Citrus Sinensis ID: 040922

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-----

YLVVTVCRLPLSGFISIDCGIPENASYSDKITGINYVSDATYVDTGVSHSISSGYNNEAVERQFLNLRSFPEGIRNCYTLRPANGDVKFLIRASFMYGNYDGQDMPPSFDLMLGADVWDSVQLQDSDGIITKEIIHMPNKGYIHVCLVHTYSGTPFISALELRPITNSIYATQSGSLSRYFRWDVGSTTNETFRYPDDVYDRIWSPNSFYYWAPISTSSNVDSTGTINFNLPSTVMQTAAIPANGVTSLEFHWVPVNRTFKYYVYMHFSEVGSDLAKNQTREMYIYFNGEKWHGPLSPSHLETVTVYTTSAMTNYSRYDIEIRATDKSSLPPILNALEVYQVKEFPQLLTHQQDVDAITNIKSKYEVKRDWQGDPCTPKVHLWQGLNCSYDDNQPPRIISLNLSSSGISGEIDPYIFSLTSIESLDLSNNSLTGLVPDFLAELESLTVLNLSGNNLQGSLPAGLVEKANNRSLSLSVERNPNFCLSDSCKKKNNRFIVPVLASVVTFSVFLAALVILQHLRRRKQ

cEEEEEEEcccccEEEEEEccccccccccccccEEEEccccccccccEEEcccccccHHHHHccEEEEEccccccccEEEcccccccEEEEEEEEEcccccccccccEEEEEEccEEEEEEEEccccccEEEEEEEEcccccEEEEEEEEccccEEEEEEEcEEccccccccccccccEEEEEEcccccccccccccccccccEEccccccccccccccEEcccccccccccHHHHHHHccccccccEEEEEEccccccccEEEEEEccccccccccccccEEEEEEccccccccccccccEEEEEEEEcccccccEEEEEEEcccccccccccHHHHHcHHccccccccccccHHHHHHHcccccccccccccccccccccccEEEEcccccccccEEEccccccccEEEccccccccccccEEEccccccccccccHHHccccccEEEccccccccccccHHHccccccEEEEEccccccccccccccccccEEEEEEEHHHHHHHHHHHHHHHHHHHHcccc

cEEEEEEEcccccEEEEEccccccccccccccccEEEcccHHccccccccccHHHccccHcccccEEcccccccccEEEEEccccccEEEEEEEEEEcccccccccccEEEEEccccEEEEEEccccccEEEEEEEEcccccEEEEEEEccccccEEEEEEEccccccccccccccHHHHEEcccccccccEEEccccccccEEEccccccccEEEcccEEcccccccccccHHHHHHccccccccccEEEEEccccccccEEEEEEHHHHHHHcccccEEEEEEEEcccccccccccccccccEEEcccccccccEEEEEEEEccccccccEEEEEEEEEEEEcccccccHHHHHHHHHHHHHcccccccccccccccccccccEEEccccccccEEEEEEEccccccccccHHHHHHHHHHHEcccccccccccHHHHHcccccEEEEcccccccccccHHHHHHcccccEEEEEccccccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHccc

YLVVTVcrlplsgfisidcgipenasysdkitginyvsdatyvdtgvshsissgynneAVERQFLNlrsfpegirncytlrpangdVKFLIRASFmygnydgqdmppsfdlmlgadvwdsvqlqdsdgiitKEIIHMPNKGYIHVCLVHtysgtpfisalelrpitnsiyatqsgslsryfrwdvgsttnetfrypddvydriwspnsfyywapistssnvdstgtinfnlpstvmqtaaipangvtslefhwvpvnrTFKYYVYMHFSEVGSDLAKNQTREMYIYFNgekwhgplspshleTVTVYTTSamtnysrydieiratdksslppilNALEvyqvkefpqllthqqdVDAITNIkskyevkrdwqgdpctpkvhlwqglncsyddnqppriislnlsssgisgeidpyiFSLTSiesldlsnnsltglvpDFLAELESLTVLNlsgnnlqgslpaglvekannrslslsvernpnfclsdsckkknnrfivPVLASVVTFSVFLAALVILQHLRRRKQ

YLVVTvcrlplsgfiSIDCGIPENASYSDKITGINYVSDATYVDTGVSHSISSGYNNEAVERQFLNLRSFPEGIRNCYTLRPANGDVKFLIRASFMYGNYDGQDMPPSFDLMLGADVWDSVQLQDSDGIITKEIIHMPNKGYIHVCLVHTYSGTPFISALELRPITNSIYatqsgslsryfrWDVGsttnetfrypddvyDRIWSPNSFYYWAPISTSSNVDSTGTINFNLPSTVMQTAAIPANGVTSLEFHWVPVNRTFKYYVYMHFSEVGSDLAKNQTREMYIYFNGEKWHGPLSPSHLETVTVYTTSAMTNYSRYDIEIRATDKSSLPPILNALEVYQVKEFpqllthqqdvdAITNIKSKYEVKRDWQGDPCTPKVHLWQGLNCSYDDNQPPRIISLNLSSSGISGEIDPYIFSLTSIESLDLSNNSLTGLVPDFLAELESLTVLNLSGNNLQGSLPAGLVEKANNRSLSLSVERNPNFCLSDSCKKKNNRFIVPVLASVVTFSVFLAALVILQHLRRRKQ

YLVVTVCRLPLSGFISIDCGIPENASYSDKITGINYVSDATYVDTGVSHSISSGYNNEAVERQFLNLRSFPEGIRNCYTLRPANGDVKFLIRASFMYGNYDGQDMPPSFDLMLGADVWDSVQLQDSDGIITKEIIHMPNKGYIHVCLVHTYSGTPFISALELRPITNSIYATQSGSLSRYFRWDVGSTTNETFRYPDDVYDRIWSPNSFYYWAPISTSSNVDSTGTINFNLPSTVMQTAAIPANGVTSLEFHWVPVNRTFKYYVYMHFSEVGSDLAKNQTREMYIYFNGEKWHGPLSPSHLETVTVYTTSAMTNYSRYDIEIRATDKSSLPPILNALEVYQVKEFPQLLTHQQDVDAITNIKSKYEVKRDWQGDPCTPKVHLWQGLNCSYDDNQPPRiislnlsssgisgeiDPYIFSLTSIESLDLSNNSLTGLVPDFLAELESLTVlnlsgnnlqgslPAGLVEKANNRSLSLSVERNPNFCLSDSCKKKNNRFIVPVLASVVTFSVFLAALVILQHLRRRKQ

*LVVTVCRLPLSGFISIDCGIPENASYSDKITGINYVSDATYVDTGVSHSISSGYNNEAVERQFLNLRSFPEGIRNCYTLRPANGDVKFLIRASFMYGNYDGQDMPPSFDLMLGADVWDSVQLQDSDGIITKEIIHMPNKGYIHVCLVHTYSGTPFISALELRPITNSIYATQSGSLSRYFRWDVGSTTNETFRYPDDVYDRIWSPNSFYYWAPISTSSNVDSTGTINFNLPSTVMQTAAIPANGVTSLEFHWVPVNRTFKYYVYMHFSEVGSDLAKNQTREMYIYFNGEKWHGPLSPSHLETVTVYTTSAMTNYSRYDIEIRATDKSSLPPILNALEVYQVKEFPQLLTHQQDVDAITNIKSKYEVKRDWQGDPCTPKVHLWQGLNCSYDDNQPPRIISLNLSSSGISGEIDPYIFSLTSIESLDLSNNSLTGLVPDFLAELESLTVLNLSGNNLQGSLPAGL***************NPNFCLSDSCKKKNNRFIVPVLASVVTFSVFLAALVILQHL*****

YLVVT**RLPLSGFISIDCGIPENASYSDKITGINYVSDATYVDTGVSHSISSG*N*EAVERQFLNLRSFPEGIRNCYTLRPANGDVKFLIRASFMYGNYDGQDMPPSFDLMLGADVWDSVQLQDSDGIITKEIIHMPNKGYIHVCLVHTYSGTPFISALELRPITNSIYATQSGSLSRYFRWDVGSTTNETFRYPDDVYDRIWSPNSFYYWAPISTSSNVDSTGTINFNLPSTVMQTAAIPANGVTSLEFHWVPVNRTFKYYVYMHFSEVGSDLAKNQTREMYIYFNGEKWHGPLSPSHLETVTVYTTSAMTNYSRYDIEIRATDKSSLPPILNALEVYQVKEFPQLLTHQQDVDAITNIKSKYEVKRDWQGDPCTPKVHLWQGLNCSYDDNQPPRIISLNLSSSGISGEIDPYIFSLTSIESLDLSNNSLTGLVPDFLAELESLTVLNLSGNNLQGSLPAGLVEKANNRSLSLSVE*********************VLASVVTFSVFLAALVILQHLRRRK*

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		525	2.2.26 [Sep-21-2011]
O65924		881	Putative leucine-rich rep	no	no	0.975	0.581	0.465	1e-133
O64556		877	Putative leucine-rich rep	no	no	0.994	0.595	0.472	1e-132
C0LGD6		852	Probable LRR receptor-lik	no	no	0.980	0.604	0.467	1e-127
O64483		876	Senescence-induced recept	no	no	0.977	0.585	0.440	1e-114
C0LGD9		871	Probable LRR receptor-lik	no	no	0.965	0.582	0.424	1e-109
Q9FN93		887	Probable LRR receptor-lik	no	no	0.944	0.559	0.423	1e-108
O81069		884	Probable leucine-rich rep	no	no	0.982	0.583	0.407	1e-106
C0LGG3		885	Probable LRR receptor-lik	no	no	0.952	0.564	0.417	1e-106
C0LGG6		876	Probable LRR receptor-lik	no	no	0.948	0.568	0.419	1e-104
C0LGR6		913	Probable LRR receptor-lik	no	no	0.923	0.531	0.434	1e-103

>sp\|O65924\|Y2921_ARATH Putative leucine-rich repeat receptor-like protein kinase At2g19210 OS=Arabidopsis thaliana GN=At2g19210 PE=3 SV=1	Back alignment and function desciption

 Score =  475 bits (1222), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 243/522 (46%), Positives = 338/522 (64%), Gaps = 10/522 (1%)

Query: 12  SGFISIDCGIPENASYSDKITGINYVSDATYVDTGVSHSISSGYNNEAVERQFLNLRSFP 71
           SGF+SIDCGIPE++SY+D+ T I YVSDA +V++G  HSI   +   ++E+QF N+RSFP
Sbjct: 29  SGFVSIDCGIPEDSSYNDETTDIKYVSDAAFVESGTIHSIDPEFQTSSLEKQFQNVRSFP 88

Query: 72  EGIRNCYTLRPANGD-VKFLIRASFMYGNYDGQDMPPSFDLMLGADVWDSVQLQDSDGII 130
           EG RNCY ++P  G   K+LIR  FMYGNYD     P FDL LG ++WDSV + ++  I+
Sbjct: 89  EGNRNCYDVKPPQGKGFKYLIRTRFMYGNYDNLGKAPDFDLYLGFNIWDSVTIDNATTIV 148

Query: 131 TKEIIHMPNKGYIHVCLVHTYSGTPFISALELRPITNSIYATQSGSLSRYFRWDVGSTTN 190
           TKEIIH     ++HVCLV    GTPF+SALE+R + ++ Y T   SL  + RWD+G    
Sbjct: 149 TKEIIHTLRSDHVHVCLVDKNRGTPFLSALEIRLLKSNTYETPYDSLILFKRWDLGGLGA 208

Query: 191 ETFRYPDDVYDRIWSPNSFYYWAPISTSSNVDSTGTINFNLPSTVMQTAAIPANGVTSLE 250
              RY DDV+DRIW P  F  +   + S  +DS     F     VM TA  P +    + 
Sbjct: 209 LPVRYKDDVFDRIWIPLRFPKYTIFNASLTIDSNNNEGFQPARFVMNTATSPEDLSQDII 268

Query: 251 FHWVPVNRTFKYYVYMHFSEVGSDLAKNQTREMYIYFNGEKWH-GPLSPSHLETVTVYTT 309
           F W P + T+KY+VYMHF+EV  +L  N+TRE  +  N ++ +    SP +L T T++  
Sbjct: 269 FSWEPKDPTWKYFVYMHFAEV-VELPSNETREFKVLLNEKEINMSSFSPRYLYTDTLFVQ 327

Query: 310 SAMTNYSRYDIEIRATDKSSLPPILNALEVYQVKEFPQLLTHQQDVDAITNIKSKYEVKR 369
           + ++   + +  ++ T +S+LPPI+NA+E Y+V EF Q  T QQDVDAI  IKSKY VK+
Sbjct: 328 NPVSG-PKLEFRLQQTPRSTLPPIINAIETYRVNEFLQSPTDQQDVDAIMRIKSKYGVKK 386

Query: 370 DWQGDPCTPKVHLWQGLNCSYDDNQPPRIISLNLSSSGISGEIDPYIFSLTSIESLDLSN 429
            W GDPC P  + W+ +NCSY DN+ PRIIS+NLSSSG++GEID    +LT +  LDLSN
Sbjct: 387 SWLGDPCAPVKYPWKDINCSYVDNESPRIISVNLSSSGLTGEIDAAFSNLTLLHILDLSN 446

Query: 430 NSLTGLVPDFLAELESLTVLNLSGNNLQGSLPAGLVEKANNRSLSLSVERNPNFCLSDSC 489
           NSLTG +PDFL  L +LT LNL GN L G++P  L+E++N + + L ++ NP+ C+S SC
Sbjct: 447 NSLTGKIPDFLGNLHNLTELNLEGNKLSGAIPVKLLERSNKKLILLRIDGNPDLCVSASC 506

Query: 490 -----KKKNNRFIVPVLASVV-TFSVFLAALVILQHLRRRKQ 525
                K K N +I+P++ASVV    + LA  + L + +R ++
Sbjct: 507 QISDEKTKKNVYIIPLVASVVGVLGLVLAIALFLLYKKRHRR 548

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1

>sp\|O64556\|Y2923_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g19230 OS=Arabidopsis thaliana GN=At2g19230 PE=2 SV=3	Back alignment and function description

>sp\|C0LGD6\|Y1570_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g05700 OS=Arabidopsis thaliana GN=At1g05700 PE=2 SV=1	Back alignment and function description

>sp\|O64483\|SIRK_ARATH Senescence-induced receptor-like serine/threonine-protein kinase OS=Arabidopsis thaliana GN=SIRK PE=2 SV=1	Back alignment and function description

>sp\|C0LGD9\|Y1756_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g07560 OS=Arabidopsis thaliana GN=At1g07560 PE=2 SV=1	Back alignment and function description

>sp\|Q9FN93\|Y5596_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g59680 OS=Arabidopsis thaliana GN=At5g59680 PE=2 SV=1	Back alignment and function description

>sp\|O81069\|Y2899_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g28990 OS=Arabidopsis thaliana GN=At2g28990 PE=2 SV=1	Back alignment and function description

>sp\|C0LGG3\|Y5182_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51820 OS=Arabidopsis thaliana GN=At1g51820 PE=2 SV=1	Back alignment and function description

>sp\|C0LGG6\|Y5189_ARATH Probable LRR receptor-like protein kinase At1g51890 OS=Arabidopsis thaliana GN=At1g51890 PE=2 SV=2	Back alignment and function description

>sp\|C0LGR6\|Y4291_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g29180 OS=Arabidopsis thaliana GN=At4g29180 PE=2 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		525
255549714		915	BRASSINOSTEROID INSENSITIVE 1-associated	0.984	0.565	0.533	1e-153
255549710		728	serine/threonine-specific receptor prote	0.986	0.711	0.500	1e-141
356522218		890	PREDICTED: putative leucine-rich repeat	0.984	0.580	0.487	1e-141
255549706		886	BRASSINOSTEROID INSENSITIVE 1-associated	0.992	0.588	0.488	1e-140
1321686		876	light repressible receptor protein kinas	0.975	0.584	0.500	1e-138
15233796		876	Leucine-rich repeat transmembrane protei	0.975	0.584	0.499	1e-137
255549700		884	BRASSINOSTEROID INSENSITIVE 1-associated	0.965	0.573	0.497	1e-135
357513567		741	Mitogen-activated protein kinase HOG1 [M	0.961	0.681	0.493	1e-135
358248460		898	putative leucine-rich repeat receptor-li	0.984	0.575	0.485	1e-135
255549716		892	Nodulation receptor kinase precursor, pu	0.969	0.570	0.495	1e-135

>gi\|255549714\|ref\|XP_002515908.1\| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, putative [Ricinus communis] gi\|223544813\|gb\|EEF46328.1\| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  547 bits (1409), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 282/529 (53%), Positives = 368/529 (69%), Gaps = 12/529 (2%)

Query: 2   LVVTVCRLPLSGFISIDCGIPENASYSDKITGINYVSDATYVDTGVSHSISSGYNNEAVE 61
           L+  V     SGFISIDCGI ENA+Y+D  T I+YVSDA ++DTG S SI++ Y    + 
Sbjct: 46  LLAVVQAQAQSGFISIDCGISENATYTDSTTSIDYVSDAAFIDTGKSKSIAAEYTRYNIN 105

Query: 62  RQFLNLRSFPEGIRNCYTLRPANGDVKFLIRASFMYGNYDGQDMPPSFDLMLGADVWDSV 121
           +Q  N+RSF EG+RNCY +    G  K+LIRA F+YGNYDGQ+  P FDL LG+  W++V
Sbjct: 106 QQLQNVRSFAEGVRNCYKIGLKKG-AKYLIRAEFLYGNYDGQNKAPIFDLYLGSSKWETV 164

Query: 122 QLQDSDGIITKEIIHMPNKGYIHVCLVHTYSGTPFISALELRPITNSIYATQSGSLSRYF 181
              +S  IITKEIIH+ N  YI VCLV+T SGTPF+S LELRPI  S Y+T  GSL+R+ 
Sbjct: 165 DTINSTMIITKEIIHLINTSYIDVCLVNTGSGTPFMSKLELRPIRISAYSTSLGSLARFS 224

Query: 182 RWDVGSTTNETFRYPDDVYDRIWSPNSFYYWAPISTSSNVDSTGTINFNLPSTVMQTAAI 241
           R DVGSTTN T RY DDVYDRIW+PN F+ WA ISTS  +D+    ++  PS VM+TA I
Sbjct: 225 RSDVGSTTNRTLRYADDVYDRIWTPNHFFKWAEISTSETIDALAQNDYRPPSIVMRTAGI 284

Query: 242 PANG----VTSLEFHWVPVNRTFKYYVYMHFSEVGSDLAKNQTREMYIYFNGEKWHGPLS 297
           PAN       S++F     + TF++ VYMHF+E+   L  N++R+  I  NGE W GPL 
Sbjct: 285 PANDNEPMTVSIDFE----DTTFRFLVYMHFAEI-LKLEANESRQFNISLNGEHWFGPLR 339

Query: 298 PSHLETVTVYTTSAMTNYSRYDIEIRATDKSSLPPILNALEVYQVKEFPQLLTHQQDVDA 357
           P +L T TV++ + ++   +Y+  I  T+ S+LPP+LNA+E+Y + +  Q  ++Q+DVDA
Sbjct: 340 PDYLYTTTVFSPTVLSG-GQYEFSIYKTENSTLPPLLNAIEIYYILDLSQPQSNQEDVDA 398

Query: 358 ITNIKSKYEVKRDWQGDPCTPKVHLWQGLNCSYDDNQPPRIISLNLSSSGISGEIDPYIF 417
           ITNIKS Y +KR+WQGDPC P+ +LW+GLNCSY  N  PRIISLNLSSSG++GEI   I 
Sbjct: 399 ITNIKSSYGIKRNWQGDPCAPQAYLWEGLNCSYSGNVMPRIISLNLSSSGLTGEIPSSIS 458

Query: 418 SLTSIESLDLSNNSLTGLVPDFLAELESLTVLNLSGNNLQGSLPAGLVEKANNRSLSLSV 477
           SLTS+ESLDLSNN LTG VPDFL++L SL VL L+GN L GS+P  LVEK+    L LSV
Sbjct: 459 SLTSLESLDLSNNYLTGSVPDFLSQLPSLNVLILTGNRLSGSVPPSLVEKSEQNLLVLSV 518

Query: 478 ERNPNFCLSDSCK-KKNNRFIVPVLASVVTFSVFLAALVILQHLRRRKQ 525
             N N CL  SCK +K N  +VPV+AS+    + ++AL  + + R+R++
Sbjct: 519 GGNANLCLKSSCKNEKKNNVVVPVVASIAGVLIIISALAAILYTRKRRK 567

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255549710\|ref\|XP_002515906.1\| serine/threonine-specific receptor protein kinase, putative [Ricinus communis] gi\|223544811\|gb\|EEF46326.1\| serine/threonine-specific receptor protein kinase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|356522218\|ref\|XP_003529744.1\| PREDICTED: putative leucine-rich repeat receptor-like protein kinase At2g19210-like [Glycine max]	Back alignment and taxonomy information

>gi\|255549706\|ref\|XP_002515904.1\| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, putative [Ricinus communis] gi\|223544809\|gb\|EEF46324.1\| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|1321686\|emb\|CAA66376.1\| light repressible receptor protein kinase [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi|15233796|ref|NP_194728.1| Leucine-rich repeat transmembrane protein kinase protein [Arabidopsis thaliana] gi|4938475|emb|CAB43834.1| serine/threonine-specific receptor protein kinase LRRPK [Arabidopsis thaliana] gi|7269899|emb|CAB80992.1| serine/threonine-specific receptor protein kinase LRRPK [Arabidopsis thaliana] gi|332660305|gb|AEE85705.1| Leucine-rich repeat transmembrane protein kinase protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|255549700\|ref\|XP_002515901.1\| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, putative [Ricinus communis] gi\|223544806\|gb\|EEF46321.1\| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|357513567\|ref\|XP_003627072.1\| Mitogen-activated protein kinase HOG1 [Medicago truncatula] gi\|355521094\|gb\|AET01548.1\| Mitogen-activated protein kinase HOG1 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|358248460\|ref\|NP_001240141.1\| putative leucine-rich repeat receptor-like protein kinase At2g19210-like precursor [Glycine max] gi\|223452414\|gb\|ACM89534.1\| stress-induced receptor-like kinase [Glycine max]	Back alignment and taxonomy information

>gi\|255549716\|ref\|XP_002515909.1\| Nodulation receptor kinase precursor, putative [Ricinus communis] gi\|223544814\|gb\|EEF46329.1\| Nodulation receptor kinase precursor, putative [Ricinus communis]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		525
TAIR\|locus:2126540		876	AT4G29990 [Arabidopsis thalian	0.975	0.584	0.464	2.6e-118
TAIR\|locus:2047675		881	AT2G19210 [Arabidopsis thalian	0.973	0.580	0.434	1.1e-112
TAIR\|locus:2017557		894	IOS1 "IMPAIRED OOMYCETE SUSCEP	0.961	0.564	0.423	1.7e-107
TAIR\|locus:2017572		882	AT1G51790 [Arabidopsis thalian	0.971	0.578	0.410	2.6e-102
TAIR\|locus:2059093		876	FRK1 "FLG22-induced receptor-l	0.973	0.583	0.421	1.3e-100
TAIR\|locus:2066158		884	AT2G28990 [Arabidopsis thalian	0.979	0.581	0.375	1.1e-92
TAIR\|locus:2078176		878	MEE39 "maternal effect embryo	0.956	0.571	0.400	1.7e-91
TAIR\|locus:2195855		876	AT1G51910 [Arabidopsis thalian	0.958	0.574	0.387	4.5e-91
TAIR\|locus:2195825		865	AT1G51850 [Arabidopsis thalian	0.721	0.438	0.380	6.2e-91
TAIR\|locus:2017647		885	AT1G51820 [Arabidopsis thalian	0.952	0.564	0.385	1.5e-90

TAIR\|locus:2126540 AT4G29990 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1165 (415.2 bits), Expect = 2.6e-118, P = 2.6e-118
 Identities = 241/519 (46%), Positives = 315/519 (60%)

Query:    12 SGFISIDCGIPENASYSDKITGINYVSDATYVDTGVSHSISSGYNNEAVERQFLNLRSFP 71
             SGFISIDCGIP+++SY+D+ T + YVSD  +V++G SHSI S     ++ERQF N+RSFP
Sbjct:    25 SGFISIDCGIPDDSSYTDEKTNMKYVSDLGFVESGTSHSIVSDLQTTSLERQFQNVRSFP 84

Query:    72 EGIRNCYTLRPANGD-VKFLIRASFMYGNYDGQDMPPSFDLMLGADVWDSVQLQDSDGII 130
             EG RNCY +RP  G   K+LIR  FMYGNYDG    P FDL +GA++W+SV L +   I+
Sbjct:    85 EGKRNCYDIRPQQGKGFKYLIRTRFMYGNYDGFSKTPEFDLYIGANLWESVVLINETAIM 144

Query:   131 TKEIIHMPNKGYIHVCLVHTYSGTPFISALELRPITNSIYATQSGSLSRYFRWDVGSTTN 190
             TKEII+ P   +IHVCLV    GTPF+S LE+R + N  Y T   +L    RWD G+ TN
Sbjct:   145 TKEIIYTPPSDHIHVCLVDKNRGTPFLSVLEIRFLKNDTYDTPYEALMLGRRWDFGTATN 204

Query:   191 ETFRYPDDVYDRIWSPNSFYYWAPISTSSNVDSTGTINFNLPSTVMQTAAIPANGVTSLE 250
                RY DD YDRIW P    Y   ++TS  +D T    F   S VM++A  P N    L+
Sbjct:   205 LQIRYKDDFYDRIWMPYKSPYQKTLNTSLTIDETNHNGFRPASIVMRSAIAPGNESNPLK 264

Query:   251 FHWVPVNRTFKYYVYMHFSEVGSDLAKNQTREMYIYFNGEKWHGPLSPSHLETVTVYTTS 310
             F+W P +   K+Y+YMHF+EV  +L +N+TRE  IY N         P +L T T  T  
Sbjct:   265 FNWAPDDPRSKFYIYMHFAEV-RELQRNETREFDIYINDVILAENFRPFYLFTDTRSTVD 323

Query:   311 AMTNYSRYDIEIRATDKSSLPPILNALEVYQVKEFPQLLTHQQDVDAITNIKSKYEVKRD 370
              +      +I ++ T  S+LPPI+NA+E+YQ+ EF QL T QQDVDA+T IK KY VK++
Sbjct:   324 PVGRKMN-EIVLQRTGVSTLPPIINAIEIYQINEFLQLPTDQQDVDAMTKIKFKYRVKKN 382

Query:   371 WQGDPCTPKVHLWQGLNCSYDDNQP-PRXXXXXXXXXXXXXXXDPYIFSLTSIESLDLSN 429
             WQGDPC P  + W+GL C + DN   P+               DP   +LTSI  LDLSN
Sbjct:   383 WQGDPCVPVDNSWEGLECLHSDNNTSPKSIALNLSSSGLTGQIDPAFANLTSINKLDLSN 442

Query:   430 NSLTGLVPDFLAELESLTVXXXXXXXXXXXXPAGLVEKANNRSLSLSVERNPNFCLSDSC 489
             NSLTG VPDFLA L +LT             PA L+EK+ + SLSL    NP+ C S SC
Sbjct:   443 NSLTGKVPDFLASLPNLTELNLEGNKLTGSIPAKLLEKSKDGSLSLRFGGNPDLCQSPSC 502

Query:   490 K---KKNNRFIVPVLASVVTFSVFLAALVILQHLRRRKQ 525
             +   KK   +IVPV+AS+    + L AL ++ H ++R +
Sbjct:   503 QTTTKKKIGYIVPVVASLAGLLIVLTALALIWHFKKRSR 541

GO:0004672 "protein kinase activity" evidence=IEA;ISS

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA;ISS

GO:0005886 "plasma membrane" evidence=ISM

GO:0006468 "protein phosphorylation" evidence=IEA;ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

TAIR\|locus:2047675 AT2G19210 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2017557 IOS1 "IMPAIRED OOMYCETE SUSCEPTIBILITY 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2017572 AT1G51790 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2059093 FRK1 "FLG22-induced receptor-like kinase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2066158 AT2G28990 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2078176 MEE39 "maternal effect embryo arrest 39" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2195855 AT1G51910 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2195825 AT1G51850 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2017647 AT1G51820 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		525
pfam12819		335	pfam12819, Malectin_like, Carbohydrate-binding pro	1e-122
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	2e-34
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	8e-14
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	3e-10
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	4e-09
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	4e-09
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	6e-09
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	9e-09
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	4e-08
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	2e-07
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	2e-06
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	3e-06
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	9e-06
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	2e-05
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	3e-05
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	5e-05
pfam12799		43	pfam12799, LRR_4, Leucine Rich repeats (2 copies)	6e-05
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	1e-04
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	9e-04
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	9e-04
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	0.001
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	0.003

>gnl\|CDD\|221790 pfam12819, Malectin_like, Carbohydrate-binding protein of the ER	Back alignment and domain information

 Score =  361 bits (928), Expect = e-122
 Identities = 150/340 (44%), Positives = 207/340 (60%), Gaps = 19/340 (5%)

Query: 17  IDCGIPENASYSDKITGINYVSDATYVDTGVSHSISSGYNNEAVERQFLNLRSFPEGIRN 76
           IDCG+P N SY+D  TGI +VSDA ++DTG S +IS   ++  + + +  LRSFP+G RN
Sbjct: 1   IDCGLPSNESYTDPSTGITWVSDAGFIDTGKSGNISKENSSSFLSKPYKTLRSFPDGKRN 60

Query: 77  CYTLRP-ANGDVKFLIRASFMYGNYDGQDM---PPSFDLMLGADVWDSVQLQ--DSDGII 130
           CYTL        K+LIRA+F+YGNYDG +    PPSFDL LG ++W +V L     D ++
Sbjct: 61  CYTLPVTPGKGTKYLIRATFLYGNYDGLNSVSSPPSFDLYLGVNLWTTVNLSNDSGDSVV 120

Query: 131 TKEIIHMPNKGYIHVCLVHTYSGTPFISALELRPITNSIY--ATQSGSLSRYFRWDVGST 188
            + IIH+     + VCLV+T +GTPFISALELRP+ +S+Y  +  S +L    R + G  
Sbjct: 121 KEYIIHVTKSDTLSVCLVNTGTGTPFISALELRPLPDSLYPSSGGSQALKLVARLNFGG- 179

Query: 189 TNETFRYPDDVYDRIWSP-NSFYYWAPISTSSNVDSTGTIN-FNLPSTVMQTAAIPANGV 246
           +  T RYPDDVYDRIW P  S   W+ ISTS +VD +     +  PS V+QTA  P N  
Sbjct: 180 SEGTIRYPDDVYDRIWEPFFSSPGWSQISTSLSVDISSNNAPYIPPSAVLQTAVTPTNAS 239

Query: 247 TSLEFHWVPVNRTFKYYVYMHFSEVGSDLAKNQTREMYIYFNGEKWHGPLSPSHLETVTV 306
             L F W  V+  F+YYVY+HF+E    +   +TRE  IY NG+  +G +SP +L T T 
Sbjct: 240 APLNFTWDLVDPNFEYYVYLHFAE----IQSLETREFDIYINGKTVYGDVSPKYLGTDTG 295

Query: 307 YTTS----AMTNYSRYDIEIRATDKSSLPPILNALEVYQV 342
                    ++     +I +  T  S+LPP+LNALE+++V
Sbjct: 296 ALYLDFPVNVSGGGLLNISLVPTSGSTLPPLLNALEIFKV 335

Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan. The domain is found on a number of plant receptor kinases. Length = 335

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies)	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		525
PLN03150		623	hypothetical protein; Provisional	100.0
PF12819		347	Malectin_like: Carbohydrate-binding protein of the	100.0
PLN03150		623	hypothetical protein; Provisional	99.77
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.21
PF11721		174	Malectin: Di-glucose binding within endoplasmic re	99.02
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	98.88
PF11721		174	Malectin: Di-glucose binding within endoplasmic re	98.87
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	98.78
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.58
KOG0617		264	consensus Ras suppressor protein (contains leucine	98.48
PF12819		347	Malectin_like: Carbohydrate-binding protein of the	98.45
KOG4237		498	consensus Extracellular matrix protein slit, conta	98.34
KOG0472		565	consensus Leucine-rich repeat protein [Function un	98.29
KOG0617		264	consensus Ras suppressor protein (contains leucine	98.17
KOG0472		565	consensus Leucine-rich repeat protein [Function un	98.16
KOG4237		498	consensus Extracellular matrix protein slit, conta	98.14
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.09
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	98.01
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	97.89
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	97.71
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	97.67
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	97.66
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.66
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	97.6
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	97.6
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	97.43
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.42
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	97.35
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.26
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	96.98
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	96.82
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	96.68
PLN03210		1153	Resistant to P. syringae 6; Provisional	96.65
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	96.61
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	96.55
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	96.47
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	96.44
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	96.43
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	96.42
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	96.34
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	96.34
PLN03210		1153	Resistant to P. syringae 6; Provisional	96.29
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	96.17
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	96.13
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	95.83
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	94.88
PF08263		43	LRRNT_2: Leucine rich repeat N-terminal domain; In	94.54
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	94.26
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	94.2
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	93.9
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	93.82
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	93.24
PF08693		40	SKG6: Transmembrane alpha-helix domain; InterPro:	92.24
PF04478		154	Mid2: Mid2 like cell wall stress sensor; InterPro:	92.14
KOG2982		418	consensus Uncharacterized conserved protein [Funct	92.04
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	90.85
KOG0473		326	consensus Leucine-rich repeat protein [Function un	90.82
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	90.26
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	89.89
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	89.57
smart00370		26	LRR Leucine-rich repeats, outliers.	89.57
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	89.22
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	88.82
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	88.54
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	88.4
PF01299		306	Lamp: Lysosome-associated membrane glycoprotein (L	86.31
KOG2982		418	consensus Uncharacterized conserved protein [Funct	86.17
PF15102		146	TMEM154: TMEM154 protein family	84.98
TIGR00864		2740	PCC polycystin cation channel protein. Note: this	82.34
smart00370		26	LRR Leucine-rich repeats, outliers.	82.03
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	82.03
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	81.23
KOG2123		388	consensus Uncharacterized conserved protein [Funct	80.22

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

Probab=100.00  E-value=4.5e-87  Score=736.40  Aligned_cols=494  Identities=24%  Similarity=0.411  Sum_probs=376.8

Q ss_pred             cEEEEeecCCCCcEEEccCCCCCCccccCCCCeeeecCCCcccCCceeeecCCCCCccccccceEeeeeC--CCCCceEE
Q 040922            2 LVVTVCRLPLSGFISIDCGIPENASYSDKITGINYVSDATYVDTGVSHSISSGYNNEAVERQFLNLRSFP--EGIRNCYT   79 (525)
Q Consensus         2 ~~~~~~~~~~~~f~sidCG~~~~~~~~d~~~~~~w~~D~~~~~~g~~~~~~~~~~~~~~~~~y~t~R~Fp--~~~~~cY~   79 (525)
                      ++.+++.+.++++++||||++.+. .+| .+||+|++|..|. .|....++.+   ....++|+|||+||  +|+++||+
T Consensus        13 ~~~~~~~~~~~~~~~I~CGs~~~~-~~d-~~~~~w~~D~~~~-~~~~~~~~~~---~~~~~~~~t~R~F~~~~g~~~cY~   86 (623)
T PLN03150         13 AVLASLASPEPFTMRISCGARVNV-RTA-PTNTLWYKDFAYT-GGIPANATRP---SFIAPPLKTLRYFPLSDGPENCYN   86 (623)
T ss_pred             HhhcccccCCCccEEEeCCCCCCc-ccC-CCCCEEcCCcccc-cCccccccCc---ccccchhhccccCCcccccccceE
Confidence            345567777899999999998642 244 3799999997774 2332222221   12457899999999  57799999


Q ss_pred             ecCcCCCcceEEEEEeecCCCCCCCCCCeeEEEeCceEEEEEEe--ccCCCcEEEEEEEecCCCcEEEEEEeCCCCCcee
Q 040922           80 LRPANGDVKFLIRASFMYGNYDGQDMPPSFDLMLGADVWDSVQL--QDSDGIITKEIIHMPNKGYIHVCLVHTYSGTPFI  157 (525)
Q Consensus        80 ~~v~~g~~~yliR~~F~y~nyd~~~~~p~F~v~~~~~~~~~v~~--~~~~~~~~~E~i~~~~~~~l~vcf~~~~~~~pFI  157 (525)
                      ||++++| +||||+||+|||||+.+..|.|||++|++.|.+|+.  +..+..++||++++++++.++|||+|+++|+|||
T Consensus        87 ~~~~~~g-~ylVRl~F~~~~y~~~~~~~~Fdv~~~~~~~~tv~~~~~~~~~~v~~E~i~~~~~~~l~vcf~~~~~~~pFI  165 (623)
T PLN03150         87 INRVPKG-HYSVRVFFGLVAEPNFDSEPLFDVSVEGTQISSLKSGWSSHDEQVFAEALVFLTDGSASICFHSTGHGDPAI  165 (623)
T ss_pred             eeecCCC-cEEEEEEeecCCcCCCCCCCceEEEECcEEEEEEecCcccCCCcEEEEEEEEecCCcEEEEEecCCCCCCce
Confidence            9998888 999999999999999998899999999999999975  2244568999999999999999999999999999


Q ss_pred             EEEEEEEcCCCccccc-----ccceeeEEeeecCCCCC-CCccCCCCCC--CcccccCCC---CCceeeccceeecCCCC
Q 040922          158 SALELRPITNSIYATQ-----SGSLSRYFRWDVGSTTN-ETFRYPDDVY--DRIWSPNSF---YYWAPISTSSNVDSTGT  226 (525)
Q Consensus       158 n~iEl~~lp~~~y~~~-----~~~l~~~~R~n~G~~~~-~~i~~~~D~~--~R~W~~d~~---~~~~~~~~~~~i~~~~~  226 (525)
                      |+|||||||+++|..+     +.+|+++||+||||++. ..+||++|+|  ||+|.+|..   ..+..+++...|+....
T Consensus       166 s~iEv~~l~~~~y~~~~~~~~~~~L~~~~R~n~G~~~~~~~~d~~~D~~~~dR~W~~d~~~~~~~~~~~st~~~I~~~~~  245 (623)
T PLN03150        166 LSIEILQVDDKAYNFGPSWGQGVILRTAKRLSCGAGKSKFDEDYSGDHWGGDRFWNRMQTFGSGSDQAISTENVIKKASN  245 (623)
T ss_pred             eEEEEEEcCcccccccccccCceEEEEEEEEEecCcccccccCCCCCcccCccccCcCcccCCCcccccccccccccccC
Confidence            9999999999999643     23699999999999653 3589999999  999998854   33556667667775556


Q ss_pred             CCCCChHHHHhhccccCCCCeeeEEEEeecCCCceEEEEEEeecccccCCCCceEEEEEEECCeeeccCcccceee---e
Q 040922          227 INFNLPSTVMQTAAIPANGVTSLEFHWVPVNRTFKYYVYMHFSEVGSDLAKNQTREMYIYFNGEKWHGPLSPSHLE---T  303 (525)
Q Consensus       227 ~~~~~P~~V~~TA~~~~~~~~~~~~~w~~v~~~~~y~v~lhF~Ei~~~~~~~~~R~F~I~in~~~~~~~~~p~~~~---~  303 (525)
                      ++|.+|+.|||||+++.+...++.+.| .++++..|+|||||||+++.....++|+|+|||||+.+.+++++....   .
T Consensus       246 ~~~~~P~~VyqTA~~~~~~~~~lty~~-~v~~~~~Y~VrLhFaEi~~~~~~~~~R~F~V~ing~~~~~~~di~~~~g~~~  324 (623)
T PLN03150        246 APNFYPESLYQSALVSTDTQPDLSYTM-DVDPNRNYSVWLHFAEIDNSITAEGKRVFDVLINGDTAFKDVDIVKMSGERY  324 (623)
T ss_pred             CCccChHHHhhhhccccCCCCceEEEe-ecCCCCCEEEEEEEEeccCccCCCceEEEEEEECCEEeecccChhhhcCCcc
Confidence            789999999999988876443444444 478999999999999998434567899999999999887766653221   1


Q ss_pred             eEEEEeeecc-ccceEEEEEeecCCCCchhHhhhhhhccccccCccccchhhHHHHHHhhhhcccCC--CCCCCCCCCcc
Q 040922          304 VTVYTTSAMT-NYSRYDIEIRATDKSSLPPILNALEVYQVKEFPQLLTHQQDVDAITNIKSKYEVKR--DWQGDPCTPKV  380 (525)
Q Consensus       304 ~~~~~~~~~~-~~~~l~l~l~~t~~s~lpp~ln~leil~~~~~~~~~t~~~d~~al~~l~~~~~~~~--~w~g~pc~p~~  380 (525)
                      ..++.++.+. ..+.+++++.+...+  +|++||+|++++... ...+.+.|+.+|..+|..+....  +|.|+||.|..
T Consensus       325 ~~~~~~~~v~~~~g~l~isl~p~~~s--~pilNaiEI~~~~~~-~~~t~~~~~~aL~~~k~~~~~~~~~~W~g~~C~p~~  401 (623)
T PLN03150        325 TALVLNKTVAVSGRTLTIVLQPKKGT--HAIINAIEVFEIITA-ESKTLLEEVSALQTLKSSLGLPLRFGWNGDPCVPQQ  401 (623)
T ss_pred             cceEEEeEEeecCCeEEEEEeeCCCC--cceeeeeeeeecccc-ccccCchHHHHHHHHHHhcCCcccCCCCCCCCCCcc
Confidence            1233322221 236799999987543  799999999999985 56788999999999998886432  89999999988


Q ss_pred             cccccccCCCCCC-------------------------CCCceEEecCCCCCccCCCchhhccCCCcCEEEcCCCCCCCc
Q 040922          381 HLWQGLNCSYDDN-------------------------QPPRIISLNLSSSGISGEIDPYIFSLTSIESLDLSNNSLTGL  435 (525)
Q Consensus       381 ~~w~gv~c~~~~~-------------------------~~~~L~~L~Ls~n~l~g~ip~~~~~L~~L~~L~Ls~N~l~g~  435 (525)
                      +.|.|+.|.....                         .+++|+.|+|++|+++|.+|..+..|++|+.|+|++|+++|.
T Consensus       402 ~~w~Gv~C~~~~~~~~~~v~~L~L~~n~L~g~ip~~i~~L~~L~~L~Ls~N~l~g~iP~~~~~l~~L~~LdLs~N~lsg~  481 (623)
T PLN03150        402 HPWSGADCQFDSTKGKWFIDGLGLDNQGLRGFIPNDISKLRHLQSINLSGNSIRGNIPPSLGSITSLEVLDLSYNSFNGS  481 (623)
T ss_pred             cccccceeeccCCCCceEEEEEECCCCCccccCCHHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECCCCCCCCC
Confidence            8999999963211                         235677777777777777777777777777777777777777


Q ss_pred             CchhccCCCCCCEEeCCCCcCCCCCChhhhcCCCCcEEEEEecCCCCCCCCC---ccCCCC-ceEEEEEehHHHHH
Q 040922          436 VPDFLAELESLTVLNLSGNNLQGSLPAGLVEKANNRSLSLSVERNPNFCLSD---SCKKKN-NRFIVPVLASVVTF  507 (525)
Q Consensus       436 iP~~l~~l~~L~~L~Ls~N~L~g~iP~~l~~l~~l~~l~L~l~~N~~~C~~~---~c~~~~-~~~~i~v~~~~~~~  507 (525)
                      +|..+++|++|+.|+|++|+|+|.+|..+..+. +....+++.+|+.+|++.   .|..+. ...++.++++++++
T Consensus       482 iP~~l~~L~~L~~L~Ls~N~l~g~iP~~l~~~~-~~~~~l~~~~N~~lc~~p~l~~C~~~~~~~~~i~~~~~~~~~  556 (623)
T PLN03150        482 IPESLGQLTSLRILNLNGNSLSGRVPAALGGRL-LHRASFNFTDNAGLCGIPGLRACGPHLSVGAKIGIAFGVSVA  556 (623)
T ss_pred             CchHHhcCCCCCEEECcCCcccccCChHHhhcc-ccCceEEecCCccccCCCCCCCCcccCCCceEEEEEhHHHHH
Confidence            777777777777777777777777777766532 122345677999999874   575432 22555555554443

>PF12819 Malectin_like: Carbohydrate-binding protein of the ER; InterPro: IPR024788 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan []	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PF11721 Malectin: Di-glucose binding within endoplasmic reticulum; InterPro: IPR021720 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PF11721 Malectin: Di-glucose binding within endoplasmic reticulum; InterPro: IPR021720 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PF12819 Malectin_like: Carbohydrate-binding protein of the ER; InterPro: IPR024788 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan []	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ]	Back alignment and domain information

>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF01299 Lamp: Lysosome-associated membrane glycoprotein (Lamp); InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF15102 TMEM154: TMEM154 protein family	Back alignment and domain information

>TIGR00864 PCC polycystin cation channel protein	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		525
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	3e-17
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	2e-16
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	4e-14
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	5e-14
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-12
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	2e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	6e-17
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	6e-17
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	7e-16
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-15
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-15
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	5e-15
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-14
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-14
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-14
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-14
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-14
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	6e-14
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-13
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-13
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-13
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	6e-13
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-12
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	7e-12
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	5e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-07
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	8e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	8e-15
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-13
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	3e-13
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-13
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-12
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-11
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-11
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-10
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	9e-09
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	9e-08
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-06
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	3e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	8e-04
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-13
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	8e-12
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	6e-11
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-10
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	4e-10
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	8e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-07
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	7e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	4e-05
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	7e-13
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-12
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-12
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-12
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-12
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	7e-12
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-11
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-11
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-10
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-10
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-10
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-10
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-09
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	6e-09
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-08
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-08
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	9e-07
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-04
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-12
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-11
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-10
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-10
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	6e-10
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-07
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	8e-06
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	7e-12
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-11
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-11
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	7e-11
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	9e-11
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	9e-11
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-10
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-10
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-10
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-09
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-09
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	8e-09
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	9e-09
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-08
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-07
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-06
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-11
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	6e-11
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-10
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-10
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-10
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-10
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	5e-10
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	6e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-08
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-08
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-04
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	3e-11
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	3e-10
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-09
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	3e-09
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-08
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	5e-08
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	5e-08
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	6e-08
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	6e-08
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	8e-08
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-07
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	5e-11
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-10
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	9e-10
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-08
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	5e-11
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-09
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	4e-09
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	1e-08
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	1e-08
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-08
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	8e-08
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	5e-07
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	4e-05
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	5e-11
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	2e-09
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-09
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-08
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-08
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-08
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-08
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-07
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	3e-06
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	3e-05
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-10
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-09
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-08
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	6e-08
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	5e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	6e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	9e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-05
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-10
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	6e-10
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-09
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	9e-08
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	7e-07
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-06
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	8e-06
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	9e-05
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-10
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	6e-10
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-08
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-08
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	7e-08
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-07
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-07
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	5e-07
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	5e-07
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-06
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	4e-06
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	4e-05
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	4e-05
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	7e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	7e-04
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	3e-10
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-09
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	1e-07
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-07
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	3e-06
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-05
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-05
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	3e-10
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-09
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-08
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-08
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-07
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-06
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	4e-10
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	6e-10
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	9e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	8e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	9e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-07
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-07
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	4e-07
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	5e-10
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	4e-09
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	2e-08
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	1e-07
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	5e-07
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	4e-05
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	2e-04
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	7e-10
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-08
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	3e-08
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	4e-06
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	4e-06
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	1e-09
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	3e-09
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	5e-09
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-08
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-08
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	4e-08
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-07
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	3e-05
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	5e-05
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	2e-09
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	2e-09
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	3e-09
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-08
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	2e-08
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	7e-08
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-07
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	6e-05
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	2e-09
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	1e-07
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	1e-06
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	9e-06
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	3e-04
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	3e-09
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	1e-08
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	2e-08
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	6e-08
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	5e-07
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	4e-06
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	3e-05
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-09
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	5e-09
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	4e-08
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	4e-08
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	2e-07
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-06
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-06
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	5e-09
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	9e-09
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	4e-08
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	9e-08
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	2e-07
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	5e-07
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	2e-04
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	5e-09
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	2e-06
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	1e-05
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	6e-09
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	5e-07
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	5e-06
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	1e-05
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	6e-09
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	6e-08
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	7e-07
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-06
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-06
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	7e-04
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	6e-09
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	1e-08
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	2e-08
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	2e-08
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	1e-07
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	9e-09
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-08
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-07
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-07
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	4e-07
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-07
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	8e-07
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-06
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-06
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-06
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-06
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	1e-08
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	2e-05
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	2e-08
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	1e-07
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	1e-07
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	8e-06
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	6e-08
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	5e-07
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	9e-08
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	7e-07
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-06
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-06
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-06
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	8e-05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-04
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-04
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-04
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	1e-07
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	9e-07
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	3e-06
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	1e-05
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	7e-05
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	8e-04
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	1e-07
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	3e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	4e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	8e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	9e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	1e-04
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	2e-07
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	9e-07
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	5e-05
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-07
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	5e-07
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	3e-05
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-04
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	2e-07
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-06
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-07
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-06
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-05
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-04
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-04
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	3e-07
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	2e-05
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-07
1o6v_A		466	Internalin A; bacterial infection, extracellular r	9e-07
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-06
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-06
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-06
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-06
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-06
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-06
1o6v_A		466	Internalin A; bacterial infection, extracellular r	5e-05
1o6v_A		466	Internalin A; bacterial infection, extracellular r	8e-05
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	3e-07
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	5e-07
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	3e-06
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	3e-05
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	3e-05
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	4e-04
2jwp_A		174	Malectin, MGC80075; sugar binding, sugar binding p	6e-07
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	6e-07
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	2e-06
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	1e-05
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	2e-05
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	5e-05
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	1e-06
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-06
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	3e-06
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	8e-06
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	2e-06
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	3e-04
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	2e-06
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	1e-05
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	3e-05
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	5e-06
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	7e-06
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	4e-05
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	4e-05
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	8e-05
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	1e-04
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	2e-04
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	7e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	7e-06
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	9e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	9e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-04
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	8e-06
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	1e-05
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	1e-05
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	2e-05
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	2e-05
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	1e-04
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	1e-05
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	1e-05
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	2e-05
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	3e-05
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	1e-04
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	2e-04
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	3e-04
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	5e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	5e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	9e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-04
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	2e-05
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	2e-05
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	2e-04
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	6e-04
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	3e-05
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	3e-04
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	4e-04
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	7e-05
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	2e-04
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	7e-04
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	8e-04
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	7e-05
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	8e-05
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	1e-04
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	5e-04
3e6j_A		229	Variable lymphocyte receptor diversity region; var	1e-04
3e6j_A		229	Variable lymphocyte receptor diversity region; var	4e-04
3e6j_A		229	Variable lymphocyte receptor diversity region; var	6e-04
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	1e-04
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	2e-04
3m19_A		251	Variable lymphocyte receptor A diversity region; a	1e-04
3m19_A		251	Variable lymphocyte receptor A diversity region; a	1e-04
3m19_A		251	Variable lymphocyte receptor A diversity region; a	4e-04
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	2e-04
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	3e-04
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	3e-04
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	4e-04
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	5e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-04
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	6e-04

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

 Score = 81.8 bits (203), Expect = 3e-17
 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 6/86 (6%)

Query: 400 SLNLSSSGISGEIDPYIFSLTSIESLDLSNNSLTGLVPDFLAELESLTVLNLSGNNLQGS 459
            ++L+ + ++ ++   +    ++  LDL NN + G +P  L +L+ L  LN+S NNL G 
Sbjct: 225 KIHLAKNSLAFDL-GKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGE 283

Query: 460 LPAGLVEKANNRSLS-LSVERNPNFC 484
           +P G     N +     +   N   C
Sbjct: 284 IPQGG----NLQRFDVSAYANNKCLC 305

PyMOL of 1ogq

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A* Length = 174	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		525
2jwp_A		174	Malectin, MGC80075; sugar binding, sugar binding p	99.77
2jwp_A		174	Malectin, MGC80075; sugar binding, sugar binding p	99.76
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.35
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.34
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.25
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.24
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.21
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.21
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.2
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.2
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.18
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	99.18
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.16
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.13
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.13
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.11
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.06
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.01
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	98.99
3m19_A		251	Variable lymphocyte receptor A diversity region; a	98.99
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	98.96
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	98.95
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	98.95
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	98.95
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	98.95
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	98.93
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	98.92
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	98.9
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	98.88
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	98.87
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	98.85
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	98.84
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	98.83
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	98.82
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	98.81
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	98.79
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	98.77
3m19_A		251	Variable lymphocyte receptor A diversity region; a	98.76
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	98.74
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	98.74
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	98.74
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	98.74
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	98.72
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	98.72
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	98.71
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	98.71
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.71
3e6j_A		229	Variable lymphocyte receptor diversity region; var	98.71
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.68
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	98.65
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	98.64
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.64
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.64
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	98.61
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	98.6
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	98.58
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	98.58
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	98.57
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	98.56
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	98.56
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.56
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	98.55
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	98.54
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	98.54
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.54
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.53
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	98.53
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.52
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	98.52
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	98.51
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	98.5
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	98.5
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.48
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	98.47
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	98.47
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	98.47
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	98.46
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	98.44
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	98.44
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	98.44
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	98.41
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	98.41
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	98.39
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	98.39
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	98.39
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	98.39
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	98.39
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.38
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	98.38
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	98.37
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	98.37
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.36
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	98.36
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	98.36
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	98.36
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	98.36
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	98.34
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	98.31
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	98.3
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	98.29
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	98.29
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	98.29
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	98.28
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	98.28
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	98.28
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	98.27
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	98.27
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	98.23
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	98.23
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	98.2
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	98.15
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	98.15
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	98.14
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	98.11
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	98.08
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	98.03
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	98.02
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	98.01
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	97.98
1o6v_A		466	Internalin A; bacterial infection, extracellular r	97.95
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	97.95
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	97.94
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	97.94
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	97.94
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	97.93
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	97.91
1o6v_A		466	Internalin A; bacterial infection, extracellular r	97.9
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	97.89
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	97.8
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	97.78
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	97.76
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	97.74
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.73
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	97.72
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	97.71
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	97.7
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	97.5
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	97.48
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	97.42
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	97.4
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	97.14
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	96.97
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	96.83
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	96.77
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	96.54
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	96.54
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	96.48
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	96.41
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	96.37
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	96.07
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	96.0
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	95.88
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	95.48
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	94.18
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	90.99
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	88.46
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	88.13
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	87.28
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	87.17
2ks1_B		44	Epidermal growth factor receptor; ERBB1, ERBB2, tr	84.0
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	82.61

>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A*	Back alignment and structure

Probab=99.77  E-value=2.4e-18  Score=159.22  Aligned_cols=145  Identities=16%  Similarity=0.168  Sum_probs=102.8

Q ss_pred             cEEEccCCCCCCccccCCCCeeeecCCCcccCCceeee----cCCCCCccccccceEeeeeCCCCCceEEecCcCCCcce
Q 040922           14 FISIDCGIPENASYSDKITGINYVSDATYVDTGVSHSI----SSGYNNEAVERQFLNLRSFPEGIRNCYTLRPANGDVKF   89 (525)
Q Consensus        14 f~sidCG~~~~~~~~d~~~~~~w~~D~~~~~~g~~~~~----~~~~~~~~~~~~y~t~R~Fp~~~~~cY~~~v~~g~~~y   89 (525)
                      -+.||||++.   .+| ..+|+|.+|..|...|.....    ........+..+|+|||+||.  ..+|.||+.+++ +|
T Consensus         7 ~~~INcGg~~---~~d-~~gr~w~~D~~~~~~g~~~~~~~~~~~~~~~~~~~~lY~TaR~~~~--~~tY~f~v~~~G-~Y   79 (174)
T 2jwp_A            7 IWAVNAGGES---HVD-VHGIHYRKDPLEGRVGRASDYGMKLPILRSNPEDQVLYQTERYNED--SFGYDIPIKEEG-EY   79 (174)
T ss_dssp             EEEEEETSSS---EEE-TTTEEECSSCSSTTCCCCCCCCTTSCCSSSCHHHHHTTTCCCCCCS--CEEEEEECCSCE-EE
T ss_pred             EEEEECCCCC---ccC-CCCCEEcCCcCcccCCcccccccceEecccCCCCchhhhhhccCCC--CeEEEEEeCCCe-EE
Confidence            4789999864   244 468999999876533322111    111111234569999999965  589999998877 99


Q ss_pred             EEEEEeecCCCCCCCCCCeeEEEeCceE-EEEEEecc---CCCcEEEEEEEec-------------CCCcEEEEEEeCCC
Q 040922           90 LIRASFMYGNYDGQDMPPSFDLMLGADV-WDSVQLQD---SDGIITKEIIHMP-------------NKGYIHVCLVHTYS  152 (525)
Q Consensus        90 liR~~F~y~nyd~~~~~p~F~v~~~~~~-~~~v~~~~---~~~~~~~E~i~~~-------------~~~~l~vcf~~~~~  152 (525)
                      +|||||..-.|... ....|||++++.. ...+++..   ...++.+|+.+.+             .++.|.|+|.|...
T Consensus        80 ~VrLhF~ei~~~~~-~~rvFdV~ing~~~l~~fdi~~~ag~~~~~~~~~~~~v~~~~l~i~~~~~~~~g~L~I~f~p~~~  158 (174)
T 2jwp_A           80 VLVLKFAEVYFAQS-QQKVFDVRVNGHTVVKDLDIFDRVGHSTAHDEIIPISIKKGKLSVQGEVSTFTGKLSVEFVKGYY  158 (174)
T ss_dssp             EEEEEEECCSCCCS-SSSCEEEEETTEEEEEEECHHHHHSSSSCEEEEEEEEEETTEEEETTEEEECCSEEEEEEECSSS
T ss_pred             EEEEEEeccccCCC-CCeEeEEEECCEEeecCcCHHHhhCCCeeEEEEEEEEEecCceeeeeeecccCCeEEEEEeccCC
Confidence            99999986666543 2368999999855 44455432   2346889888763             56689999998767


Q ss_pred             CCceeEEEEEEEcC
Q 040922          153 GTPFISALELRPIT  166 (525)
Q Consensus       153 ~~pFIn~iEl~~lp  166 (525)
                      ..||||||||++-+
T Consensus       159 ~~a~inaIEI~~~~  172 (174)
T 2jwp_A          159 DNPKVCALFIMKGT  172 (174)
T ss_dssp             CSSSEEEEEEESSC
T ss_pred             CCcEEEEEEEEeCc
Confidence            78999999999754

PyMOL of 2jwp

>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A*	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		525
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	1e-10
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	4e-09
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	3e-07
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	4e-09
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	8e-09
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	6e-06
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	6e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	8e-08
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	3e-05
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	3e-05
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	4e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	8e-04
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	2e-07
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	2e-04
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	6e-07
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-06
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	5e-05
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	0.001
d1xwdc1		242	c.10.2.7 (C:18-259) Follicle-stimulating hormone r	2e-05
d2ca6a1		344	c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom	2e-05
d2ca6a1		344	c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom	4e-04
d1h6ta2		210	c.10.2.1 (A:31-240) Internalin B {Listeria monocyt	4e-05
d1h6ta2		210	c.10.2.1 (A:31-240) Internalin B {Listeria monocyt	8e-04
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	1e-04
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	0.002
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	1e-04
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	0.002
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	5e-04
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	0.002
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	6e-04

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 60.5 bits (145), Expect = 1e-10
 Identities = 16/91 (17%), Positives = 31/91 (34%), Gaps = 1/91 (1%)

Query: 371 WQGDPCTPKVHLWQGLNCSYDDNQPPRIISLNLSSSGISGEIDPYIFSLTSIESLDLSNN 430
              +     +                 +  L+L ++ I G +   +  L  + SL++S N
Sbjct: 219 SDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFN 278

Query: 431 SLTGLVPDFLAELESLTVLNLSGNNLQGSLP 461
           +L G +P     L+   V   + N      P
Sbjct: 279 NLCGEIPQ-GGNLQRFDVSAYANNKCLCGSP 308

PyMOL of d1ogqa_

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		525
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.48
d2ifga3		156	High affinity nerve growth factor receptor, N-term	99.24
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.13
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.05
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	98.93
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	98.91
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	98.9
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	98.76
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	98.65
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.51
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	98.48
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.45
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	98.28
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	98.27
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	98.27
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	98.12
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	98.12
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.06
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	97.92
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	97.82
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	97.76
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	97.74
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	97.73
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	97.68
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	97.68
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.61
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	97.57
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	97.34
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	97.22
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	97.0
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	96.97
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	96.96
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	96.26
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	95.97
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	95.68
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	95.65
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	95.36
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	94.76
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	94.05
d2o14a1		146	Hypothetical protein YxiM {Bacillus subtilis [TaxI	93.99
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	93.05
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	92.46
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	85.37

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.48  E-value=1.6e-14  Score=142.86  Aligned_cols=123  Identities=28%  Similarity=0.461  Sum_probs=103.1

Q ss_pred             cchhhHHHHHHhhhhcc---cCCCCC--CCCCCCcccccccccCCCCCCCCCceEEecCCCCCccC--CCchhhccCCCc
Q 040922          350 THQQDVDAITNIKSKYE---VKRDWQ--GDPCTPKVHLWQGLNCSYDDNQPPRIISLNLSSSGISG--EIDPYIFSLTSI  422 (525)
Q Consensus       350 t~~~d~~al~~l~~~~~---~~~~w~--g~pc~p~~~~w~gv~c~~~~~~~~~L~~L~Ls~n~l~g--~ip~~~~~L~~L  422 (525)
                      ..++|..||.++|+.+.   ...+|.  +|+|.   +.|.||.|+..+ ...+|+.|+|++|.++|  .+|+++++|++|
T Consensus         3 c~~~e~~aLl~~k~~~~~~~~l~sW~~~~d~C~---~~w~gv~C~~~~-~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L   78 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCN---RTWLGVLCDTDT-QTYRVNNLDLSGLNLPKPYPIPSSLANLPYL   78 (313)
T ss_dssp             SCHHHHHHHHHHHHHTTCCGGGTTCCTTSCTTT---TCSTTEEECCSS-SCCCEEEEEEECCCCSSCEECCGGGGGCTTC
T ss_pred             CCHHHHHHHHHHHHHCCCCCcCCCCCCCCCCCC---CcCCCeEEeCCC-CcEEEEEEECCCCCCCCCCCCChHHhcCccc
Confidence            46789999999998775   456894  58773   259999998643 34589999999999998  588999999999


Q ss_pred             CEEEcCC-CCCCCcCchhccCCCCCCEEeCCCCcCCCCCChhhhcCCCCcEEEEE
Q 040922          423 ESLDLSN-NSLTGLVPDFLAELESLTVLNLSGNNLQGSLPAGLVEKANNRSLSLS  476 (525)
Q Consensus       423 ~~L~Ls~-N~l~g~iP~~l~~l~~L~~L~Ls~N~L~g~iP~~l~~l~~l~~l~L~  476 (525)
                      +.|+|++ |++.|.+|..+++|++|++|+|++|++.+..|..+..+..|+.++++
T Consensus        79 ~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~  133 (313)
T d1ogqa_          79 NFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFS  133 (313)
T ss_dssp             SEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECC
T ss_pred             cccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccc
Confidence            9999986 89999999999999999999999999998888877777777776543

PyMOL of d1ogqa_

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d2o14a1 b.18.1.32 (A:14-159) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure