+ + S
Sbjct: 191 IRELSKHAKSSS 202
|
| >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 203 | Back information, alignment and structure |
|---|
| >d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 200 | Back information, alignment and structure |
|---|
| >d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 200 | Back information, alignment and structure |
|---|
| >d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Length = 178 | Back information, alignment and structure |
|---|
| >d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Length = 178 | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Length = 170 | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Length = 170 | Back information, alignment and structure |
|---|
| >d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 185 | Back information, alignment and structure |
|---|
| >d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 185 | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 | Back information, alignment and structure |
|---|
| >d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 162 | Back information, alignment and structure |
|---|
| >d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 162 | Back information, alignment and structure |
|---|
| >d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Length = 174 | Back information, alignment and structure |
|---|
| >d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Length = 174 | Back information, alignment and structure |
|---|
| >d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 173 | Back information, alignment and structure |
|---|
| >d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 173 | Back information, alignment and structure |
|---|
| >d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 245 | Back information, alignment and structure |
|---|
| >d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 245 | Back information, alignment and structure |
|---|
| >d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Length = 239 | Back information, alignment and structure |
|---|
| >d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Length = 239 | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Length = 348 | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Length = 348 | Back information, alignment and structure |
|---|
| >d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 201 | Back information, alignment and structure |
|---|
| >d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 201 | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Length = 330 | Back information, alignment and structure |
|---|
| >d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Length = 160 | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Length = 351 | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Length = 355 | Back information, alignment and structure |
|---|
| >d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Length = 128 | Back information, alignment and structure |
|---|
| >d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} Length = 179 | Back information, alignment and structure |
|---|
| >d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 190 | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Length = 308 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 540 | |||
| d1j58a_ | 372 | Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil | 100.0 | |
| d2phla1 | 200 | Seed storage 7S protein {French bean (Phaseolus vu | 100.0 | |
| d1uika1 | 203 | Seed storage 7S protein {Soybean (Glycine max), be | 100.0 | |
| d1uika2 | 185 | Seed storage 7S protein {Soybean (Glycine max), be | 100.0 | |
| d1dgwa_ | 178 | Seed storage 7S protein {Jack bean (Canavalia ensi | 100.0 | |
| g1dgw.1 | 168 | Seed storage 7S protein {Jack bean (Canavalia ensi | 100.0 | |
| d1uija1 | 170 | Seed storage 7S protein {Soybean (Glycine max), be | 100.0 | |
| d1fxza2 | 174 | Seed storage 7S protein {Soybean (Glycine max), pr | 100.0 | |
| d1fxza1 | 239 | Seed storage 7S protein {Soybean (Glycine max), pr | 100.0 | |
| d1od5a1 | 245 | Seed storage 7S protein {Soybean (Glycine max), gl | 100.0 | |
| d1od5a2 | 173 | Seed storage 7S protein {Soybean (Glycine max), gl | 100.0 | |
| d2phla2 | 162 | Seed storage 7S protein {French bean (Phaseolus vu | 100.0 | |
| d2phla1 | 200 | Seed storage 7S protein {French bean (Phaseolus vu | 99.97 | |
| d1od5a1 | 245 | Seed storage 7S protein {Soybean (Glycine max), gl | 99.97 | |
| d1dgwa_ | 178 | Seed storage 7S protein {Jack bean (Canavalia ensi | 99.97 | |
| d1fxza1 | 239 | Seed storage 7S protein {Soybean (Glycine max), pr | 99.97 | |
| d1uika1 | 203 | Seed storage 7S protein {Soybean (Glycine max), be | 99.97 | |
| d1uika2 | 185 | Seed storage 7S protein {Soybean (Glycine max), be | 99.97 | |
| d1fxza2 | 174 | Seed storage 7S protein {Soybean (Glycine max), pr | 99.96 | |
| g1dgw.1 | 168 | Seed storage 7S protein {Jack bean (Canavalia ensi | 99.96 | |
| d1uija1 | 170 | Seed storage 7S protein {Soybean (Glycine max), be | 99.95 | |
| d2et1a1 | 201 | Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | 99.95 | |
| d2phla2 | 162 | Seed storage 7S protein {French bean (Phaseolus vu | 99.94 | |
| d1od5a2 | 173 | Seed storage 7S protein {Soybean (Glycine max), gl | 99.94 | |
| d1juha_ | 348 | Quercetin 2,3-dioxygenase {Aspergillus japonicus [ | 99.9 | |
| d2et1a1 | 201 | Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | 99.89 | |
| d1j58a_ | 372 | Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil | 99.89 | |
| d2d40a1 | 308 | Gentisate 1,2-dioxygenase {Escherichia coli [TaxId | 99.8 | |
| d3bu7a1 | 355 | Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ | 99.78 | |
| d1y3ta1 | 330 | Hypothetical protein YxaG {Bacillus subtilis [TaxI | 99.78 | |
| d2phda1 | 351 | Gentisate 1,2-dioxygenase {Pseudaminobacter salicy | 99.75 | |
| d1sefa_ | 250 | Hypothetical protein EF2996 {Enterococcus faecalis | 99.74 | |
| d1sq4a_ | 273 | Glyoxylate-induced protein PA1140 {Pseudomonas aer | 99.74 | |
| d1sfna_ | 245 | Hypothetical protein DR1152 {Deinococcus radiodura | 99.7 | |
| d1rc6a_ | 253 | Hypothetical protein YlbA {Escherichia coli [TaxId | 99.65 | |
| d1lr5a_ | 160 | Auxin binding protein {Maize (Zea mays) [TaxId: 45 | 99.36 | |
| d2b8ma1 | 108 | Hypothetical protein MJ0764 {Archaeon Methanococcu | 99.34 | |
| d1o4ta_ | 115 | Hypothetical protein TM1287 {Thermotoga maritima [ | 99.23 | |
| d1v70a_ | 105 | Hypothetical protein TTHA0104 {Thermus thermophilu | 99.23 | |
| d1vj2a_ | 114 | Hypothetical protein TM1459 {Thermotoga maritima [ | 99.23 | |
| d1y9qa2 | 99 | Probable transcriptional regulator VC1968, C-termi | 99.12 | |
| d1o4ta_ | 115 | Hypothetical protein TM1287 {Thermotoga maritima [ | 99.12 | |
| d2f4pa1 | 134 | Hypothetical protein TM1010 {Thermotoga maritima [ | 99.05 | |
| d1x82a_ | 190 | Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc | 99.02 | |
| d1v70a_ | 105 | Hypothetical protein TTHA0104 {Thermus thermophilu | 99.01 | |
| d2b8ma1 | 108 | Hypothetical protein MJ0764 {Archaeon Methanococcu | 99.0 | |
| d1sefa_ | 250 | Hypothetical protein EF2996 {Enterococcus faecalis | 98.98 | |
| d1sfna_ | 245 | Hypothetical protein DR1152 {Deinococcus radiodura | 98.98 | |
| d1lr5a_ | 160 | Auxin binding protein {Maize (Zea mays) [TaxId: 45 | 98.93 | |
| d1rc6a_ | 253 | Hypothetical protein YlbA {Escherichia coli [TaxId | 98.93 | |
| d1yhfa1 | 112 | Hypothetical protein SPy1581 {Streptococcus pyogen | 98.93 | |
| d1sq4a_ | 273 | Glyoxylate-induced protein PA1140 {Pseudomonas aer | 98.88 | |
| d1x82a_ | 190 | Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc | 98.86 | |
| d2pyta1 | 128 | Ethanolamine utilization protein EutQ {Salmonella | 98.85 | |
| d1vj2a_ | 114 | Hypothetical protein TM1459 {Thermotoga maritima [ | 98.84 | |
| d2f4pa1 | 134 | Hypothetical protein TM1010 {Thermotoga maritima [ | 98.82 | |
| d1juha_ | 348 | Quercetin 2,3-dioxygenase {Aspergillus japonicus [ | 98.79 | |
| d1y9qa2 | 99 | Probable transcriptional regulator VC1968, C-termi | 98.75 | |
| d2bnma2 | 122 | Hydroxypropylphosphonic acid epoxidase Fom4, C-ter | 98.74 | |
| d1y3ta1 | 330 | Hypothetical protein YxaG {Bacillus subtilis [TaxI | 98.7 | |
| d3bu7a1 | 355 | Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ | 98.63 | |
| d2d40a1 | 308 | Gentisate 1,2-dioxygenase {Escherichia coli [TaxId | 98.56 | |
| d1yhfa1 | 112 | Hypothetical protein SPy1581 {Streptococcus pyogen | 98.52 | |
| d1zrra1 | 179 | Acireductone dioxygenase {Klebsiella pneumoniae [T | 98.44 | |
| d2phda1 | 351 | Gentisate 1,2-dioxygenase {Pseudaminobacter salicy | 98.43 | |
| d2pyta1 | 128 | Ethanolamine utilization protein EutQ {Salmonella | 98.22 | |
| d2bnma2 | 122 | Hydroxypropylphosphonic acid epoxidase Fom4, C-ter | 98.17 | |
| d1vr3a1 | 179 | Acireductone dioxygenase {Mouse (Mus musculus) [Ta | 98.09 | |
| d1zrra1 | 179 | Acireductone dioxygenase {Klebsiella pneumoniae [T | 98.03 | |
| d1vr3a1 | 179 | Acireductone dioxygenase {Mouse (Mus musculus) [Ta | 97.95 | |
| d2arca_ | 161 | Regulatory protein AraC {Escherichia coli [TaxId: | 97.76 | |
| d1o5ua_ | 88 | Hypothetical protein TM1112 {Thermotoga maritima [ | 97.68 | |
| d2pa7a1 | 135 | dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane | 97.48 | |
| d2pa7a1 | 135 | dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane | 97.45 | |
| d1pmia_ | 440 | Phosphomannose isomerase {Yeast (Candida albicans) | 96.96 | |
| d1tq5a1 | 231 | Hypothetical protein YhhW {Escherichia coli [TaxId | 96.82 | |
| d2o1qa1 | 144 | Putative acetyl/propionyl-CoA carboxylase subunit | 96.78 | |
| d2o1qa1 | 144 | Putative acetyl/propionyl-CoA carboxylase subunit | 96.71 | |
| d1qwra_ | 315 | Mannose-6-phosphate isomerase ManA {Bacillus subti | 96.69 | |
| d1j1la_ | 288 | Pirin {Human (Homo sapiens) [TaxId: 9606]} | 96.63 | |
| d1yfua1 | 174 | 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m | 96.55 | |
| d1vrba1 | 319 | Putative asparaginyl hydroxylase YxbC {Bacillus su | 96.47 | |
| d1o5ua_ | 88 | Hypothetical protein TM1112 {Thermotoga maritima [ | 96.16 | |
| d2arca_ | 161 | Regulatory protein AraC {Escherichia coli [TaxId: | 96.15 | |
| d1vrba1 | 319 | Putative asparaginyl hydroxylase YxbC {Bacillus su | 96.13 | |
| d1zvfa1 | 175 | 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea | 95.88 | |
| d1zx5a1 | 299 | Putative mannosephosphate isomerase AF0035 {Archae | 95.46 | |
| d2ixca1 | 198 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac | 95.19 | |
| d2ixca1 | 198 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac | 95.16 | |
| d1dzra_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone | 95.15 | |
| d3elna1 | 186 | Cysteine dioxygenase type I {Rattus norvegicus [Ta | 95.13 | |
| d1oi6a_ | 202 | dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amyc | 94.89 | |
| d1wlta1 | 176 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 94.82 | |
| d1wlta1 | 176 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 94.66 | |
| d1yuda1 | 158 | Hypothetical protein SO0799 {Shewanella oneidensis | 94.57 | |
| d2c0za1 | 190 | Novobiocin biosynthesis protein NovW {Streptomyces | 94.34 | |
| d2gm6a1 | 192 | Cysteine dioxygenase type I {Ralstonia eutropha [T | 94.03 | |
| d1h2ka_ | 335 | Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum | 93.92 | |
| d1dzra_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone | 93.84 | |
| d1ep0a_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 93.8 | |
| d2ixha1 | 184 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudom | 93.65 | |
| d1h2ka_ | 335 | Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum | 93.64 | |
| d2c0za1 | 190 | Novobiocin biosynthesis protein NovW {Streptomyces | 93.54 | |
| d1ep0a_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 93.52 | |
| d1nxma_ | 194 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Strepto | 93.42 | |
| d1eyba_ | 439 | Homogentisate dioxygenase {Human (Homo sapiens) [T | 93.34 | |
| d1pmia_ | 440 | Phosphomannose isomerase {Yeast (Candida albicans) | 93.19 | |
| d1eyba_ | 439 | Homogentisate dioxygenase {Human (Homo sapiens) [T | 93.19 | |
| d1yfua1 | 174 | 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m | 92.54 | |
| d2ixha1 | 184 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudom | 92.02 | |
| d1oi6a_ | 202 | dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amyc | 91.98 | |
| d1zvfa1 | 175 | 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea | 90.52 | |
| d1znpa1 | 140 | Hypothetical protein Atu3615 {Agrobacterium tumefa | 90.02 | |
| d1nxma_ | 194 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Strepto | 89.16 | |
| d1e5ra_ | 290 | Type II Proline 3-hydroxylase (proline oxidase) {S | 88.36 | |
| d1qwra_ | 315 | Mannose-6-phosphate isomerase ManA {Bacillus subti | 87.85 | |
| d3elna1 | 186 | Cysteine dioxygenase type I {Rattus norvegicus [Ta | 85.96 | |
| d1znpa1 | 140 | Hypothetical protein Atu3615 {Agrobacterium tumefa | 84.98 | |
| d2oyza1 | 93 | Uncharacterized protein VPA0057 {Vibrio parahaemol | 84.1 | |
| d1zx5a1 | 299 | Putative mannosephosphate isomerase AF0035 {Archae | 83.85 | |
| d2gm6a1 | 192 | Cysteine dioxygenase type I {Ralstonia eutropha [T | 81.1 | |
| d1xe7a_ | 194 | Hypothetical protein YML079W {Baker's yeast (Sacch | 80.26 |
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Double-stranded beta-helix superfamily: RmlC-like cupins family: Germin/Seed storage 7S protein domain: Oxalate decarboxylase OxdC (YvrK) species: Bacillus subtilis [TaxId: 1423]
Probab=100.00 E-value=4.8e-52 Score=434.18 Aligned_cols=314 Identities=12% Similarity=0.140 Sum_probs=255.5
Q ss_pred cCCceEEEeccCccccccccccccceeeeeeeCCCccccccccCCCeEEEEEeeEEEEEEEecCCc-eEEeeCCCcEEEE
Q 040805 155 SQHGRVAFLPKFTQRSKLLRGLEKYRLGILIANPQTFVTPTHLDADAVFFVSWGQGTITVIRENNR-ESYNVKRGDIIRV 233 (540)
Q Consensus 155 ~e~G~i~~l~~f~~~~~~L~Gi~~~rl~~~~l~Pggl~~Ph~~~A~ei~yV~~G~g~ig~V~~~~~-~~~~l~~GDv~~i 233 (540)
.++|++|.++. ...|.+.+ ++.+.+.|+||+++.||||.+++|.||++|++++++|++++. .+++|++||+|+|
T Consensus 53 ~~gg~~r~~~~--~~lp~~~~---~a~~~~~L~pga~~~pH~H~~ae~~yVl~G~~~vt~Vd~~G~~~~~~l~~GDv~~~ 127 (372)
T d1j58a_ 53 EKGGYAREVTV--RELPISEN---LASVNMRLKPGAIRELHWHKEAEWAYMIYGSARVTIVDEKGRSFIDDVGEGDLWYF 127 (372)
T ss_dssp ETTEEEEEECT--TTCTTCSS---CEEEEEEECTTCEEEEEEESSCEEEEEEEEEEEEEEECTTSCEEEEEEETTEEEEE
T ss_pred cCCCeeEEeeh--hhChhhhh---hhheEEEECCCcCcCCcccCcccEEEEEeCEEEEEEEeCCCcEEEEEeccCCEEEE
Confidence 58899999853 22355544 555555999999999999988899999999999999998754 5678999999999
Q ss_pred CCCCeEEEEeCCCCccEEEEEEeecCCCCCcccccccCCCCCcccccccCCHHHHHHhcCCCHHHHHHHhccCCCCcEEE
Q 040805 234 PSGNTFYVTNTDDDEKLYIVKFIKSINLPGQYEAFYGAGGENPESFLRAFSWEILESAFKTKRDSLERVLFQQDQGAMVK 313 (540)
Q Consensus 234 PaG~~h~~~N~g~~e~l~~v~i~~~~~~pg~~~~f~LaG~~~~~s~l~~f~~evLa~Af~v~~~~v~~l~~~q~~g~Iv~ 313 (540)
|+|++||++|.+ +.+.++.++++. ++.....|.+ .+||++||++||++||+++.+++++|++.+. +|+.
T Consensus 128 P~G~~H~i~n~~--dg~e~l~vf~~~-~~~~~~~f~~------~~~~~~~p~evLa~af~v~~~~~~~i~~~e~--~i~~ 196 (372)
T d1j58a_ 128 PSGLPHSIQALE--EGAEFLLVFDDG-SFSENSTFQL------TDWLAHTPKEVIAANFGVTKEEISNLPGKEK--YIFE 196 (372)
T ss_dssp CTTCCEEEEEEE--EEEEEEEEESCT-TCCGGGEEEH------HHHHHTSCHHHHHHHHTCCTGGGTTSCSSCC--SEEC
T ss_pred CCCCEEEEEeCC--CCcEEEEEECCC-Ccccccceee------ccccccCCHHHHHHhhCCCHHHHhhcccccc--cccc
Confidence 999999999975 468888888544 3444444443 3899999999999999999999999998774 6665
Q ss_pred cc-chhhhccCCCCCCCCcCCCCCCCCceeEcCCCCCcccCCCceEEEecCCCCCCCccccceEEEEEEcCCCccccccc
Q 040805 314 AS-KQQIRALSRSQEGPSIWPFAGESRGTFNLFGKRPSHSNNFGELFEADSNDFRPLEDLDITVSYANISKGAMAAPFYN 392 (540)
Q Consensus 314 ~~-~e~l~~l~~~~~~~s~~~~~~~~~~~fnL~~~~P~~~n~~G~~~~~~~~~~p~L~~l~isv~~~~L~pggm~~PH~h 392 (540)
.. +..+...... + .......+++|+|..++| +++.+|+++++++.+||+|+ +|+++.++|.||||+.||||
T Consensus 197 ~~~p~~~~~~~~~----~-~~g~~~~~~~~~l~~q~P-~~~~gG~~~~~d~~~fp~~~--~is~~~~~l~PG~~~~~H~H 268 (372)
T d1j58a_ 197 NQLPGSLKDDIVE----G-PNGEVPYPFTYRLLEQEP-IESEGGKVYIADSTNFKVSK--TIASALVTVEPGAMRELHWH 268 (372)
T ss_dssp CCCCCCHHHHCCC----C-TTCCCSSCSEEEGGGSCC-EECSSEEEEEESTTTSTTCC--SCEEEEEEECTTCEEEEEEC
T ss_pred ccCCCcchhhhcc----C-CCCCCCCcceeeccccCC-cccCCccEEEeccccCCccC--ceeEEEEEECCCcccCCCCC
Confidence 42 1122211111 1 112234567899999999 68999999999999999998 58999999999999999999
Q ss_pred CCCcEEEEEEeceEEEEEEcCCCCCCcccccccCCCccccCCccceEEeeeeCCCcEEEECCCCeEEEEecCCCCEEEEE
Q 040805 393 SRSTKVAVVVAGDGYIEIACPHVSRSSSERRHQGSSTREEGSATYHKVSSRIRTDSAYIVPAGHPVVTVASQNNNLEVVC 472 (540)
Q Consensus 393 ~~A~ei~yV~~G~g~v~vv~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~GDV~vVPaG~~h~~~n~~~e~l~~v~ 472 (540)
|+|+||.||++|+|+++|+++++ +..+.+|++|||++||+|++|++.|.+++++.|+.
T Consensus 269 p~a~E~~yvl~G~g~v~v~~~~g----------------------~~~t~~l~~GDv~~iP~g~~H~i~N~g~e~l~~l~ 326 (372)
T d1j58a_ 269 PNTHEWQYYISGKARMTVFASDG----------------------HARTFNYQAGDVGYVPFAMGHYVENIGDEPLVFLE 326 (372)
T ss_dssp SSSCEEEEEEESEEEEEEEEETT----------------------EEEEEEEESSCEEEECTTCBEEEEECSSSCEEEEE
T ss_pred CCCcEEEEEEECeEEEEEEcCCC----------------------ceEEEEecCCcEEEECCCCeEEEEECCCCCEEEEE
Confidence 99999999999999999999876 45567899999999999999999999999999988
Q ss_pred EEecCCCCccccccccccccccCCHHHHHHHcCCCHHHHHHhhcCC
Q 040805 473 FEINAEGNIRFPLAGRNKIFKVMESEAKELAFNTRADEVERVFGNQ 518 (540)
Q Consensus 473 F~~~a~~~~~~~LAG~~svl~~~~~evla~AF~vs~e~v~kl~~~q 518 (540)
+..+. .+...-| +++|+.+|++|++++|+++.+++++|++..
T Consensus 327 vf~s~-~~~~i~~---~~~l~~~P~~vv~~~~~~~~e~~~~l~~~k 368 (372)
T d1j58a_ 327 IFKDD-HYADVSL---NQWLAMLPETFVQAHLDLGKDFTDVLSKEK 368 (372)
T ss_dssp EESSS-SCCCEEH---HHHHHTSCHHHHHHHHTCCHHHHTTCCSSC
T ss_pred EECCC-CcceeeH---HHHhhhCCHHHHHHHhCcCHHHHHHHHhcC
Confidence 65443 3333223 578999999999999999999999998654
|
| >d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} | Back information, alignment and structure |
|---|
| >d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} | Back information, alignment and structure |
|---|
| >d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} | Back information, alignment and structure |
|---|
| >d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} | Back information, alignment and structure |
|---|
| >d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} | Back information, alignment and structure |
|---|
| >d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} | Back information, alignment and structure |
|---|
| >d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} | Back information, alignment and structure |
|---|
| >d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} | Back information, alignment and structure |
|---|
| >d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} | Back information, alignment and structure |
|---|
| >d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1j1la_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} | Back information, alignment and structure |
|---|
| >d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1yuda1 b.82.1.16 (A:1-158) Hypothetical protein SO0799 {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} | Back information, alignment and structure |
|---|
| >d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} | Back information, alignment and structure |
|---|
| >d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} | Back information, alignment and structure |
|---|
| >d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1znpa1 b.82.1.16 (A:4-143) Hypothetical protein Atu3615 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1e5ra_ b.82.2.4 (A:) Type II Proline 3-hydroxylase (proline oxidase) {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1znpa1 b.82.1.16 (A:4-143) Hypothetical protein Atu3615 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2oyza1 b.82.1.22 (A:2-94) Uncharacterized protein VPA0057 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d1xe7a_ b.82.1.16 (A:) Hypothetical protein YML079W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|