Citrus Sinensis ID: 040876


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340---
MSVVLVFALFLFELLVISISFCNGSSDHMGCLESEREALLRFKQDLQDPSNRLASWNIGGDCCTWAGIVCDNVTGHIIELNLRNPFTYYRRSRYKANPRSMLVGKGPIPSWLYRLTHLEQLSVADRPSLASREDQDLLSNIRQRLSKCRTGAKSSQEISDIFDIFSGCVSKGLEILVLRSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLSDNKLNGTLSEIHFVNLTKLSVFSVNENNLTLKFLDLGENQIHGEMTNLTNATQLWYLRLHSNNFSGPLSLISSNLVYLDLFNNSFLGSISHFWCYRSNETKRLRALSLGDNYLQGE
ccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccccccccccccEEEccccccEEEEEccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccHHHcccccccccccccccccccccccccccccccccEEEccccEEEEcccHHHcccccccEEEcccccEEccccHHccccccccEEEcccccccccccHHHHcccccccEEEccccccccccEEccccccEEccccccccccccEEcccccccccccccccccccEEEccccccccccccHHHHcccccccccEEEccccccccc
ccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccccccccEEEEEEccccccEEEccccccHHHccccccEEEEcccccccccccHHHcccccccEEEEccccccccccccccccHHHcccccccEEEcccccccccccHHHHccHHHccEEEcccccccccccHHHcccccccEEEcccccccccHHHcHcccccccEEEcccccccccccHHHHcccccccEEEccccccEEEEEEcccccccccccccccccccEEEEccccccccccccccccccEEEcccccccccccHHHHccccccccccEEEccccccccc
MSVVLVFALFLFELLVISISFcngssdhmgcLESEREALLRFKQdlqdpsnrlaswniggdcctwagivcdnvTGHIielnlrnpftyyrrsrykanprsmlvgkgpipswlyrlthleqlsvadrpslasredQDLLSNIRQRLSKcrtgakssqEISDIFDIFSGCVSKGLEILVLRSssisghlteqighfknldtldlgnnsivglvplslnELSKLRILHlsdnklngtlseIHFVNLTKLSVFSvnennltlkfldlgenqihgemtnltnATQLWYLRLhsnnfsgplslissnlvyldlfnnsflgsISHFWCYRSNETKRLRALSlgdnylqge
MSVVLVFALFLFELLVISISFCNGSSDHMGCLESEREALLRFKQDLQDPSNRLASWNIGGDCCTWAGIVCDNVTGHIIELNLRNPFTYYRRSrykanprsmlvgKGPIPSWLYRLTHLEQLSvadrpslasredqdLLSNIRQRLSkcrtgakssqeiSDIFDIFSGCVSKGLEILVLRSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLSDNKLNGTLSEIHFVNLTKLSVFSVNENNLTLKFLDLGENQIHGEMTNLTNATQLWYLRLHSNNFSGPLSLISSNLVYLDLFNNSFLGSISHFWCYRSNETKRLRalslgdnylqge
MSvvlvfalflfellvISISFCNGSSDHMGCLESEREALLRFKQDLQDPSNRLASWNIGGDCCTWAGIVCDNVTGHIIELNLRNPFTYYRRSRYKANPRSMLVGKGPIPSWLYRLTHLEQLSVADRPSLASREDQDLLSNIRQRLSKCRTGAKSSQEISDIFDIFSGCVSKGLEILVLRSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLSDNKLNGTLSEIHFVNLTKLSVFSVNENNLTLKFLDLGENQIHGEMTNLTNATQLWYLRLHSNNFSGPLSLISSNLVYLDLFNNSFLGSISHFWCYRSNETKRLRALSLGDNYLQGE
**VVLVFALFLFELLVISISFCNGSSDHMGCLESEREALLRFKQDLQDPSNRLASWNIGGDCCTWAGIVCDNVTGHIIELNLRNPFTYYRRSRYKANPRSMLVGKGPIPSWLYRLTHLEQLS***********************************ISDIFDIFSGCVSKGLEILVLRSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLSDNKLNGTLSEIHFVNLTKLSVFSVNENNLTLKFLDLGENQIHGEMTNLTNATQLWYLRLHSNNFSGPLSLISSNLVYLDLFNNSFLGSISHFWCYRSNETKRLRAL**********
*SVVLVFALFLFELLVISISFCN**********SEREALLRFKQDLQDPSNRLASWNIGGDCCTWAGIVCDNVTGHIIELNLRNPFTYYRRSRYKANPRSMLVGKGPIPSWLYRLTHLEQLSVADRPSLASRE******NIRQRLSKCRTGAKSSQEISDIFDIFSGCVSKGLEILVLRSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLSDNKLNGTLSEIHFVNLTKLSVFSVNENNLTLKFLDLGENQIHGEMTNLTNATQLWYLRLHSNNFSGPLSLISSNLVYLDLFNNSFLGSISHFWCYRSNETKRLRALSLGDNYLQ**
MSVVLVFALFLFELLVISISFCNGSSDHMGCLESEREALLRFKQDLQDPSNRLASWNIGGDCCTWAGIVCDNVTGHIIELNLRNPFTYYRRSRYKANPRSMLVGKGPIPSWLYRLTHLEQLSVADRPSLASREDQDLLSNIRQRLS*********QEISDIFDIFSGCVSKGLEILVLRSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLSDNKLNGTLSEIHFVNLTKLSVFSVNENNLTLKFLDLGENQIHGEMTNLTNATQLWYLRLHSNNFSGPLSLISSNLVYLDLFNNSFLGSISHFWCYRSNETKRLRALSLGDNYLQGE
*SVVLVFALFLFELLVISISFCNGSSDHMGCLESEREALLRFKQDLQDPSNRLASWNIGGDCCTWAGIVCDNVTGHIIELNLRNPFTYYRRSRYKANPRSMLVGKGPIPSWLYRLTHLEQLSVADRPSLASREDQDLLSNIRQRLSKCRTGAKSSQEISDIFDIFSGCVSKGLEILVLRSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLSDNKLNGTLSEIHFVNLTKLSVFSVNENNLTLKFLDLGENQIHGEMTNLTNATQLWYLRLHSNNFSGPLSLISSNLVYLDLFNNSFLGSISHFWCYRSNETKRLRALSLGDN*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVVLVFALFLFELLVISISFCNGSSDHMGCLESEREALLRFKQDLQDPSNRLASWNIGGDCCTWAGIVCDNVTGHIIELNLRNPFTYYRRSRYKANPRSMLVGKGPIPSWLYRLTHLEQLSVADRPSLASREDQDLLSNIRQRLSKCRTGAKSSQEISDIFDIFSGCVSKGLEILVLRSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLSDNKLNGTLSEIHFVNLTKLSVFSVNENNLTLKFLDLGENQIHGEMTNLTNATQLWYLRLHSNNFSGPLSLISSNLVYLDLFNNSFLGSISHFWCYRSNETKRLRALSLGDNYLQGE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query343 2.2.26 [Sep-21-2011]
Q9C9H7 847 Receptor-like protein 12 no no 0.880 0.356 0.285 1e-18
O82318 960 Probably inactive leucine no no 0.816 0.291 0.285 5e-17
Q00874372 DNA-damage-repair/tolerat no no 0.781 0.720 0.277 8e-15
Q6XAT2 967 LRR receptor-like serine/ no no 0.752 0.266 0.286 3e-14
C0LGQ5 1249 LRR receptor-like serine/ no no 0.822 0.225 0.306 1e-13
Q9S7I6 1151 LRR receptor-like serine/ no no 0.527 0.157 0.308 2e-13
Q9FL28 1173 LRR receptor-like serine/ no no 0.906 0.265 0.268 4e-13
Q05091330 Polygalacturonase inhibit N/A no 0.688 0.715 0.264 1e-12
Q9FL51 872 Probably inactive leucine no no 0.755 0.297 0.296 3e-12
Q9M5J9330 Polygalacturonase inhibit no no 0.705 0.733 0.251 4e-12
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score = 94.4 bits (233), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 109/382 (28%), Positives = 166/382 (43%), Gaps = 80/382 (20%)

Query: 9   LFLFELLVISISFCNGSSDHMGCLESEREALLRFKQDLQDPSNR--------LASWNIGG 60
           +    LLV S++    SS H  C + +R+ALL F+ +   P N            WN   
Sbjct: 16  IIFLSLLVHSLA---SSSPHF-CRDDQRDALLEFRGEF--PINASWHIMNQWRGPWNKST 69

Query: 61  DCCTWAGIVCDNVTGHIIELNLRNPF--------------TYYRR------SRYKANPRS 100
           DCC W G+ C++ +G +I L++ N F               Y R       + Y   P S
Sbjct: 70  DCCLWNGVTCNDKSGQVISLDIPNTFLNNYLKTNSSLFKLQYLRHLDLTNCNLYGEIPSS 129

Query: 101 M-------LVG------KGPIPSWLYRLTHLEQLSVADRPSLASREDQDLLSNIRQ---- 143
           +       LV        G IP+ +  L  L  L +A+  ++ + E    L N+ +    
Sbjct: 130 LGNLSHLTLVNLYFNKFVGEIPASIGNLNQLRHLILAN--NVLTGEIPSSLGNLSRLVNL 187

Query: 144 RLSKCRTGAKSSQEISDIFDIFSGCVSKGLEILVLRSSSISGHLTEQIGHFKNLDTLDLG 203
            L   R   K    I D+         K L  L L S+++ G +   +G+  NL  L L 
Sbjct: 188 ELFSNRLVGKIPDSIGDL---------KQLRNLSLASNNLIGEIPSSLGNLSNLVHLVLT 238

Query: 204 NNSIVGLVPLSLNELSKLRILHLSDNKLNGTLSEIHFVNLTKLSVFSVNENNLTLKFLDL 263
           +N +VG VP S+  L +LR++   +N L+G +  I F NLTKLS+F ++ NN T  F   
Sbjct: 239 HNQLVGEVPASIGNLIELRVMSFENNSLSGNI-PISFANLTKLSIFVLSSNNFTSTF--- 294

Query: 264 GENQIHGEMTNLTNATQLWYLRLHSNNFSGPLS---LISSNLVYLDLFNNSFLGSISHFW 320
                  +M+   N   L Y  +  N+FSGP     L+  +L  + L  N F G I    
Sbjct: 295 -----PFDMSIFHN---LEYFDVSYNSFSGPFPKSLLLIPSLESIYLQENQFTGPIEF-- 344

Query: 321 CYRSNETKRLRALSLGDNYLQG 342
              ++ + +L+ L LG N L G
Sbjct: 345 -ANTSSSTKLQDLILGRNRLHG 365




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|Q00874|DR100_ARATH DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2 Back     alignment and function description
>sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9S7I6|RPK2_ARATH LRR receptor-like serine/threonine-protein kinase RPK2 OS=Arabidopsis thaliana GN=RPK2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q05091|PGIP_PYRCO Polygalacturonase inhibitor OS=Pyrus communis GN=PGIP PE=1 SV=1 Back     alignment and function description
>sp|Q9FL51|Y5694_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940 OS=Arabidopsis thaliana GN=At5g06940 PE=3 SV=1 Back     alignment and function description
>sp|Q9M5J9|PGIP1_ARATH Polygalacturonase inhibitor 1 OS=Arabidopsis thaliana GN=PGIP1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query343
359473590 780 PREDICTED: LRR receptor-like serine/thre 0.586 0.257 0.367 2e-23
359473582 781 PREDICTED: LRR receptor-like serine/thre 0.530 0.233 0.372 2e-22
359473578 777 PREDICTED: LRR receptor-like serine/thre 0.527 0.232 0.368 9e-22
224095212 594 predicted protein [Populus trichocarpa] 0.804 0.464 0.314 2e-21
302143762 965 unnamed protein product [Vitis vinifera] 0.941 0.334 0.294 2e-21
147865941 781 hypothetical protein VITISV_037334 [Viti 0.530 0.233 0.368 2e-21
350284769 1041 receptor-like protein [Malus x domestica 0.982 0.323 0.312 1e-20
255581850 1082 leucine-rich repeat receptor protein kin 0.548 0.173 0.312 1e-20
147843339 969 hypothetical protein VITISV_034464 [Viti 0.839 0.297 0.302 1e-20
225466101 1035 PREDICTED: LRR receptor-like serine/thre 0.787 0.260 0.307 2e-20
>gi|359473590|ref|XP_003631330.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  116 bits (290), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 89/242 (36%), Positives = 125/242 (51%), Gaps = 41/242 (16%)

Query: 9   LFLFELLVISISFCNGSSDHMGCLESEREALLRFKQDLQDPSNRLASWNIGGDCCTWAGI 68
            FL E LVI+ +  +G  D + C+E ER+ALL+FK  L+DPS RL+SW +GGDCC W G+
Sbjct: 22  FFLLEALVINST--DGDRDVV-CIEMERKALLKFKGGLEDPSGRLSSW-VGGDCCKWQGV 77

Query: 69  VCDNVTGHIIELNLRNPFTYYRRSRYKANPRSMLVGKGPIPSWLYRLTHLEQLSVADRPS 128
            C+N TGH+I+L+L+NP+    +S   A P S L+G+  I   L  L +L  L +     
Sbjct: 78  DCNNGTGHVIKLDLKNPY----QSDEAAFPLSRLIGQ--ISDSLLDLKYLNYLDL----- 126

Query: 129 LASREDQDLLSNIRQRLSKCRTGAKSSQEISDIFDIFSGCVSKGLEILVLRSSSISGHLT 188
                                    S  E+S +     G +   L  L L  +SISG + 
Sbjct: 127 -------------------------SKNELSGLIPDSIGNLDN-LRYLDLSDNSISGSIP 160

Query: 189 EQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLSDNKLNGTLSEIHFVNLTKLSV 248
             IG    L+ LDL +N + G +P S+ +L +L  L    N   G +SEIHF+ L KL  
Sbjct: 161 ASIGRLLLLEELDLSHNGMNGTIPESIGQLKELLTLTFDWNPWKGRVSEIHFMGLIKLEY 220

Query: 249 FS 250
           FS
Sbjct: 221 FS 222




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359473582|ref|XP_003631326.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase ERL1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359473578|ref|XP_002264037.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase ERL1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224095212|ref|XP_002310361.1| predicted protein [Populus trichocarpa] gi|222853264|gb|EEE90811.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|302143762|emb|CBI22623.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147865941|emb|CAN78838.1| hypothetical protein VITISV_037334 [Vitis vinifera] Back     alignment and taxonomy information
>gi|350284769|gb|AEQ27756.1| receptor-like protein [Malus x domestica] Back     alignment and taxonomy information
>gi|255581850|ref|XP_002531725.1| leucine-rich repeat receptor protein kinase exs precursor, putative [Ricinus communis] gi|223528628|gb|EEF30645.1| leucine-rich repeat receptor protein kinase exs precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147843339|emb|CAN80531.1| hypothetical protein VITISV_034464 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225466101|ref|XP_002265750.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query343
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.784 0.285 0.318 3.4e-22
TAIR|locus:2044767 905 AT2G34930 "AT2G34930" [Arabido 0.868 0.329 0.322 6.6e-20
UNIPROTKB|Q40640 1025 Xa21 "Receptor kinase-like pro 0.883 0.295 0.293 8e-20
TAIR|locus:2182855 967 ERL2 "ERECTA-like 2" [Arabidop 0.571 0.202 0.334 1.5e-19
TAIR|locus:2040075 935 RLP21 "AT2G25470" [Arabidopsis 0.626 0.229 0.310 8.3e-19
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.851 0.233 0.301 1.2e-18
TAIR|locus:2043540 960 AT2G25790 [Arabidopsis thalian 0.507 0.181 0.321 2.1e-18
TAIR|locus:2180587 811 RLP52 "receptor like protein 5 0.833 0.352 0.299 5.8e-18
TAIR|locus:2180617 1005 AT5G25930 [Arabidopsis thalian 0.830 0.283 0.298 8.1e-18
TAIR|locus:2096349 860 RLP31 "receptor like protein 3 0.830 0.331 0.284 6e-17
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 253 (94.1 bits), Expect = 3.4e-22, Sum P(2) = 3.4e-22
 Identities = 98/308 (31%), Positives = 143/308 (46%)

Query:    49 PSNRLASWNIGGDCCTWAGIVCDNVTGHIIELNLRNPFTY----YRRSRYKA-NPRSMLV 103
             P     SW    DCC W GI CD  +G +IEL+L   + Y       S ++  N R + +
Sbjct:    73 PHPTTESWRNNSDCCNWEGITCDTKSGEVIELDLSCSWLYGSFHSNSSLFRLQNLRVLDL 132

Query:   104 GK----GPIPSWLYRLTHLEQLSVADRPSLASREDQDLLSNIRQRLSKCRTGAKSSQEIS 159
              +    G IPS +  L+HL  L ++    L       L+ +  + LS+  +   SS + S
Sbjct:   133 TQNDLDGEIPSSIGNLSHLTSLHLSYNQFLG------LIPSSIENLSRLTSLHLSSNQFS 186

Query:   160 DIFDIFSGCVSKGLEILVLRSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELS 219
                    G +S  L  L L S+  SG +   IG+  NL  L L +N   G +P S+  L+
Sbjct:   187 GQIPSSIGNLSH-LTSLELSSNQFSGQIPSSIGNLSNLTFLSLPSNDFFGQIPSSIGNLA 245

Query:   220 KLRILHLSDNKLNGTLSEIHFVNLTKLSVFSVNENNLTLKFLDLGENQIHGEMTNLTNAT 279
             +L  L+LS N   G +    F NL +L V  V+ N L+      G   I     +L N T
Sbjct:   246 RLTYLYLSYNNFVGEIPS-SFGNLNQLIVLQVDSNKLS------GNVPI-----SLLNLT 293

Query:   280 QLWYLRLHSNNFSG--P--LSLISSNLVYLDLFNNSFLGSI-SHFWCYRSNETKRLRALS 334
             +L  L L  N F+G  P  +SL+S NL+  +  NN+F G++ S  +    N    +R L 
Sbjct:   294 RLSALLLSHNQFTGTIPNNISLLS-NLMDFEASNNAFTGTLPSSLF----NIPPLIR-LD 347

Query:   335 LGDNYLQG 342
             L DN L G
Sbjct:   348 LSDNQLNG 355


GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40640 Xa21 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2182855 ERL2 "ERECTA-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043540 AT2G25790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180587 RLP52 "receptor like protein 52" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180617 AT5G25930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096349 RLP31 "receptor like protein 31" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query343
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-24
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-09
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  103 bits (258), Expect = 3e-24
 Identities = 100/349 (28%), Positives = 161/349 (46%), Gaps = 74/349 (21%)

Query: 9   LFLFELLVISISFCNGSSDHMGCLESER-EALLRFKQDLQDPSNRLASWNIGGDCCTWAG 67
             +F L  + ++F          L +E  E LL FK  + DP   L++WN   D C W G
Sbjct: 11  YLIFMLFFLFLNF--------SMLHAEELELLLSFKSSINDPLKYLSNWNSSADVCLWQG 62

Query: 68  IVCDNVTGHIIELNLRNPFTYYRRSRYKANPRSMLVGK---GPIPSWLYRLTHLEQLSVA 124
           I C+N +  ++ ++L                     GK   G I S ++RL +++ ++++
Sbjct: 63  ITCNNSS-RVVSIDLS--------------------GKNISGKISSAIFRLPYIQTINLS 101

Query: 125 DRPSLASREDQDLLSNIRQRLSKCRTGAKSSQEISDIFDIFSGCVSKG----LEILVLRS 180
           +   L+     D+            T + S + ++   + F+G + +G    LE L L +
Sbjct: 102 NN-QLSGPIPDDIF-----------TTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSN 149

Query: 181 SSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLSDNKLNGTLSEIHF 240
           + +SG +   IG F +L  LDLG N +VG +P SL  L+ L  L L+ N+L G +     
Sbjct: 150 NMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIP---- 205

Query: 241 VNLTKLSVFSVNENNLTLKFLDLGENQIHGEM-TNLTNATQLWYLRLHSNNFSGPL--SL 297
             L ++          +LK++ LG N + GE+   +   T L +L L  NN +GP+  SL
Sbjct: 206 RELGQMK---------SLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSL 256

Query: 298 IS-SNLVYLDLFNNSFLGSI--SHFWCYRSNETKRLRALSLGDNYLQGE 343
            +  NL YL L+ N   G I  S F        ++L +L L DN L GE
Sbjct: 257 GNLKNLQYLFLYQNKLSGPIPPSIF------SLQKLISLDLSDNSLSGE 299


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 343
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.85
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.85
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.8
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.77
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.76
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.69
PLN03150623 hypothetical protein; Provisional 99.66
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.64
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.62
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.61
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.6
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.59
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.55
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.52
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.51
KOG0617264 consensus Ras suppressor protein (contains leucine 99.51
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.29
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.28
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.26
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.24
PLN03150623 hypothetical protein; Provisional 99.19
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.17
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.1
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.1
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.99
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.99
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.99
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.89
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.86
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.86
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.83
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.78
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.75
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.63
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.63
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.6
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.48
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.45
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.3
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.29
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.26
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.22
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.07
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.07
PRK15386 426 type III secretion protein GogB; Provisional 97.95
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.95
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.94
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.93
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.8
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.78
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.66
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.53
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.48
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.24
PRK15386 426 type III secretion protein GogB; Provisional 97.16
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.65
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.3
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.01
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.74
KOG4308 478 consensus LRR-containing protein [Function unknown 95.72
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.64
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.39
KOG4308 478 consensus LRR-containing protein [Function unknown 94.49
KOG2123 388 consensus Uncharacterized conserved protein [Funct 93.78
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 92.86
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.83
KOG0473 326 consensus Leucine-rich repeat protein [Function un 91.32
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.71
smart0037026 LRR Leucine-rich repeats, outliers. 90.71
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.3
smart0037026 LRR Leucine-rich repeats, outliers. 89.29
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.29
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.11
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 85.52
KOG1947482 consensus Leucine rich repeat proteins, some prote 82.19
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.1e-36  Score=317.40  Aligned_cols=296  Identities=29%  Similarity=0.493  Sum_probs=206.7

Q ss_pred             HHHHHHHHHhhhhCCCCCCCCCCCCCCCCCccccceEeCCCCCcEEEEecCCCccccccccceeCCC-------------
Q 040876           33 ESEREALLRFKQDLQDPSNRLASWNIGGDCCTWAGIVCDNVTGHIIELNLRNPFTYYRRSRYKANPR-------------   99 (343)
Q Consensus        33 ~~~~~~L~~~k~~~~~~~~~~~~W~~~~~~c~w~gv~c~~~~~~v~~l~l~~~~~~~~~~~g~~~~~-------------   99 (343)
                      ++|++||++||+++.+|.+.+.+|+...+||.|.||+|++ .++|+.||+++.     ++.|.++..             
T Consensus        28 ~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~-~~~v~~L~L~~~-----~i~~~~~~~~~~l~~L~~L~Ls  101 (968)
T PLN00113         28 AEELELLLSFKSSINDPLKYLSNWNSSADVCLWQGITCNN-SSRVVSIDLSGK-----NISGKISSAIFRLPYIQTINLS  101 (968)
T ss_pred             HHHHHHHHHHHHhCCCCcccCCCCCCCCCCCcCcceecCC-CCcEEEEEecCC-----CccccCChHHhCCCCCCEEECC
Confidence            4899999999999988887889998888999999999986 579999999986     555554432             


Q ss_pred             CCCCCCCCCCcccc-CCCCCCEecCCCCC--------CCCCCcccccchh-hccccccc-----CCCcc-ccC--cccch
Q 040876          100 SMLVGKGPIPSWLY-RLTHLEQLSVADRP--------SLASREDQDLLSN-IRQRLSKC-----RTGAK-SSQ--EISDI  161 (343)
Q Consensus       100 ~n~~~~~~ip~~l~-~l~~L~~L~Ls~n~--------~l~~L~~L~l~~n-l~~~l~~~-----~~~~~-~~~--~~~~i  161 (343)
                      +|++.+. +|..+. .+++|++|++++|.        .+++|++|++++| +.+.++..     ++..+ +.+  ..+.+
T Consensus       102 ~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~  180 (968)
T PLN00113        102 NNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKI  180 (968)
T ss_pred             CCccCCc-CChHHhccCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccC
Confidence            6777776 887765 88888888888886        4667888888888 66422110     00000 000  11455


Q ss_pred             hhhhhcCCCCCccEEEeecCccccccchhccCCCCCCEEECcCCcccccCCccccCCCCCcEEEccCccCccccChHhhh
Q 040876          162 FDIFSGCVSKGLEILVLRSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLSDNKLNGTLSEIHFV  241 (343)
Q Consensus       162 p~~l~~l~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~l~~N~l~g~~p~~~~~  241 (343)
                      |..++++  ++|++|++++|.+.+.+|..++++++|++|++++|.+++.+|..++++++|++|++++|.+++.+|. .++
T Consensus       181 p~~~~~l--~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~-~l~  257 (968)
T PLN00113        181 PNSLTNL--TSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPS-SLG  257 (968)
T ss_pred             ChhhhhC--cCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccCh-hHh
Confidence            6666666  6666666666666666666666666666666666666666666666666777777777666666666 666


Q ss_pred             cCCCCCeEEecCceee------------EeEEeccCCcccccCCCccccc-CCCeEeCcCCcccCccccc---CCCCcEE
Q 040876          242 NLTKLSVFSVNENNLT------------LKFLDLGENQIHGEMTNLTNAT-QLWYLRLHSNNFSGPLSLI---SSNLVYL  305 (343)
Q Consensus       242 ~l~~L~~L~l~~n~l~------------l~~L~ls~n~l~~~~~~~~~~~-~L~~L~Ls~N~l~~~~~~~---~~~L~~L  305 (343)
                      ++++|+.|++++|.++            ++.|++++|.+.+.+|..+... +|++|++++|.+++.+|..   +++|+.|
T Consensus       258 ~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L  337 (968)
T PLN00113        258 NLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVL  337 (968)
T ss_pred             CCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEE
Confidence            6677777777666653            4456777777776666666555 7777777777777666654   5677777


Q ss_pred             EccCCccccccCchhhccCCccccCceEecCCCcccc
Q 040876          306 DLFNNSFLGSISHFWCYRSNETKRLRALSLGDNYLQG  342 (343)
Q Consensus       306 ~Ls~N~l~~~~~~~l~~~l~~l~~L~~L~ls~N~l~g  342 (343)
                      ++++|.+++.+|    ..++.+++|+.|++++|+++|
T Consensus       338 ~L~~n~l~~~~p----~~l~~~~~L~~L~Ls~n~l~~  370 (968)
T PLN00113        338 QLWSNKFSGEIP----KNLGKHNNLTVLDLSTNNLTG  370 (968)
T ss_pred             ECcCCCCcCcCC----hHHhCCCCCcEEECCCCeeEe
Confidence            777777776554    445667788888888887765



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query343
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-12
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 8e-05
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-04
3rgx_A768 Structural Insight Into Brassinosteroid Perception 8e-05
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 4e-04
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 2e-04
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 2e-04
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 3e-04
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 3e-04
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 5e-04
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 6e-04
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 7e-04
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Iteration: 1

Score = 70.5 bits (171), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 90/331 (27%), Positives = 132/331 (39%), Gaps = 68/331 (20%) Query: 31 CLESEREALLRFKQDLQDPSNRLASWNIGGDCC--TWAGIVCDNVTG-------HIIELN 81 C +++ALL+ K+DL +P+ L+SW DCC TW G++CD T + LN Sbjct: 3 CNPQDKQALLQIKKDLGNPTT-LSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLN 61 Query: 82 LRNPFTYYRRSRYKANPRSMLVGK-----GPIPSWLYRLTHLEQLSVADRPSLASREDQD 136 L P+ + +G GPIP + +LT L L + + S D Sbjct: 62 LPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITH--TNVSGAIPD 119 Query: 137 LLSNIRQRLSKCRTGAKSSQEISDIFDIFSGCVSKGLEILVLRSSSISGHLTEQIGHFKN 196 LS I K L L +++SG L I N Sbjct: 120 FLSQI-----------------------------KTLVTLDFSYNALSGTLPPSISSLPN 150 Query: 197 LDTLDLGNNSIVGLVPLSLNELSKLRI-LHLSDNKLNGTLSEIHFVNLTKLSVFSVNENN 255 L + N I G +P S SKL + +S N+L G + F+ N Sbjct: 151 LVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPP----------TFA----N 196 Query: 256 LTLKFLDLGENQIHGEMTNLTNA---TQLWYLRLHSNNFSGPLSLISSNLVYLDLFNNSF 312 L L F+DL N + G+ + L + TQ +L +S F +S NL LDL NN Sbjct: 197 LNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRI 256 Query: 313 LGSISHFWCYRSNETKRLRALSLGDNYLQGE 343 G++ + K L +L++ N L GE Sbjct: 257 YGTLPQGL----TQLKFLHSLNVSFNNLCGE 283
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query343
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-45
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-29
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-25
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-20
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-16
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-15
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-13
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-42
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-19
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-19
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-16
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-18
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-09
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 8e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-15
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-15
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-14
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-13
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 9e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-13
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-14
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-14
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-13
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-13
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-13
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-12
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-11
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 1e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 6e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-11
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-07
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 5e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-10
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-10
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-10
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-10
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-08
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-09
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-08
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-07
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-05
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-07
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-06
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 9e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  162 bits (412), Expect = 9e-45
 Identities = 75/332 (22%), Positives = 127/332 (38%), Gaps = 73/332 (21%)

Query: 30  GCLESEREALLRFKQDLQDPSNRLASWNIGGDCCTWAGIVCDNVTGHIIELNLRNPFTYY 89
             L  E   L+ FK  L D  N L  W+   + CT+ G+ C +    +  ++L +     
Sbjct: 8   QSLYREIHQLISFKDVLPDK-NLLPDWSSNKNPCTFDGVTCRD--DKVTSIDLSS----- 59

Query: 90  RRSRYKANPRSMLVGKGPIPSWLYRLTHLEQLSVADRPSLASREDQDLLSNIRQRLSKCR 149
                    + + VG   + S L  LT LE L +                          
Sbjct: 60  ---------KPLNVGFSAVSSSLLSLTGLESLFL-------------------------- 84

Query: 150 TGAKSSQEISDIFDIFSGCVSKGLEILVLRSSSISGHL--TEQIGHFKNLDTLDLGNNSI 207
               S+  I+     F    S  L  L L  +S+SG +     +G    L  L++ +N++
Sbjct: 85  ----SNSHINGSVSGFKCSAS--LTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTL 138

Query: 208 VGLVPLS-LNELSKLRILHLSDNKLNGTL--SEIHFVNLTKLSVFSVNENNLT------- 257
                +S   +L+ L +L LS N ++G      +      +L   +++ N ++       
Sbjct: 139 DFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSR 198

Query: 258 ---LKFLDLGENQIHGEMTNLTNATQLWYLRLHSNNFSGPL-SLIS--SNLVYLDLFNNS 311
              L+FLD+  N     +  L + + L +L +  N  SG     IS  + L  L++ +N 
Sbjct: 199 CVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQ 258

Query: 312 FLGSISHFWCYRSNETKRLRALSLGDNYLQGE 343
           F+G I           K L+ LSL +N   GE
Sbjct: 259 FVGPIPPLPL------KSLQYLSLAENKFTGE 284


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query343
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.98
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.93
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.93
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.93
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.92
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.92
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.92
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.92
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.92
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.92
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.91
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.91
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.91
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.9
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.9
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.9
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.9
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.9
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.89
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.89
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.89
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.89
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.89
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.88
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.87
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.87
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.86
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.85
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.84
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.83
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.81
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.8
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.8
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.74
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.71
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.7
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.67
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.65
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.65
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.64
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.62
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.59
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.54
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.53
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.47
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.46
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.44
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.44
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.42
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.39
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.36
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.36
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.33
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.31
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.28
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.26
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.2
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.19
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.92
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.82
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.77
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.75
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.65
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.63
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.28
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.0
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.87
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.77
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.65
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.62
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.53
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.09
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.85
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.82
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.72
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.32
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.28
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=2e-41  Score=308.52  Aligned_cols=270  Identities=28%  Similarity=0.422  Sum_probs=228.1

Q ss_pred             CCcHHHHHHHHHhhhhCCCCCCCCCCCCCCCCCcc--ccceEeCCCC--CcEEEEecCCCccccccccceeCCCCCCCCC
Q 040876           30 GCLESEREALLRFKQDLQDPSNRLASWNIGGDCCT--WAGIVCDNVT--GHIIELNLRNPFTYYRRSRYKANPRSMLVGK  105 (343)
Q Consensus        30 ~~~~~~~~~L~~~k~~~~~~~~~~~~W~~~~~~c~--w~gv~c~~~~--~~v~~l~l~~~~~~~~~~~g~~~~~~n~~~~  105 (343)
                      .|.++|++||++||+++.+|. .+.+|..+.+||.  |.||+|+..+  ++|+.+++++.                .+++
T Consensus         2 ~c~~~~~~aL~~~k~~~~~~~-~l~~W~~~~~~C~~~w~gv~C~~~~~~~~l~~L~L~~~----------------~l~~   64 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLGNPT-TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGL----------------NLPK   64 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECC----------------CCSS
T ss_pred             CCCHHHHHHHHHHHHhcCCcc-cccCCCCCCCCCcCCCcceEeCCCCCCceEEEEECCCC----------------CccC
Confidence            588999999999999998876 7889988889998  9999998655  89999999986                4444


Q ss_pred             --CCCCccccCCCCCCEecCCC-CC----------CCCCCcccccchh-hcccccccCCCccccCcccchhhhhhcCCCC
Q 040876          106 --GPIPSWLYRLTHLEQLSVAD-RP----------SLASREDQDLLSN-IRQRLSKCRTGAKSSQEISDIFDIFSGCVSK  171 (343)
Q Consensus       106 --~~ip~~l~~l~~L~~L~Ls~-n~----------~l~~L~~L~l~~n-l~~~l~~~~~~~~~~~~~~~ip~~l~~l~~~  171 (343)
                        . +|+.++++++|++|++++ |.          .+++|++|++++| +.                +.+|+.+.++  +
T Consensus        65 ~~~-~~~~l~~l~~L~~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~----------------~~~p~~~~~l--~  125 (313)
T 1ogq_A           65 PYP-IPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVS----------------GAIPDFLSQI--K  125 (313)
T ss_dssp             CEE-CCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCE----------------EECCGGGGGC--T
T ss_pred             Ccc-cChhHhCCCCCCeeeCCCCCcccccCChhHhcCCCCCEEECcCCeeC----------------CcCCHHHhCC--C
Confidence              3 888999999999999995 65          5667888999888 77                5788888888  8


Q ss_pred             CccEEEeecCccccccchhccCCCCCCEEECcCCcccccCCccccCCC-CCcEEEccCccCccccChHhhhcCCCCCeEE
Q 040876          172 GLEILVLRSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELS-KLRILHLSDNKLNGTLSEIHFVNLTKLSVFS  250 (343)
Q Consensus       172 ~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~-~L~~L~l~~N~l~g~~p~~~~~~l~~L~~L~  250 (343)
                      +|++|++++|.+++.+|..+..+++|++|++++|.+++.+|..++.++ +|++|++++|++++.+|. .+..++ |+.|+
T Consensus       126 ~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~-~~~~l~-L~~L~  203 (313)
T 1ogq_A          126 TLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPP-TFANLN-LAFVD  203 (313)
T ss_dssp             TCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCG-GGGGCC-CSEEE
T ss_pred             CCCEEeCCCCccCCcCChHHhcCCCCCeEECcCCcccCcCCHHHhhhhhcCcEEECcCCeeeccCCh-HHhCCc-ccEEE
Confidence            999999999999988898899999999999999999888898898887 899999999999888887 777777 99999


Q ss_pred             ecCceee------------EeEEeccCCcccccCCCcccccCCCeEeCcCCcccCccccc---CCCCcEEEccCCccccc
Q 040876          251 VNENNLT------------LKFLDLGENQIHGEMTNLTNATQLWYLRLHSNNFSGPLSLI---SSNLVYLDLFNNSFLGS  315 (343)
Q Consensus       251 l~~n~l~------------l~~L~ls~n~l~~~~~~~~~~~~L~~L~Ls~N~l~~~~~~~---~~~L~~L~Ls~N~l~~~  315 (343)
                      +++|.++            ++.|++++|++++.+|......+|++|++++|++++.+|..   +++|++|++++|.++|.
T Consensus       204 Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~  283 (313)
T 1ogq_A          204 LSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGE  283 (313)
T ss_dssp             CCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGGGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEE
T ss_pred             CcCCcccCcCCHHHhcCCCCCEEECCCCceeeecCcccccCCCCEEECcCCcccCcCChHHhcCcCCCEEECcCCccccc
Confidence            9998876            56789999998877776333338999999999998877765   67889999999999887


Q ss_pred             cCchhhccCCccccCceEecCCCc-ccc
Q 040876          316 ISHFWCYRSNETKRLRALSLGDNY-LQG  342 (343)
Q Consensus       316 ~~~~l~~~l~~l~~L~~L~ls~N~-l~g  342 (343)
                      +|.    . ..+++|+.+++++|+ +.|
T Consensus       284 ip~----~-~~l~~L~~l~l~~N~~lc~  306 (313)
T 1ogq_A          284 IPQ----G-GNLQRFDVSAYANNKCLCG  306 (313)
T ss_dssp             CCC----S-TTGGGSCGGGTCSSSEEES
T ss_pred             CCC----C-ccccccChHHhcCCCCccC
Confidence            662    2 678889999999987 554



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 343
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-17
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-09
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 78.6 bits (192), Expect = 4e-17
 Identities = 71/326 (21%), Positives = 110/326 (33%), Gaps = 45/326 (13%)

Query: 31  CLESEREALLRFKQDLQDPSNRLASWNIGGDCC--TWAGIVCDN--VTGHIIELNLRNPF 86
           C   +++ALL+ K+DL +P+  L+SW    DCC  TW G++CD    T  +  L+L    
Sbjct: 3   CNPQDKQALLQIKKDLGNPTT-LSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSG-- 59

Query: 87  TYYRRSRYKANPRSMLVGKGPIPSWLYRLTHLEQLSVADRPSLASREDQDLLSNIRQRLS 146
                          L    PIPS L  L +L  L +    +L                 
Sbjct: 60  -------------LNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPA------IAKL 100

Query: 147 KCRTGAKSSQEISDIFDIFSGCVSKGLEILVLRSSSISGHLTEQIGHFKNLDTLDLGNNS 206
                   +               K L  L    +++SG L   I    NL  +    N 
Sbjct: 101 TQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNR 160

Query: 207 IVGLVPLSLNELSKLRI-LHLSDNKLNGTLSEIHFVNLTKLSVFSVNENNLTLKF----- 260
           I G +P S    SKL   + +S N+L G +              S N             
Sbjct: 161 ISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSD 220

Query: 261 -----LDLGENQIHGEMTNLTNATQLWYLRLHSNNFSG--PLSLIS-SNLVYLDLFNNSF 312
                + L +N +  ++  +  +  L  L L +N   G  P  L     L  L++  N+ 
Sbjct: 221 KNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNL 280

Query: 313 LGSISHFWCYRSNETKRLRALSLGDN 338
            G I           +R    +  +N
Sbjct: 281 CGEIPQGG-----NLQRFDVSAYANN 301


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query343
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.85
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.84
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.82
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.81
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.81
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.81
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.75
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.73
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.66
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.64
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.64
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.6
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.58
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.55
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.4
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.37
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.37
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.35
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.33
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.32
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.17
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.13
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.54
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.1
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.91
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.71
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.32
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.23
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=8.2e-41  Score=302.13  Aligned_cols=257  Identities=26%  Similarity=0.449  Sum_probs=164.6

Q ss_pred             CCcHHHHHHHHHhhhhCCCCCCCCCCCCCCCCCc--cccceEeCCCC--CcEEEEecCCCccccccccceeCCCCCCCCC
Q 040876           30 GCLESEREALLRFKQDLQDPSNRLASWNIGGDCC--TWAGIVCDNVT--GHIIELNLRNPFTYYRRSRYKANPRSMLVGK  105 (343)
Q Consensus        30 ~~~~~~~~~L~~~k~~~~~~~~~~~~W~~~~~~c--~w~gv~c~~~~--~~v~~l~l~~~~~~~~~~~g~~~~~~n~~~~  105 (343)
                      -|.++|++||++||+++.+|. .+++|..+.|||  .|.||+|+..+  +||++|||++.     ++.|.+         
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~-----~l~g~~---------   66 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGL-----NLPKPY---------   66 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECC-----CCSSCE---------
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-cCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCC-----CCCCCC---------
Confidence            389999999999999998875 688998889999  49999998644  48999999986     444432         


Q ss_pred             CCCCccccCCCCCCEecCCC-CCCCCCCcccccchhhcccccccCCCccccCcccchhhhhhcCCCCCccEEEeecCccc
Q 040876          106 GPIPSWLYRLTHLEQLSVAD-RPSLASREDQDLLSNIRQRLSKCRTGAKSSQEISDIFDIFSGCVSKGLEILVLRSSSIS  184 (343)
Q Consensus       106 ~~ip~~l~~l~~L~~L~Ls~-n~~l~~L~~L~l~~nl~~~l~~~~~~~~~~~~~~~ip~~l~~l~~~~L~~L~L~~n~l~  184 (343)
                       ++|+.++++++|++|+|++ |.             +.                |.+|+.++++  ++|++|++++|++.
T Consensus        67 -~lp~~l~~L~~L~~L~Ls~~N~-------------l~----------------g~iP~~i~~L--~~L~~L~Ls~N~l~  114 (313)
T d1ogqa_          67 -PIPSSLANLPYLNFLYIGGINN-------------LV----------------GPIPPAIAKL--TQLHYLYITHTNVS  114 (313)
T ss_dssp             -ECCGGGGGCTTCSEEEEEEETT-------------EE----------------SCCCGGGGGC--TTCSEEEEEEECCE
T ss_pred             -CCChHHhcCccccccccccccc-------------cc----------------cccccccccc--cccchhhhcccccc
Confidence             2899999999999999986 44             22                3555555555  55566666655555


Q ss_pred             cccchhccCCCCCCEEECcCCcccccCCccccCCCCCcEEEccCccCccccChHhhhcCCCC-CeEEecCceee------
Q 040876          185 GHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLSDNKLNGTLSEIHFVNLTKL-SVFSVNENNLT------  257 (343)
Q Consensus       185 ~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~l~~N~l~g~~p~~~~~~l~~L-~~L~l~~n~l~------  257 (343)
                      +..+..+..+..|+++++++|.+.+.+|..+++++.++++++++|.++|.+|. .+..+..+ +.++++.|+++      
T Consensus       115 ~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~-~~~~l~~l~~~l~~~~n~l~~~~~~~  193 (313)
T d1ogqa_         115 GAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPD-SYGSFSKLFTSMTISRNRLTGKIPPT  193 (313)
T ss_dssp             EECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCG-GGGCCCTTCCEEECCSSEEEEECCGG
T ss_pred             ccccccccchhhhcccccccccccccCchhhccCcccceeecccccccccccc-cccccccccccccccccccccccccc
Confidence            55555555555555555555555555555555555555555555555555555 44444443 45555555543      


Q ss_pred             -----------------------------EeEEeccCCcccccCCCcccccCCCeEeCcCCcccCccccc---CCCCcEE
Q 040876          258 -----------------------------LKFLDLGENQIHGEMTNLTNATQLWYLRLHSNNFSGPLSLI---SSNLVYL  305 (343)
Q Consensus       258 -----------------------------l~~L~ls~n~l~~~~~~~~~~~~L~~L~Ls~N~l~~~~~~~---~~~L~~L  305 (343)
                                                   ++.+++++|.+.+.++......+|++|+|++|+++|.+|..   +++|++|
T Consensus       194 ~~~l~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L  273 (313)
T d1ogqa_         194 FANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSL  273 (313)
T ss_dssp             GGGCCCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGGGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEE
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccccccccccccCccCeecccCChHHhCCCCCCEE
Confidence                                         23355555555555443222225666666666666555543   4556666


Q ss_pred             EccCCccccccCchhhccCCccccCceEecCCCc
Q 040876          306 DLFNNSFLGSISHFWCYRSNETKRLRALSLGDNY  339 (343)
Q Consensus       306 ~Ls~N~l~~~~~~~l~~~l~~l~~L~~L~ls~N~  339 (343)
                      +|++|+++|.+|     .++++++|+.+++++|+
T Consensus       274 ~Ls~N~l~g~iP-----~~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         274 NVSFNNLCGEIP-----QGGNLQRFDVSAYANNK  302 (313)
T ss_dssp             ECCSSEEEEECC-----CSTTGGGSCGGGTCSSS
T ss_pred             ECcCCcccccCC-----CcccCCCCCHHHhCCCc
Confidence            666666665544     12455556666666664



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure