Citrus Sinensis ID: 040815


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----
MEAKRSHNLFEGRIPRSLINCSKLEFLGLGNYQISDTFPSWLGTLPKLNVLILRSNIFYGVIEEPRTGCGFSKLRIIDLSNNRFSGNLPSKSFLCWNAMKIVNARRMMTYNKIPDILAGIILSNNRFVGAIPASIANLKGLQVLNLQYNNLQGLIPSSLGNLTNLESLDLSNKKFAGRIPQQLVELTFLEFFNVSDNYLTGPIPQGKQFATFDNTSFDGNSGLCGKPLSKGCESGETPTNEDHTEGSSESLFSGASDRKIILTGYAGGLVAGLVLGFNFSTGIIGWILEKLGTQQKATRRRGSRK
cEEEccccccEEEccccccccccccEEEcccccccccccccccccccccEEEccccccEEEccccccccccccccEEEcccccccccccHHHHccccccEEEEEcccEEEccccccccEEEcccccccccccHHHHccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEHHHHHHHHHHHccccHHHHHHccHHHHHHHHcccc
ccEEcccccccccccHHHHccccccEEEcccccccccccHHHccccccEEEEEcccccccccccccccccccccEEEEcccccccccccHHHHHccHHHHHHEcccccccccccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccHHccccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcccccEEEcccccccccccccccccccccccccccccccccEEEEEEEcHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccc
meakrshnlfegriprslincskleflglgnyqisdtfpswlgtlpklnvLILRSNIfygvieeprtgcgfsklriidlsnnrfsgnlpsksfLCWNAMKIVNARRMMTYNKIPDILAGIilsnnrfvgaipasiANLKGLQVLNLQYNnlqglipsslgnltnlesldlsnkkfagripqqLVELTFLEFfnvsdnyltgpipqgkqfatfdntsfdgnsglcgkplskgcesgetptnedhtegsseslfsgasdRKIILTGYAGGLVAGLVLGFNFSTGIIGWILEKLGtqqkatrrrgsrk
meakrshnlfegriprsliNCSKLEFLGLGNYQISDTFPSWLGTLPKLNVLILRSNIFYGVIEEPRTGCGFSKLRIIDLSnnrfsgnlpsksfLCWNAMKIVNARRMMTYNKIPDILAGIILSNNRFVGAIPASIANLKGLQVLNLQYNNLQGLIPSSLGNLTNLESLDLSNKKFAGRIPQQLVELTFLEFFNVSDNYLTGPIPQGKQFATFDNTSFDGNSGLCGKPLSKGCESGetptnedhtegssESLFSGASDRKIILTGYAGGLVAGLVLGFNFSTGIIGWIleklgtqqkatrrrgsrk
MEAKRSHNLFEGRIPRSLINCSKLEFLGLGNYQISDTFPSWLGTLPKLNVLILRSNIFYGVIEEPRTGCGFSKLRIIDLSNNRFSGNLPSKSFLCWNAMKIVNARRMMTYNKIPDILAGIILSNNRFVGAIPASIANLKGlqvlnlqynnlqglIPSSLGNLTNLESLDLSNKKFAGRIPQQLVELTFLEFFNVSDNYLTGPIPQGKQFATFDNTSFDGNSGLCGKPLSKGCESGETPTNEDHTEGSSESLFSGASDRKIILTGYagglvaglvlgFNFSTGIIGWILEKLGTQQKATRRRGSRK
*********FEGRIPRSLINCSKLEFLGLGNYQISDTFPSWLGTLPKLNVLILRSNIFYGVIEEPRTGCGFSKLRIIDLSNNRFSGNLPSKSFLCWNAMKIVNARRMMTYNKIPDILAGIILSNNRFVGAIPASIANLKGLQVLNLQYNNLQGLIPSSLGNLTNLESLDLSNKKFAGRIPQQLVELTFLEFFNVSDNYLTGPIPQGKQFATFDNTSF****************************************RKIILTGYAGGLVAGLVLGFNFSTGIIGWILEKL**************
MEAKRSHNLFEGRIPRSLINCSKLEFLGLGNYQISDTFPSWLGTLPKLNVLILRSNIFYGVIEEPRTGCGFSKLRIIDLSNNRFSGNLPSKSFLCWNAMKIVNARRMMTYNKIPDILAGIILSNNRFVGAIPASIANLKGLQVLNLQYNNLQGLIPSSLGNLTNLESLDLSNKKFAGRIPQQLVELTFLEFFNVSDNYLTGPIPQGKQFATFDNTSFDGNSGLCGKPL**************************ASDRKIILTGYAGGLVAGLVLGFNFSTGIIGWILEKLGTQQK*********
********LFEGRIPRSLINCSKLEFLGLGNYQISDTFPSWLGTLPKLNVLILRSNIFYGVIEEPRTGCGFSKLRIIDLSNNRFSGNLPSKSFLCWNAMKIVNARRMMTYNKIPDILAGIILSNNRFVGAIPASIANLKGLQVLNLQYNNLQGLIPSSLGNLTNLESLDLSNKKFAGRIPQQLVELTFLEFFNVSDNYLTGPIPQGKQFATFDNTSFDGNSGLCGKPLS**********************FSGASDRKIILTGYAGGLVAGLVLGFNFSTGIIGWILEKLG*************
MEAKRSHNLFEGRIPRSLINCSKLEFLGLGNYQISDTFPSWLGTLPKLNVLILRSNIFYGVIEEPRTGCGFSKLRIIDLSNNRFSGNLPSKSFLCWNAMKIVNARRMMTYNKIPDILAGIILSNNRFVGAIPASIANLKGLQVLNLQYNNLQGLIPSSLGNLTNLESLDLSNKKFAGRIPQQLVELTFLEFFNVSDNYLTGPIPQGKQFATFDNTSFDGNSGLCGKPLSKGC*********************GASDRKIILTGYAGGLVAGLVLGFNFSTGIIGWILEKLGTQQK*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAKRSHNLFEGRIPRSLINCSKLEFLGLGNYQISDTFPSWLGTLPKLNVLILRSNIFYGVIEEPRTGCGFSKLRIIDLSNNRFSGNLPSKSFLCWNAMKIVNARRMMTYNKIPDILAGIILSNNRFVGAIPASIANLKGLQVLNLQYNNLQGLIPSSLGNLTNLESLDLSNKKFAGRIPQQLVELTFLEFFNVSDNYLTGPIPQGKQFATFDNTSFDGNSGLCGKPLSKGCESGETPTNEDHTEGSSESLFSGASDRKIILTGYAGGLVAGLVLGFNFSTGIIGWILEKLGTQQKATRRRGSRK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query305 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.931 0.335 0.386 7e-50
Q9C7S5 1095 Tyrosine-sulfated glycope no no 0.708 0.197 0.367 5e-32
Q9SHI3729 Receptor-like protein 2 O no no 0.731 0.305 0.386 8e-32
Q8LPB4 1021 Phytosulfokine receptor 1 N/A no 0.796 0.238 0.376 3e-30
Q9ZVR7 1008 Phytosulfokine receptor 1 no no 0.701 0.212 0.392 4e-30
Q9FN37 1036 Phytosulfokine receptor 2 no no 0.737 0.217 0.368 9e-30
C0LGQ5 1249 LRR receptor-like serine/ no no 0.721 0.176 0.357 1e-27
O22938 890 Leucine-rich repeat recep no no 0.740 0.253 0.355 1e-25
C0LGS2 1136 Probable LRR receptor-lik no no 0.734 0.197 0.339 7e-25
Q9LHP4 1141 Receptor-like protein kin no no 0.701 0.187 0.331 2e-24
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  197 bits (502), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 124/321 (38%), Positives = 168/321 (52%), Gaps = 37/321 (11%)

Query: 6   SHNLFEGRIPRSLINCSKLEFLGLGNYQISDTFPSWLGTLPKLNVLILRSNIFYGVIEEP 65
           SHN  EG+ P+SLINC  LE + + + +I D FPSWL +LP L+VL LRSN FYG +   
Sbjct: 524 SHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLHVLNLRSNKFYGPLYHR 583

Query: 66  RTGCGFSKLRIIDLSNNRFSGNLPSKSFLCW-------------------------NAMK 100
               GF  LRIID+S+N FSG LP   F  W                         + M+
Sbjct: 584 HASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMTTLTEEMDQYMTEFWRYADSYYHEME 643

Query: 101 IVNARRMMTYNKIPDILAGIILSNNRFVGAIPASIANLKGLQVLNLQYNNLQGLIPSSLG 160
           +VN    M++ +I      I  S N+  G IP S+  LK L+VLNL  N    +IP  L 
Sbjct: 644 MVNKGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKELRVLNLSGNAFTSVIPRFLA 703

Query: 161 NLTNLESLDLSNKKFAGRIPQQLVELTFLEFFNVSDNYLTGPIPQGKQFATFDNTSFDGN 220
           NLT LE+LD+S  K +G+IPQ L  L+FL + N S N L GP+P+G QF     +SF  N
Sbjct: 704 NLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVPRGTQFQRQKCSSFLDN 763

Query: 221 SGLCGKPLSKGCES--GETPTN---EDHTEGSSESLFSGASDRKIILTGYAGGLVAGLVL 275
            GL G  L   C       PT+   ED +E + E++F+  +        Y  G++ GLV+
Sbjct: 764 PGLYG--LEDICRDTGALNPTSQLPEDLSE-AEENMFNWVAAA----IAYGPGVLCGLVI 816

Query: 276 GFNFSTGIIGWILEKLGTQQK 296
           G  +++    W  EK G +Q 
Sbjct: 817 GHFYTSHNHEWFTEKFGRKQH 837




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1 OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHI3|RLP2_ARATH Receptor-like protein 2 OS=Arabidopsis thaliana GN=RLP2 PE=2 SV=1 Back     alignment and function description
>sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1 Back     alignment and function description
>sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4 Back     alignment and function description
>sp|Q9FN37|PSKR2_ARATH Phytosulfokine receptor 2 OS=Arabidopsis thaliana GN=PSKR2 PE=2 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|O22938|Y2182_ARATH Leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 OS=Arabidopsis thaliana GN=At2g41820 PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query305
147782974 1719 hypothetical protein VITISV_036826 [Viti 0.967 0.171 0.490 4e-75
359485824 973 PREDICTED: receptor-like protein 12-like 0.957 0.300 0.487 4e-75
359485822 993 PREDICTED: receptor-like protein 12-like 0.963 0.296 0.5 3e-74
225447578 1946 PREDICTED: uncharacterized protein LOC10 0.954 0.149 0.476 4e-73
359490156 886 PREDICTED: receptor-like protein 12-like 0.967 0.332 0.477 2e-72
147794486 1924 hypothetical protein VITISV_000631 [Viti 0.954 0.151 0.470 4e-72
255548694 984 serine/threonine-protein kinase bri1, pu 0.957 0.296 0.465 1e-69
224140509 961 predicted protein [Populus trichocarpa] 0.908 0.288 0.479 4e-67
147766212 925 hypothetical protein VITISV_018438 [Viti 0.885 0.291 0.498 5e-67
224140517 979 predicted protein [Populus trichocarpa] 0.914 0.284 0.467 6e-67
>gi|147782974|emb|CAN66148.1| hypothetical protein VITISV_036826 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  287 bits (735), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 161/328 (49%), Positives = 196/328 (59%), Gaps = 33/328 (10%)

Query: 6    SHNLFEGRIPRSLINCSKLEFLGLGNYQISDTFPSWLGTLPKLNVLILRSNIFYGVIEEP 65
            S NL EG +PRSL NC+ LE L LGN QISDTFP WLG LP+L VLILRSN F+G I +P
Sbjct: 1391 SQNLLEGPVPRSLTNCTVLESLNLGNNQISDTFPFWLGALPELQVLILRSNRFHGAIGKP 1450

Query: 66   RTGCGFSKLRIIDLSNNRFSGNLPSKSFLCWNAMKIVNARRM------------------ 107
            RT   F KLRIIDLS N FSGNLPS  FL W AMK ++A                     
Sbjct: 1451 RTNFEFPKLRIIDLSYNSFSGNLPSVYFLDWIAMKSIDADNFTYMQASSGFSTQTYKLYD 1510

Query: 108  -------MT-------YNKIPDILAGIILSNNRFVGAIPASIANLKGLQVLNLQYNNLQG 153
                   MT       Y KIP I   I  S+N+F G IP SI  LKGL +LN   N+L G
Sbjct: 1511 NYTYSMTMTNKGMERVYEKIPGIFRAIDFSSNKFKGEIPTSIGTLKGLHLLNFSXNSLTG 1570

Query: 154  LIPSSLGNLTNLESLDLSNKKFAGRIPQQLVELTFLEFFNVSDNYLTGPIPQGKQFATFD 213
             IP+SL NLT LE+LDLS     G IPQQL E+TFL FFNVS N LTGPIPQ KQF TF 
Sbjct: 1571 RIPTSLRNLTELEALDLSQNNLLGEIPQQLTEMTFLGFFNVSHNNLTGPIPQXKQFDTFQ 1630

Query: 214  NTSFDGNSGLCGKPLSKGCESGETPTNEDHTEGSSESLFSGAS-DRKIILTGYAGGLVAG 272
            + S++GN GLCG PL + C + +  + +  T    + L   +  DRK++L GY   LV G
Sbjct: 1631 SDSYEGNPGLCGNPLIRKCGNPKQASPQPSTSEQGQDLEPASXFDRKVVLMGYXSXLVFG 1690

Query: 273  LVLGFNFSTGIIGWILEKLGTQQKATRR 300
            +++G+ F+T    W ++  G +Q+   R
Sbjct: 1691 VIIGYIFTTRKHEWFVKTFGRRQQQQER 1718




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359485824|ref|XP_003633343.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485822|ref|XP_003633342.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225447578|ref|XP_002270154.1| PREDICTED: uncharacterized protein LOC100264911 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490156|ref|XP_003634044.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147794486|emb|CAN71611.1| hypothetical protein VITISV_000631 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255548694|ref|XP_002515403.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223545347|gb|EEF46852.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224140509|ref|XP_002323625.1| predicted protein [Populus trichocarpa] gi|222868255|gb|EEF05386.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147766212|emb|CAN63381.1| hypothetical protein VITISV_018438 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140517|ref|XP_002323629.1| predicted protein [Populus trichocarpa] gi|222868259|gb|EEF05390.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query305
TAIR|locus:2046515864 RLP24 "receptor like protein 2 0.301 0.106 0.505 3.3e-42
TAIR|locus:2096339786 RLP30 "receptor like protein 3 0.308 0.119 0.521 9.2e-41
TAIR|locus:2094613784 RLP38 "receptor like protein 3 0.318 0.123 0.494 1.2e-40
TAIR|locus:2040035671 RLP20 "receptor like protein 2 0.668 0.304 0.400 9.6e-31
TAIR|locus:2094563595 RLP36 "receptor like protein 3 0.698 0.357 0.369 7.6e-30
TAIR|locus:2825389784 RLP11 "AT1G71390" [Arabidopsis 0.721 0.280 0.387 1.4e-29
TAIR|locus:2119430741 RLP47 "receptor like protein 4 0.642 0.264 0.397 1.6e-29
TAIR|locus:2086974881 RLP41 "AT3G25010" [Arabidopsis 0.708 0.245 0.349 3.3e-27
TAIR|locus:2173777792 RLP54 "receptor like protein 5 0.662 0.255 0.359 1.7e-28
TAIR|locus:2074633943 RLP35 "AT3G11080" [Arabidopsis 0.691 0.223 0.385 1.2e-28
TAIR|locus:2046515 RLP24 "receptor like protein 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 250 (93.1 bits), Expect = 3.3e-42, Sum P(2) = 3.3e-42
 Identities = 47/93 (50%), Positives = 62/93 (66%)

Query:     7 HNLFEGRIPRSLINCSKLEFLGLGNYQISDTFPSWLGTLPKLNVLILRSNIFYGVIEEPR 66
             +N   G++PRSL+NCS L FL + N ++ DTFP WL  LP L VL LRSN FYG I  P 
Sbjct:   548 YNRLTGKLPRSLLNCSSLRFLSVDNNRVKDTFPFWLKALPNLRVLTLRSNKFYGPISPPH 607

Query:    67 TG-CGFSKLRIIDLSNNRFSGNLPSKSFLCWNA 98
              G  GF +LRI ++++N F+G+LP   F+ W A
Sbjct:   608 QGPLGFPELRIFEIADNMFTGSLPPSFFVNWKA 640


GO:0005886 "plasma membrane" evidence=ISM
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2096339 RLP30 "receptor like protein 30" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094613 RLP38 "receptor like protein 38" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040035 RLP20 "receptor like protein 20" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094563 RLP36 "receptor like protein 36" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825389 RLP11 "AT1G71390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119430 RLP47 "receptor like protein 47" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086974 RLP41 "AT3G25010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173777 RLP54 "receptor like protein 54" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-25
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-24
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-22
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-22
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-20
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-19
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-18
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-17
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-16
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 5e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-04
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  105 bits (263), Expect = 3e-25
 Identities = 68/232 (29%), Positives = 106/232 (45%), Gaps = 14/232 (6%)

Query: 8   NLFEGRIPRSLINCSKLEFLGLGNYQISDTFPSWLGTLPKLNVLILRSNIFYGVIEEPRT 67
           N  EG IP+SL  C  L  + L +   S   PS    LP +  L + +N   G I   + 
Sbjct: 390 NSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRK- 448

Query: 68  GCGFSKLRIIDLSNNRFSGNLPSKSF--------LCWNAMKIVNARRMMTYNKIPDILAG 119
                 L+++ L+ N+F G LP            L  N       R++ + +++  +   
Sbjct: 449 -WDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLK-- 505

Query: 120 IILSNNRFVGAIPASIANLKGLQVLNLQYNNLQGLIPSSLGNLTNLESLDLSNKKFAGRI 179
             LS N+  G IP  +++ K L  L+L +N L G IP+S   +  L  LDLS  + +G I
Sbjct: 506 --LSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEI 563

Query: 180 PQQLVELTFLEFFNVSDNYLTGPIPQGKQFATFDNTSFDGNSGLCGKPLSKG 231
           P+ L  +  L   N+S N+L G +P    F   + ++  GN  LCG   + G
Sbjct: 564 PKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGDTTSG 615


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 305
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.91
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.89
KOG4237498 consensus Extracellular matrix protein slit, conta 99.85
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.82
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.82
KOG0617264 consensus Ras suppressor protein (contains leucine 99.79
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.77
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.77
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.75
KOG0617264 consensus Ras suppressor protein (contains leucine 99.75
PLN03150623 hypothetical protein; Provisional 99.75
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.7
KOG4237498 consensus Extracellular matrix protein slit, conta 99.7
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.69
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.68
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.68
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.65
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.65
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.58
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.57
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.56
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.49
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.38
PLN03150623 hypothetical protein; Provisional 99.37
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.35
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.34
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.23
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.22
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.22
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.16
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.09
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.04
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.99
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.98
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.85
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.85
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.84
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.77
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.76
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.72
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.58
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.53
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.4
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.3
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.28
PRK15386 426 type III secretion protein GogB; Provisional 98.18
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.17
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.17
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.11
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.11
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.0
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.95
PRK15386426 type III secretion protein GogB; Provisional 97.85
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.69
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.67
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.56
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.56
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.45
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.45
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.41
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.21
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.95
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.49
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.28
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.22
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.0
KOG4308478 consensus LRR-containing protein [Function unknown 95.73
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.68
smart0037026 LRR Leucine-rich repeats, outliers. 95.68
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.09
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.11
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.15
smart0037026 LRR Leucine-rich repeats, outliers. 92.31
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.31
KOG4308478 consensus LRR-containing protein [Function unknown 91.55
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 91.42
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.28
PF08374 221 Protocadherin: Protocadherin; InterPro: IPR013585 88.23
KOG1947482 consensus Leucine rich repeat proteins, some prote 86.91
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 85.13
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 84.74
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 83.75
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 82.29
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 82.26
KOG3864221 consensus Uncharacterized conserved protein [Funct 80.73
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.97  E-value=2.8e-30  Score=257.63  Aligned_cols=223  Identities=28%  Similarity=0.411  Sum_probs=150.2

Q ss_pred             EEEccCCccccccchhccCCCCCcEEeCCCcccCCCcChhccCCCCCCEEEccCccCCcccCCCCCCCCCCCccEEEccC
Q 040815            2 EAKRSHNLFEGRIPRSLINCSKLEFLGLGNYQISDTFPSWLGTLPKLNVLILRSNIFYGVIEEPRTGCGFSKLRIIDLSN   81 (305)
Q Consensus         2 ~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~l~~L~~L~L~~   81 (305)
                      +|+|++|++++.+|..+..+++|+.|++++|.+.+.+|..++.+++|+.|++++|.+++..|..+  ..++.|+.|++++
T Consensus       360 ~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~--~~l~~L~~L~Ls~  437 (968)
T PLN00113        360 VLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEF--TKLPLVYFLDISN  437 (968)
T ss_pred             EEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhH--hcCCCCCEEECcC
Confidence            45666666665556555555555555555555555555555555555555555555554444433  4444455555555


Q ss_pred             CcCcccCChhhhhcc-----------------------chhhhhhhcccccc------CcccccccEEEccCCccccccc
Q 040815           82 NRFSGNLPSKSFLCW-----------------------NAMKIVNARRMMTY------NKIPDILAGIILSNNRFVGAIP  132 (305)
Q Consensus        82 n~l~g~~p~~~~~~l-----------------------~~L~~l~l~~~~~~------~~~~~~L~~L~ls~n~l~~~~p  132 (305)
                      |.+++.+|.. +..+                       .+|+.|+++.+...      ...++.|+.|++++|.+.+.+|
T Consensus       438 N~l~~~~~~~-~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p  516 (968)
T PLN00113        438 NNLQGRINSR-KWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIP  516 (968)
T ss_pred             CcccCccChh-hccCCCCcEEECcCceeeeecCcccccccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCC
Confidence            4444333322 3333                       44555554432211      1224567888888888888888


Q ss_pred             hhhhCCCCCCEEecCCccccccCCccccCCCCCCEEeCCCCcCCccCccccccCCCCCEEeccCCcccCCCCCCCCCCcc
Q 040815          133 ASIANLKGLQVLNLQYNNLQGLIPSSLGNLTNLESLDLSNKKFAGRIPQQLVELTFLEFFNVSDNYLTGPIPQGKQFATF  212 (305)
Q Consensus       133 ~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~l~~N~l~~~~p~~~~~~~l  212 (305)
                      ..+..+++|+.|+|++|.+++.+|..+..+++|++|+|++|++++.+|..+..++.|+++++++|+++|.+|....+..+
T Consensus       517 ~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~  596 (968)
T PLN00113        517 DELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAI  596 (968)
T ss_pred             hHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhccc
Confidence            88888888888888888888888888888888888888888888888888888888888888888888888887777778


Q ss_pred             CCCccCCCCCCCCCC
Q 040815          213 DNTSFDGNSGLCGKP  227 (305)
Q Consensus       213 ~~~~~~~n~~~c~~~  227 (305)
                      ....+.||+.+|+.+
T Consensus       597 ~~~~~~~n~~lc~~~  611 (968)
T PLN00113        597 NASAVAGNIDLCGGD  611 (968)
T ss_pred             ChhhhcCCccccCCc
Confidence            788888998888743



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08374 Protocadherin: Protocadherin; InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-16
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-16
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-14
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 82.8 bits (203), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 80/289 (27%), Positives = 118/289 (40%), Gaps = 64/289 (22%) Query: 8 NLFEGRIPRSLINCSKLEFLGLGNYQISDTFPSWLGTLPKLNV----------------- 50 N G IP L NC+ L ++ L N +++ P W+G L L + Sbjct: 473 NDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELG 532 Query: 51 -------LILRSNIFYGVI------EEPRTGCGF-SKLRIIDLSNNRF------SGNLPS 90 L L +N+F G I + + F + R + + N+ +GNL Sbjct: 533 DCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNL-- 590 Query: 91 KSFLCWNAMKIVNARRMMTYN--KIPDILAG---------------IILSNNRFVGAIPA 133 L + ++ R+ T N I + G + +S N G IP Sbjct: 591 ---LEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPK 647 Query: 134 SIANLKGXXXXXXXXXXXXXXIPSSLGNLTNLESLDLSNKKFAGRIPQQLVELTFLEFFN 193 I ++ IP +G+L L LDLS+ K GRIPQ + LT L + Sbjct: 648 EIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEID 707 Query: 194 VSDNYLTGPIPQGKQFATFDNTSFDGNSGLCGKPLSKGCESGETPTNED 242 +S+N L+GPIP+ QF TF F N GLCG PL + C+ P+N D Sbjct: 708 LSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPR-CD----PSNAD 751
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-63
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-43
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-43
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-41
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-40
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-37
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-36
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-35
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-33
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-33
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-28
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-60
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-35
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-32
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-26
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-26
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-29
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-29
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-24
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-24
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-20
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-26
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-25
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-24
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-23
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-23
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-22
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-21
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-24
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-19
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-18
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-16
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-22
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-21
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-19
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-09
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-17
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-16
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-11
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-10
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-15
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-11
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-13
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-13
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-12
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 9e-11
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-09
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-14
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-07
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-09
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 6e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-07
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-10
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-09
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 7e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-04
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 4e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  210 bits (537), Expect = 8e-63
 Identities = 62/245 (25%), Positives = 97/245 (39%), Gaps = 24/245 (9%)

Query: 6   SHNLFEGRIPRSLINCSKLEFLGLGNYQISDTFPSWLGTLPKLNVLILRSNIFYGVIEEP 65
           + NLF G IP ++   S      +    I+     ++             N+        
Sbjct: 546 NTNLFNGTIPAAMFKQSGK----IAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRS 601

Query: 66  RTGCGFSKLRIIDLSNNRFSGNLPSKSFLCWNAMKIVNARRMMTYNKIPDILAGIILSNN 125
                 S     ++++  + G+         +                   +  + +S N
Sbjct: 602 EQLNRLSTRNPCNITSRVYGGHTSPTFDNNGS-------------------MMFLDMSYN 642

Query: 126 RFVGAIPASIANLKGLQVLNLQYNNLQGLIPSSLGNLTNLESLDLSNKKFAGRIPQQLVE 185
              G IP  I ++  L +LNL +N++ G IP  +G+L  L  LDLS+ K  GRIPQ +  
Sbjct: 643 MLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSA 702

Query: 186 LTFLEFFNVSDNYLTGPIPQGKQFATFDNTSFDGNSGLCGKPLSKGCESGETPTNEDHTE 245
           LT L   ++S+N L+GPIP+  QF TF    F  N GLCG PL + C+         H  
Sbjct: 703 LTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPR-CDPSNADGYAHHQR 761

Query: 246 GSSES 250
                
Sbjct: 762 SHHHH 766


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query305
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.97
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.95
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.93
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.93
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.93
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.93
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.92
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.92
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.92
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.92
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.92
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.92
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.91
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.91
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.9
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.89
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.89
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.89
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.89
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.88
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.88
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.88
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.88
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.88
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.88
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.88
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.87
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.87
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.87
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.86
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.86
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.84
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.83
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.83
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.82
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.82
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.81
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.8
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.8
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.78
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.77
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.77
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.77
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.77
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.76
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.75
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.74
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.74
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.73
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.73
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.72
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.7
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.68
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.66
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.66
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.64
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.63
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.61
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.6
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.57
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.55
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.51
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.5
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.47
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.47
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.45
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.44
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.42
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.39
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.35
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.03
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.74
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.73
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.71
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.66
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.65
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.62
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.5
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.21
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.1
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.07
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.07
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.91
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.77
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.61
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.56
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.34
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.11
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 91.03
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 91.01
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=4.3e-36  Score=291.21  Aligned_cols=231  Identities=35%  Similarity=0.531  Sum_probs=172.0

Q ss_pred             EEEccCCccccccchhccCCCCCcEEeCCCcccCCCcChhccCCCCCCEEEccCccCCcccCCCCCCCCCCCccEEEccC
Q 040815            2 EAKRSHNLFEGRIPRSLINCSKLEFLGLGNYQISDTFPSWLGTLPKLNVLILRSNIFYGVIEEPRTGCGFSKLRIIDLSN   81 (305)
Q Consensus         2 ~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~l~~L~~L~L~~   81 (305)
                      +|+|++|.+++.+|..+..+++|++|++++|++++.+|..+..+++|++|+|++|.+++.+|..+  +.+++|++|++++
T Consensus       446 ~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~--~~l~~L~~L~L~~  523 (768)
T 3rgz_A          446 DLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWI--GRLENLAILKLSN  523 (768)
T ss_dssp             EEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGG--GGCTTCCEEECCS
T ss_pred             EEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHH--hcCCCCCEEECCC
Confidence            44555555555555555555555555555555555555555555555555555555555544444  4555555555555


Q ss_pred             CcCcccCChhhhhccchhhhhhhccccc----------------------------------------------------
Q 040815           82 NRFSGNLPSKSFLCWNAMKIVNARRMMT----------------------------------------------------  109 (305)
Q Consensus        82 n~l~g~~p~~~~~~l~~L~~l~l~~~~~----------------------------------------------------  109 (305)
                      |.++|.+|.. +..+++|+.|+++.+..                                                    
T Consensus       524 N~l~~~~p~~-l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  602 (768)
T 3rgz_A          524 NSFSGNIPAE-LGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSE  602 (768)
T ss_dssp             SCCEEECCGG-GGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGG
T ss_pred             CcccCcCCHH-HcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccch
Confidence            5555555543 55555555555443100                                                    


Q ss_pred             ------------------------cCcccccccEEEccCCccccccchhhhCCCCCCEEecCCccccccCCccccCCCCC
Q 040815          110 ------------------------YNKIPDILAGIILSNNRFVGAIPASIANLKGLQVLNLQYNNLQGLIPSSLGNLTNL  165 (305)
Q Consensus       110 ------------------------~~~~~~~L~~L~ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L  165 (305)
                                              ....++.|+.||+++|.++|.+|..+++++.|+.|+|++|+++|.+|..++++++|
T Consensus       603 ~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L  682 (768)
T 3rgz_A          603 QLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGL  682 (768)
T ss_dssp             GGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTC
T ss_pred             hhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCC
Confidence                                    01124678999999999999999999999999999999999999999999999999


Q ss_pred             CEEeCCCCcCCccCccccccCCCCCEEeccCCcccCCCCCCCCCCccCCCccCCCCCCCCCCCCCCCCCCC
Q 040815          166 ESLDLSNKKFAGRIPQQLVELTFLEFFNVSDNYLTGPIPQGKQFATFDNTSFDGNSGLCGKPLSKGCESGE  236 (305)
Q Consensus       166 ~~L~L~~N~l~~~~p~~~~~l~~L~~L~l~~N~l~~~~p~~~~~~~l~~~~~~~n~~~c~~~~~~~c~~~~  236 (305)
                      ++|||++|+++|.+|..+..++.|++||+++|+++|.+|...++.++...+|.|||.+||.|+. .|....
T Consensus       683 ~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~~  752 (768)
T 3rgz_A          683 NILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDPSN  752 (768)
T ss_dssp             CEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCSCC
T ss_pred             CEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCCCc
Confidence            9999999999999999999999999999999999999999999999999999999999999987 787654



>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 305
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-23
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-12
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 9e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 2e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-05
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-05
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.001
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.003
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 95.1 bits (235), Expect = 7e-23
 Identities = 43/193 (22%), Positives = 71/193 (36%), Gaps = 15/193 (7%)

Query: 6   SHNLFEGRIPRSLINCSKLEFLGLGNYQISDTFPSWLGTLPKLNVLILRSNIFYGVIEEP 65
           ++N      P      + L+ L L   Q+ D     L +L  L  L L +N    +    
Sbjct: 205 TNNQISDITPL--GILTNLDELSLNGNQLKD--IGTLASLTNLTDLDLANNQISNLAPL- 259

Query: 66  RTGCGFSKLRIIDLSNNRFSGNLPSKSFLCWNAMKIV-NARRMMTYNKIPDILAGIILSN 124
               G +KL  + L  N+ S   P         +++  N    ++       L  + L  
Sbjct: 260 ---SGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYF 316

Query: 125 NRFVGAIPASIANLKGLQVLNLQYNNLQGLIPSSLGNLTNLESLDLSNKKFAGRIPQQLV 184
           N      P  +++L  LQ L    N +     SSL NLTN+  L   + + +   P  L 
Sbjct: 317 NNISDISP--VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHNQISDLTP--LA 370

Query: 185 ELTFLEFFNVSDN 197
            LT +    ++D 
Sbjct: 371 NLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query305
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.94
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.86
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.86
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.8
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.8
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.79
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.79
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.78
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.78
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.74
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.65
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.63
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.62
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.61
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.55
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.55
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.52
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.46
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.46
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.44
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.41
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.32
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.27
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.01
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.57
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.53
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.06
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.86
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.42
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.26
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.97  E-value=5e-32  Score=233.85  Aligned_cols=226  Identities=31%  Similarity=0.429  Sum_probs=184.5

Q ss_pred             EEEccCCcccc--ccchhccCCCCCcEEeCCC-cccCCCcChhccCCCCCCEEEccCccCCcccCCCCCCCCCCCccEEE
Q 040815            2 EAKRSHNLFEG--RIPRSLINCSKLEFLGLGN-YQISDTFPSWLGTLPKLNVLILRSNIFYGVIEEPRTGCGFSKLRIID   78 (305)
Q Consensus         2 ~L~Ls~n~l~~--~~~~~l~~l~~L~~L~L~~-n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~l~~L~~L~   78 (305)
                      .|+|++|.++|  .+|++++++++|++|+|++ |+++|.+|..|+++++|++|+|++|++.+..+..+  ..+..|+.++
T Consensus        54 ~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~--~~~~~L~~l~  131 (313)
T d1ogqa_          54 NLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFL--SQIKTLVTLD  131 (313)
T ss_dssp             EEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGG--GGCTTCCEEE
T ss_pred             EEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccc--cchhhhcccc
Confidence            58999999987  4789999999999999986 88999999999999999999999999988776655  6677788888


Q ss_pred             ccCCcCcccCChhhhhccchhhhhhhccccc-------cCcccc-----------------------cccEEEccCCccc
Q 040815           79 LSNNRFSGNLPSKSFLCWNAMKIVNARRMMT-------YNKIPD-----------------------ILAGIILSNNRFV  128 (305)
Q Consensus        79 L~~n~l~g~~p~~~~~~l~~L~~l~l~~~~~-------~~~~~~-----------------------~L~~L~ls~n~l~  128 (305)
                      +++|.+.+.+|.. +..++.++.+++..+..       +.....                       ....++++.+.+.
T Consensus       132 l~~N~~~~~~p~~-l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~~~  210 (313)
T d1ogqa_         132 FSYNALSGTLPPS-ISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLE  210 (313)
T ss_dssp             CCSSEEESCCCGG-GGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEE
T ss_pred             cccccccccCchh-hccCcccceeeccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            8888777666654 67777777766654211       111111                       2234555666666


Q ss_pred             cccchhhhCCCCCCEEecCCccccccCCccccCCCCCCEEeCCCCcCCccCccccccCCCCCEEeccCCcccCCCCCCCC
Q 040815          129 GAIPASIANLKGLQVLNLQYNNLQGLIPSSLGNLTNLESLDLSNKKFAGRIPQQLVELTFLEFFNVSDNYLTGPIPQGKQ  208 (305)
Q Consensus       129 ~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~l~~N~l~~~~p~~~~  208 (305)
                      +.+|..+..+++++.+++++|.+.+.+| .+..+++|+.|+|++|+++|.+|..+..+++|++|||++|+|+|.+|+...
T Consensus       211 ~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~  289 (313)
T d1ogqa_         211 GDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGN  289 (313)
T ss_dssp             ECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTT
T ss_pred             cccccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCccc
Confidence            6677777778899999999999997655 588899999999999999999999999999999999999999999998888


Q ss_pred             CCccCCCccCCCCCCCCCCCCCCC
Q 040815          209 FATFDNTSFDGNSGLCGKPLSKGC  232 (305)
Q Consensus       209 ~~~l~~~~~~~n~~~c~~~~~~~c  232 (305)
                      +..+..+++.||+.+|+.|++ .|
T Consensus       290 L~~L~~l~l~~N~~l~g~plp-~c  312 (313)
T d1ogqa_         290 LQRFDVSAYANNKCLCGSPLP-AC  312 (313)
T ss_dssp             GGGSCGGGTCSSSEEESTTSS-CC
T ss_pred             CCCCCHHHhCCCccccCCCCC-CC
Confidence            889999999999999998864 45



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure