Citrus Sinensis ID: 040924

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
NITSRNNTKLPPGPWGLPFIGTLHQLDVSKPHVLFWELSKKYGPLMSLRLGFSPSLVVSSAKMAKEILKTHDLQFCSRPALVAQQKLSYNGLDLAFSPYDEYWREIRKICAIHLFNSNRGQNFRPIEKMNLIHQQASRPLFVELVLARGYFPFIGWIDKLTGMLQRPQNNFQEIDRVYQELIDKHLDPNRAKIEQLQQEDVIDVLLQI
cccccccccccccccccccccccccccccccHHHHHHHHHHHcccEEEEcccccEEEEccHHHHHHHHHHccccccccccHHHHHHHcccccccEEccccHHHHHHHHHHHHHHccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHcccc
ccccccccccccccccEcccEcHHHccccccHHHHHHHHHHcccEEEEEccccEEEEEccHHHHHHHHHccccHHcccccHHHHHHHEcccccEEEccccHHHHHHHHHHHHHHHcHHHHHccHHHHHHHHHHHHHHHcHHHHHHHcccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHcc
nitsrnntklppgpwglpfigtlhqldvskpHVLFWELSkkygplmslrlgfspslvVSSAKMAKEILKthdlqfcsrpaLVAQQKLsyngldlafspYDEYWREIRKICAIHLfnsnrgqnfrpiekmNLIHQQASRPLFVELVLArgyfpfigwIDKLTGmlqrpqnnfQEIDRVYQELIDKHLDPNRAKIEQLQQEDVIDVLLQI
nitsrnntklppgpwGLPFIGTLHQLDVSKPHVLFWELSKKYGPLMSLRLGFSPSLVVSSAKMAKEILKTHDLQFCSRPALVAQQKLSYNGLDLAFSPYDEYWREIRKICAIHLFNSNRGQNFRPIEKMNLIHQQASRPLFVELVLARGYFPFIGWIDKLTGMLQRPQNNFQEIDRVYQELIDKHLDPNRAkieqlqqedVIDVLLQI
NITSRNNTKLPPGPWGLPFIGTLHQLDVSKPHVLFWELSKKYGPLMSLRLGFSPSLVVSSAKMAKEILKTHDLQFCSRPALVAQQKLSYNGLDLAFSPYDEYWREIRKICAIHLFNSNRGQNFRPIEKMNLIHQQASRPLFVELVLARGYFPFIGWIDKLTGMLQRPQNNFQEIDRVYQELIDKHLDPNRAKIEQLQQEDVIDVLLQI
*************PWGLPFIGTLHQLDVSKPHVLFWELSKKYGPLMSLRLGFSPSLVVSSAKMAKEILKTHDLQFCSRPALVAQQKLSYNGLDLAFSPYDEYWREIRKICAIHLFNSNRGQNFRPIEKMNLIHQQASRPLFVELVLARGYFPFIGWIDKLTGMLQRPQNNFQEIDRVYQELIDKHLD*************VID*****
************GP*GLPFIGTLHQLDVSKPHVLFWELSKKYGPLMSLRLGFSPSLVVSSAKMAKEILKTHDLQFCSRPALVAQQKLSYNGLDLAFSPYDEYWREIRKICAIHLFNSNRGQNFRPIEKMNLIHQQASRPLFVELVLARGYFPFIGWIDKLTGMLQRPQNNFQEIDRVYQELI******************VIDVLLQI
********KLPPGPWGLPFIGTLHQLDVSKPHVLFWELSKKYGPLMSLRLGFSPSLVVSSAKMAKEILKTHDLQFCSRPALVAQQKLSYNGLDLAFSPYDEYWREIRKICAIHLFNSNRGQNFRPIEKMNLIHQQASRPLFVELVLARGYFPFIGWIDKLTGMLQRPQNNFQEIDRVYQELIDKHLDPNRAKIEQLQQEDVIDVLLQI
******NTKLPPGPWGLPFIGTLHQLDVSKPHVLFWELSKKYGPLMSLRLGFSPSLVVSSAKMAKEILKTHDLQFCSRPALVAQQKLSYNGLDLAFSPYDEYWREIRKICAIHLFNSNRGQNFRPIEKMNLIHQQASRPLFVELVLARGYFPFIGWIDKLTGMLQRPQNNFQEIDRVYQELIDKHLDPN*********EDVIDVLLQI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NITSRNNTKLPPGPWGLPFIGTLHQLDVSKPHVLFWELSKKYGPLMSLRLGFSPSLVVSSAKMAKEILKTHDLQFCSRPALVAQQKLSYNGLDLAFSPYDEYWREIRKICAIHLFNSNRGQNFRPIEKMNLIHQQASRPLFVELVLARGYFPFIGWIDKLTGMLQRPQNNFQEIDRVYQELIDKHLDPNRAKIEQLQQEDVIDVLLQI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query208 2.2.26 [Sep-21-2011]
O65782 499 Cytochrome P450 83B1 OS=A yes no 0.975 0.406 0.367 1e-40
Q6XQ14 511 2-methylbutanal oxime mon N/A no 0.961 0.391 0.387 1e-40
Q9LVD2 502 Cytochrome P450 71B10 OS= no no 0.966 0.400 0.357 6e-37
Q9LIP4 500 Cytochrome P450 71B36 OS= no no 0.923 0.384 0.357 5e-36
O81970 499 Cytochrome P450 71A9 OS=G no no 0.980 0.408 0.351 2e-35
Q9LIP6 500 Cytochrome P450 71B34 OS= no no 0.951 0.396 0.349 8e-35
O22307 490 Cytochrome P450 71D11 (Fr N/A no 0.951 0.404 0.368 2e-34
O81974 504 Cytochrome P450 71D8 OS=G no no 0.975 0.402 0.349 3e-34
Q9LIP3 500 Cytochrome P450 71B37 OS= no no 0.951 0.396 0.337 3e-34
P49264 496 Cytochrome P450 71B1 OS=T N/A no 0.923 0.387 0.353 5e-34
>sp|O65782|C83B1_ARATH Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 Back     alignment and function desciption
 Score =  166 bits (419), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 94/256 (36%), Positives = 139/256 (54%), Gaps = 53/256 (20%)

Query: 3   TSRNNTKLPPGPWGLPFIGTLHQLDVSKPHVLFWELSKKYGPLMSLRLGFSPSLVVSSAK 62
           T++ + +LPPGP GLP IG LHQ++   P    + LSK YGP+ ++++G     V+SSA+
Sbjct: 22  TTKKSLRLPPGPKGLPIIGNLHQMEKFNPQHFLFRLSKLYGPIFTMKIGGRRLAVISSAE 81

Query: 63  MAKEILKTHDLQFCSRPALVAQQKLSYNGLDLAFSPYDEYWREIRKICAIHLFNSNRGQN 122
           +AKE+LKT DL F +RP L  QQ +SY G +L F  Y  Y+RE+RK+C ++LF+ NR  +
Sbjct: 82  LAKELLKTQDLNFTARPLLKGQQTMSYQGRELGFGQYTAYYREMRKMCMVNLFSPNRVAS 141

Query: 123 FRPIEK------MNLIHQQASRPLFVEL----------VLAR------------------ 148
           FRP+ +      M+ I++ A +   V+L          V+ R                  
Sbjct: 142 FRPVREEECQRMMDKIYKAADQSGTVDLSELLLSFTNCVVCRQAFGKRYNEYGTEMKRFI 201

Query: 149 ----------------GYFPFIGWIDKLTGMLQRPQNNFQEIDRVYQELIDKHLDPNRAK 192
                             FP+ G++D LTG+  R +  F+E+D   QEL+D+ LDPNR K
Sbjct: 202 DILYETQALLGTLFFSDLFPYFGFLDNLTGLSARLKKAFKELDTYLQELLDETLDPNRPK 261

Query: 193 IEQLQQEDVIDVLLQI 208
            E    E  ID+L+QI
Sbjct: 262 QE---TESFIDLLMQI 274
Involved in the metabolism of aromatic oximes. Catalyzes the oxime metabolizing step in indole glucosinolate biosynthesis by converting indole-3-acetaldoxime into indole-3-S-alkyl-thiohydroximate. Probably required for glucosinolate activation in response to pathogens. Functions in auxin homeostasis because indole-3-acetaldoxime also serves as a precursor for auxin biosynthesis.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q6XQ14|C71E7_MANES 2-methylbutanal oxime monooxygenase OS=Manihot esculenta GN=CYP71E7 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVD2|C71BA_ARATH Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 Back     alignment and function description
>sp|Q9LIP4|C71BX_ARATH Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1 Back     alignment and function description
>sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 Back     alignment and function description
>sp|Q9LIP6|C71BV_ARATH Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 Back     alignment and function description
>sp|O22307|C71DB_LOTJA Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 Back     alignment and function description
>sp|O81974|C71D8_SOYBN Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 Back     alignment and function description
>sp|Q9LIP3|C71BY_ARATH Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2 Back     alignment and function description
>sp|P49264|C71B1_THLAR Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
255538870 497 cytochrome P450, putative [Ricinus commu 0.980 0.410 0.486 2e-61
255538866 496 cytochrome P450, putative [Ricinus commu 0.961 0.403 0.503 3e-59
224097756 504 cytochrome P450 [Populus trichocarpa] gi 0.947 0.390 0.488 2e-57
224065988 504 cytochrome P450 [Populus trichocarpa] gi 0.937 0.386 0.476 2e-56
225458055 495 PREDICTED: cytochrome P450 83B1 [Vitis v 0.894 0.375 0.489 2e-54
224062041 513 cytochrome P450 [Populus trichocarpa] gi 0.985 0.399 0.458 1e-53
359492722 555 PREDICTED: LOW QUALITY PROTEIN: cytochro 0.923 0.345 0.467 3e-53
224085806 654 cytochrome P450 [Populus trichocarpa] gi 0.971 0.308 0.459 4e-53
224062037 513 cytochrome P450 [Populus trichocarpa] gi 0.985 0.399 0.450 1e-51
356506418 499 PREDICTED: cytochrome P450 83B1-like [Gl 0.956 0.398 0.428 2e-50
>gi|255538870|ref|XP_002510500.1| cytochrome P450, putative [Ricinus communis] gi|223551201|gb|EEF52687.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 125/257 (48%), Positives = 160/257 (62%), Gaps = 53/257 (20%)

Query: 2   ITSRNNTKLPPGPWGLPFIGTLHQLDVSKPHVLFWELSKKYGPLMSLRLGFSPSLVVSSA 61
           + +R N+ LPPGP GLP IG LHQ D S P    W+LS+KYGPLMSLRLG  P LVVSSA
Sbjct: 22  LKTRRNSSLPPGPKGLPLIGNLHQFDQSAPQNYLWKLSQKYGPLMSLRLGSVPILVVSSA 81

Query: 62  KMAKEILKTHDLQFCSRPALVAQQKLSYNGLDLAFSPYDEYWREIRKICAIHLFNSNRGQ 121
           KMAK+ILKT+DL FCSRP ++ QQKLSYNGLDLAF+PY+ YWRE+RKIC +HLFNSN+ Q
Sbjct: 82  KMAKDILKTYDLTFCSRPPVLGQQKLSYNGLDLAFAPYNSYWREMRKICVVHLFNSNKVQ 141

Query: 122 NFRPIEKMNLIHQ--------QASRPL--------FVELVLAR----------------- 148
           +FRPI +  + H          A++P+            ++ R                 
Sbjct: 142 SFRPIREFEVSHMLEKISKLAAATKPVDLSEAMMSLTSTIICRVAFGKRYEEEGIERTRF 201

Query: 149 -----------------GYFPFIGWIDKLTGMLQRPQNNFQEIDRVYQELIDKHLDPNRA 191
                             YFPF+G++D+LTGM +R + NF+E D  Y ++I +HLDP+R 
Sbjct: 202 QALLEETQALFTSFFVSDYFPFLGFVDRLTGMNRRLEKNFKEFDIFYNQIIQEHLDPSRP 261

Query: 192 KIEQLQQEDVIDVLLQI 208
           K E   QED++DVLLQI
Sbjct: 262 KPE---QEDILDVLLQI 275

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255538866|ref|XP_002510498.1| cytochrome P450, putative [Ricinus communis] gi|223551199|gb|EEF52685.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224097756|ref|XP_002334586.1| cytochrome P450 [Populus trichocarpa] gi|222873361|gb|EEF10492.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224065988|ref|XP_002301993.1| cytochrome P450 [Populus trichocarpa] gi|222843719|gb|EEE81266.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225458055|ref|XP_002278300.1| PREDICTED: cytochrome P450 83B1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224062041|ref|XP_002300725.1| cytochrome P450 [Populus trichocarpa] gi|222842451|gb|EEE79998.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359492722|ref|XP_003634459.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 83B1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224085806|ref|XP_002307703.1| cytochrome P450 [Populus trichocarpa] gi|222857152|gb|EEE94699.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224062037|ref|XP_002300723.1| cytochrome P450 [Populus trichocarpa] gi|222842449|gb|EEE79996.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356506418|ref|XP_003521980.1| PREDICTED: cytochrome P450 83B1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
TAIR|locus:2125264 499 CYP83B1 ""cytochrome P450, fam 0.600 0.250 0.488 5e-42
TAIR|locus:2065254 500 CYP71B9 ""cytochrome P450, fam 0.591 0.246 0.516 1.5e-41
TAIR|locus:2079311 500 CYP71B36 ""cytochrome P450, fa 0.591 0.246 0.516 2.8e-40
TAIR|locus:2165595 502 CYP71B10 ""cytochrome P450, fa 0.677 0.280 0.466 4.1e-40
TAIR|locus:2079251 500 CYP71B34 ""cytochrome P450, fa 0.586 0.244 0.520 2.5e-39
TAIR|locus:2079316 500 CYP71B37 ""cytochrome P450, fa 0.591 0.246 0.483 3e-38
TAIR|locus:2093561 500 CYP71B26 ""cytochrome P450, fa 0.552 0.23 0.508 3.8e-38
TAIR|locus:2079306 500 CYP71B35 ""cytochrome P450, fa 0.552 0.23 0.508 4.5e-37
TAIR|locus:2031820 504 CYP71B7 ""cytochrome P450, fam 0.572 0.236 0.491 3e-36
TAIR|locus:2031900 502 CYP71B2 ""cytochrome P450, fam 0.644 0.266 0.496 1.3e-35
TAIR|locus:2125264 CYP83B1 ""cytochrome P450, family 83, subfamily B, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 331 (121.6 bits), Expect = 5.0e-42, Sum P(2) = 5.0e-42
 Identities = 62/127 (48%), Positives = 89/127 (70%)

Query:     3 TSRNNTKLPPGPWGLPFIGTLHQLDVSKP-HVLFWELSKKYGPLMSLRLGFSPSLVVSSA 61
             T++ + +LPPGP GLP IG LHQ++   P H LF  LSK YGP+ ++++G     V+SSA
Sbjct:    22 TTKKSLRLPPGPKGLPIIGNLHQMEKFNPQHFLF-RLSKLYGPIFTMKIGGRRLAVISSA 80

Query:    62 KMAKEILKTHDLQFCSRPALVAQQKLSYNGLDLAFSPYDEYWREIRKICAIHLFNSNRGQ 121
             ++AKE+LKT DL F +RP L  QQ +SY G +L F  Y  Y+RE+RK+C ++LF+ NR  
Sbjct:    81 ELAKELLKTQDLNFTARPLLKGQQTMSYQGRELGFGQYTAYYREMRKMCMVNLFSPNRVA 140

Query:   122 NFRPIEK 128
             +FRP+ +
Sbjct:   141 SFRPVRE 147
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009684 "indoleacetic acid biosynthetic process" evidence=RCA;IMP
GO:0009759 "indole glucosinolate biosynthetic process" evidence=IDA
GO:0000162 "tryptophan biosynthetic process" evidence=IMP
GO:0016709 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0048830 "adventitious root development" evidence=TAS
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0042742 "defense response to bacterium" evidence=RCA;IMP
GO:0052544 "defense response by callose deposition in cell wall" evidence=IMP
GO:0009682 "induced systemic resistance" evidence=IEP
GO:0000096 "sulfur amino acid metabolic process" evidence=RCA
GO:0006520 "cellular amino acid metabolic process" evidence=RCA
GO:0006546 "glycine catabolic process" evidence=RCA
GO:0006569 "tryptophan catabolic process" evidence=RCA
GO:0006636 "unsaturated fatty acid biosynthetic process" evidence=RCA
GO:0006733 "oxidoreduction coenzyme metabolic process" evidence=RCA
GO:0006766 "vitamin metabolic process" evidence=RCA
GO:0008652 "cellular amino acid biosynthetic process" evidence=RCA
GO:0009072 "aromatic amino acid family metabolic process" evidence=RCA
GO:0009106 "lipoate metabolic process" evidence=RCA
GO:0009108 "coenzyme biosynthetic process" evidence=RCA
GO:0009117 "nucleotide metabolic process" evidence=RCA
GO:0009695 "jasmonic acid biosynthetic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0019748 "secondary metabolic process" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0044272 "sulfur compound biosynthetic process" evidence=RCA
GO:0009641 "shade avoidance" evidence=IMP
GO:0010114 "response to red light" evidence=IMP
TAIR|locus:2065254 CYP71B9 ""cytochrome P450, family 71, subfamily B, polypeptide 9"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079311 CYP71B36 ""cytochrome P450, family 71, subfamily B, polypeptide 36"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165595 CYP71B10 ""cytochrome P450, family 71, subfamily B, polypeptide 10"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079251 CYP71B34 ""cytochrome P450, family 71, subfamily B, polypeptide 34"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079316 CYP71B37 ""cytochrome P450, family 71, subfamily B, polypeptide 37"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093561 CYP71B26 ""cytochrome P450, family 71, subfamily B, polypeptide 26"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079306 CYP71B35 ""cytochrome P450, family 71, subfamily B, polypeptide 35"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031820 CYP71B7 ""cytochrome P450, family 71 subfamily B, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031900 CYP71B2 ""cytochrome P450, family 71, subfamily B, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 1e-48
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 1e-33
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 2e-32
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 7e-29
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 7e-26
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 4e-25
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 2e-19
pfam00067 461 pfam00067, p450, Cytochrome P450 2e-19
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 3e-14
PLN02971 543 PLN02971, PLN02971, tryptophan N-hydroxylase 1e-11
PLN00168 519 PLN00168, PLN00168, Cytochrome P450; Provisional 4e-11
PLN03018 534 PLN03018, PLN03018, homomethionine N-hydroxylase 5e-08
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 2e-06
PLN02196 463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 4e-05
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information 
 Score =  165 bits (418), Expect = 1e-48
 Identities = 94/256 (36%), Positives = 139/256 (54%), Gaps = 53/256 (20%)

Query: 3   TSRNNTKLPPGPWGLPFIGTLHQLDVSKPHVLFWELSKKYGPLMSLRLGFSPSLVVSSAK 62
           T++ + +LPPGP GLP IG LHQ++   P    + LSK YGP+ ++++G     V+SSA+
Sbjct: 22  TTKKSLRLPPGPKGLPIIGNLHQMEKFNPQHFLFRLSKLYGPIFTMKIGGRRLAVISSAE 81

Query: 63  MAKEILKTHDLQFCSRPALVAQQKLSYNGLDLAFSPYDEYWREIRKICAIHLFNSNRGQN 122
           +AKE+LKT DL F +RP L  QQ +SY G +L F  Y  Y+RE+RK+C ++LF+ NR  +
Sbjct: 82  LAKELLKTQDLNFTARPLLKGQQTMSYQGRELGFGQYTAYYREMRKMCMVNLFSPNRVAS 141

Query: 123 FRPIEK------MNLIHQQASRPLFVEL----------VLAR------------------ 148
           FRP+ +      M+ I++ A +   V+L          V+ R                  
Sbjct: 142 FRPVREEECQRMMDKIYKAADQSGTVDLSELLLSFTNCVVCRQAFGKRYNEYGTEMKRFI 201

Query: 149 ----------------GYFPFIGWIDKLTGMLQRPQNNFQEIDRVYQELIDKHLDPNRAK 192
                             FP+ G++D LTG+  R +  F+E+D   QEL+D+ LDPNR K
Sbjct: 202 DILYETQALLGTLFFSDLFPYFGFLDNLTGLSARLKKAFKELDTYLQELLDETLDPNRPK 261

Query: 193 IEQLQQEDVIDVLLQI 208
            E    E  ID+L+QI
Sbjct: 262 QE---TESFIDLLMQI 274

Length = 499
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 208
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.97
PLN02687 517 flavonoid 3'-monooxygenase 99.93
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.91
PLN02655 466 ent-kaurene oxidase 99.91
PLN03234 499 cytochrome P450 83B1; Provisional 99.91
PLN02183 516 ferulate 5-hydroxylase 99.9
PLN02971 543 tryptophan N-hydroxylase 99.9
PTZ00404 482 cytochrome P450; Provisional 99.89
PLN03112 514 cytochrome P450 family protein; Provisional 99.89
PLN02290 516 cytokinin trans-hydroxylase 99.88
PLN00168 519 Cytochrome P450; Provisional 99.88
PLN02966 502 cytochrome P450 83A1 99.87
PLN02196 463 abscisic acid 8'-hydroxylase 99.87
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.86
PLN02500 490 cytochrome P450 90B1 99.85
PLN02394 503 trans-cinnamate 4-monooxygenase 99.85
PLN02774 463 brassinosteroid-6-oxidase 99.84
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.84
PLN03018 534 homomethionine N-hydroxylase 99.84
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.83
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.82
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.8
PLN02302 490 ent-kaurenoic acid oxidase 99.79
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.79
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.77
PLN02738 633 carotene beta-ring hydroxylase 99.76
PLN02936 489 epsilon-ring hydroxylase 99.74
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.72
PLN02648 480 allene oxide synthase 99.57
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.47
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 99.39
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 98.95
KOG0114124 consensus Predicted RNA-binding protein (RRM super 84.45
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=99.97  E-value=1.1e-29  Score=202.61  Aligned_cols=201  Identities=38%  Similarity=0.717  Sum_probs=157.8

Q ss_pred             CCCCCCCCCCCCCCccccccccCCCCCchHHHHHHHHhhCCeEEEEcCCcCEEEecCHHHHHHHHHHcCccCCCCCC-hH
Q 040924            4 SRNNTKLPPGPWGLPFIGTLHQLDVSKPHVLFWELSKKYGPLMSLRLGFSPSLVVSSAKMAKEILKTHDLQFCSRPA-LV   82 (208)
Q Consensus         4 ~~~~~~~~pgp~~~p~~g~~~~~~~~~~~~~~~~~~~~yG~v~~~~~~~~~~v~i~dp~~~~~i~~~~~~~~~~~~~-~~   82 (208)
                      .+++.++||||+++|++||++++....+|..+.++.++|||++.+++|..++|+|+|+++++|+|++++..|.+|+. ..
T Consensus        21 ~~~~~~lPPGP~~lPiIGnl~~l~~~~~h~~~~~ls~~yGpi~tl~lG~~~~Vviss~~~akE~l~~~d~~fa~Rp~~~~  100 (489)
T KOG0156|consen   21 YRKRRNLPPGPPPLPIIGNLHQLGSLPPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLVKQDLEFADRPDPTA  100 (489)
T ss_pred             ccCCCCCCcCCCCCCccccHHHcCCCchhHHHHHHHHHhCCeEEEEecCceEEEECCHHHHHHHHHhCCccccCCCCchh
Confidence            34458899999999999999999444599999999999999999999999999999999999999999999999997 33


Q ss_pred             HHHHhhcCCcceeeCCCChHHHHHHHHHHHHhhccccccccccHHHH------HHHHH-hc-C-----------------
Q 040924           83 AQQKLSYNGLDLAFSPYDEYWREIRKICAIHLFNSNRGQNFRPIEKM------NLIHQ-QA-S-----------------  137 (208)
Q Consensus        83 ~~~~~~~~~~~l~~~~~g~~w~~~Rk~l~~~~f~~~~l~~~~~~~~~------~~l~~-~~-~-----------------  137 (208)
                      ....+..++.|++++++|+.||.+||++....|+.+.+++......+      +.+.+ .. .                 
T Consensus       101 ~~~~~~~~~~~i~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~~~R~~E~~~l~~~l~~~~~~~~vdl~~~l~~~~~nvI~  180 (489)
T KOG0156|consen  101 TLKYLSYGGKGIVFAPYGDYWREMRRFALTELRSFGRGKSFMEIREEEVDELVKKLSKSKKGEPVDLSELLDLLVGNVIC  180 (489)
T ss_pred             hHHHhcCCCCceEeCCCcHHHHHHHHHHHHHhcChhhhhhhHHHHHHHHHHHHHHHHhcCCCceeeHHHHHHHHHHHHHH
Confidence            44666667899999988999999999999889999998877555533      33332 00 1                 


Q ss_pred             ------------hhH---HHHHh----------hhccccc-cccccccccchhhhhhhhHHHHHHHHHHHHHHhhccccc
Q 040924          138 ------------RPL---FVELV----------LARGYFP-FIGWIDKLTGMLQRPQNNFQEIDRVYQELIDKHLDPNRA  191 (208)
Q Consensus       138 ------------~~~---~~~~~----------~~~~~~p-~l~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~  191 (208)
                                  +++   +.+++          ...+++| ++++++...+..++......+++++++++|+++++.. .
T Consensus       181 ~~~fG~rf~~~~~~~~~~~~~l~~~~~~~~~~~~~~d~~p~~l~~~~~~~g~~~~~~~~~~~~~~~~~~~i~eh~~~~-~  259 (489)
T KOG0156|consen  181 RMLFGRRFEEEDEEEFLELKELVEESLELLGSFNLSDYFPFLLRWLDGISGLEKRLKKVSKRLDEFLERIIDEHREKI-G  259 (489)
T ss_pred             HHHhCCccccCCchHHHHHHHHHHHHHHHhCCccHHHHhhHHHHhcccccHHHHHHHHHHHHHHHHHHHHHHHHHhhh-c
Confidence                        122   33333          5667788 5666654345677777777789999999999998875 2


Q ss_pred             chhccccccHHHhhhcC
Q 040924          192 KIEQLQQEDVIDVLLQI  208 (208)
Q Consensus       192 ~~~~~~~~d~l~~ll~~  208 (208)
                      . ++.  +||+|.||++
T Consensus       260 ~-~~~--~D~vD~lL~~  273 (489)
T KOG0156|consen  260 D-EEG--RDFVDALLKL  273 (489)
T ss_pred             c-CCC--CcHHHHHHHh
Confidence            1 222  7999999863

>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
1dt6_A 473 Structure Of Mammalian Cytochrome P450 2c5 Length = 3e-11
4i8v_A 491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 9e-11
1pq2_A 476 Crystal Structure Of Human Drug Metabolizing Cytoch 2e-10
4gqs_A 477 Structure Of Human Microsomal Cytochrome P450 (cyp) 4e-10
1r9o_A 477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 5e-10
3e4e_A 476 Human Cytochrome P450 2e1 In Complex With The Inhib 4e-09
3pm0_A 507 Structural Characterization Of The Complex Between 5e-09
3ruk_A 494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 7e-09
1og2_A 475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 3e-08
2hi4_A 495 Crystal Structure Of Human Microsomal P450 1a2 In C 1e-07
4h1n_A 479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 2e-07
2q6n_A 478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 2e-07
1po5_A 476 Structure Of Mammalian Cytochrome P450 2b4 Length = 2e-07
3tk3_A 476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 2e-07
1suo_A 476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 2e-07
2p85_A 476 Structure Of Human Lung Cytochrome P450 2a13 With I 5e-07
2pg7_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-06
2pg6_A 476 Crystal Structure Of Human Microsomal P450 2a6 L240 2e-06
2pg5_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-06
1z10_A 476 Crystal Structure Of Human Microsomal P450 2a6 With 2e-06
3ebs_A 476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 2e-06
3qz1_A 496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 3e-04
3qm4_A 479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 5e-04
2f9q_A 479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 6e-04
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure 
Iteration: 1

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 72/141 (51%), Gaps = 7/141 (4%)
Query: 4   SRNNTKLPPGPWGLPFIGTLHQLDVSKPHVLFWELSKKYGPLMSLRLGFSPSLVVSSAKM 63
           + +  KLPPGP   P IG + Q+D         + S+ YGP+ ++ LG  P++V+   + 
Sbjct: 5   TSSKGKLPPGPTPFPIIGNILQIDAKDISKSLTKFSECYGPVFTVYLGMKPTVVLHGYEA 64
Query: 64  AKEILKTHDLQFCSRPALVAQQKLSYNGLDLAFSPYDEYWREIRKICAIHLFNSNRGQNF 123
            KE L     +F  R ++   +K+S  GL +AFS   + W+E+R+   + L N   G+  
Sbjct: 65  VKEALVDLGEEFAGRGSVPILEKVS-KGLGIAFS-NAKTWKEMRRFSLMTLRNFGMGK-- 120
Query: 124 RPIEKMNLIHQQASRPLFVEL 144
           R IE      Q+ +R L  EL
Sbjct: 121 RSIEDRI---QEEARCLVEEL 138
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 3e-41
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 9e-40
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 1e-35
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 7e-35
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 3e-32
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 9e-31
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 9e-31
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 3e-30
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 8e-30
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 1e-29
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 5e-29
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-28
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 2e-28
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 4e-28
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 5e-20
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 9e-19
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 2e-17
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 4e-16
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 2e-15
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 1e-14
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 7e-13
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 4e-11
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 4e-11
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 7e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 1e-06
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 2e-05
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 5e-04
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
 Score =  144 bits (366), Expect = 3e-41
 Identities = 30/260 (11%), Positives = 63/260 (24%), Gaps = 63/260 (24%)

Query: 9   KLPPGPWGLPFIGTLHQL---DVSKPHVLFWELSKKYGPLMSLRLGFSPSLVVSSAKMAK 65
              P P    ++   H        K H+   +  +KYGP+   +LG   S+ V   +   
Sbjct: 9   NEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVA 68

Query: 66  EILKTHDLQFCSRPALVAQQ-KLSYNGLDLAFSPYDEYWREIRKICAIHLFNSNRGQNFR 124
            + K+                   Y             W++ R      +      +NF 
Sbjct: 69  LLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFL 128

Query: 125 PI------EKMNLIHQQASRP--------------------------------------- 139
           P+      + ++++H++  +                                        
Sbjct: 129 PLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGERQGMLEEVVNP 188

Query: 140 -----------LFVELVLARGYFPFIGWIDKLTGMLQRPQNNFQEIDRVYQELIDKHLDP 188
                      +F   V      P +  + + T   +     +  I              
Sbjct: 189 EAQRFIDAIYQMFHTSVPMLNLPPDLFRLFR-TKTWKDHVAAWDVIFSKADIYTQNFYWE 247

Query: 189 NRAKIEQLQQEDVIDVLLQI 208
            R K       D   +L ++
Sbjct: 248 LRQKGS--VHHDYRGILYRL 265
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.95
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.93
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.92
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.91
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.91
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.91
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.91
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.91
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.9
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.9
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.89
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.89
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.89
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.88
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.88
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.86
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.85
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.83
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.83
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.83
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.82
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.78
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.76
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.74
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.71
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.69
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.68
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.66
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.64
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.6
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.6
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.59
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 99.59
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.59
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.58
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 99.57
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.57
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.56
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.56
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.54
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.54
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.52
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.52
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 99.51
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.5
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.5
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.5
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 99.5
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.49
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.48
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.46
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.46
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.44
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.44
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.44
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.43
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 99.43
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 99.42
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.41
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 99.41
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.4
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.4
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.36
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.34
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 99.33
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.32
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.27
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.21
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.19
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 99.15
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.06
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 98.96
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 98.92
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 98.92
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 98.88
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 98.71
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 95.45
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 82.16
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
Probab=99.95  E-value=1.5e-26  Score=186.25  Aligned_cols=197  Identities=21%  Similarity=0.425  Sum_probs=141.7

Q ss_pred             CCCCCCCCCCCCCCccccccccCCC-CCchHHHHHHHHhhCCeEEEEcCCcCEEEecCHHHHHHHHHHcCccCCCCCChH
Q 040924            4 SRNNTKLPPGPWGLPFIGTLHQLDV-SKPHVLFWELSKKYGPLMSLRLGFSPSLVVSSAKMAKEILKTHDLQFCSRPALV   82 (208)
Q Consensus         4 ~~~~~~~~pgp~~~p~~g~~~~~~~-~~~~~~~~~~~~~yG~v~~~~~~~~~~v~i~dp~~~~~i~~~~~~~~~~~~~~~   82 (208)
                      +++..+.||||+++|++||++.+.. +.++..+.+|+++||+|+++++|+.++|+|+||+++++||.+++..|.+++...
T Consensus         3 k~~~~~~PPgP~~lPliGnl~~l~~~~~~~~~~~~~~~kYG~i~~~~~g~~~~vvv~~p~~~k~il~~~~~~f~~rp~~~   82 (494)
T 3swz_A            3 KKTGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMA   82 (494)
T ss_dssp             ---------CCBCCCEEEEESSCTTSSCHHHHHHHTHHHHCSEEEEEETTEEEEEECSHHHHHHHHTTTTTTTBBCCCCH
T ss_pred             CCCCCCCCCCCCCCCeEcchHHhCCCCchhHHHHHHHHHcCCEEEEEeCCCCEEEECCHHHHHHHHHhCcHhhCCCCCcH
Confidence            4566788999999999999998843 467899999999999999999999999999999999999998888998888766


Q ss_pred             HHHHhhcCCcceeeCCCChHHHHHHHHHHHHhhcc--ccccccccHHHH------HHHHHhcC-----------------
Q 040924           83 AQQKLSYNGLDLAFSPYDEYWREIRKICAIHLFNS--NRGQNFRPIEKM------NLIHQQAS-----------------  137 (208)
Q Consensus        83 ~~~~~~~~~~~l~~~~~g~~w~~~Rk~l~~~~f~~--~~l~~~~~~~~~------~~l~~~~~-----------------  137 (208)
                      ....+...+.|++++++|+.|+++|++++ ++|+.  ..+..+.+++.+      +.+.+..+                 
T Consensus        83 ~~~~~~~~~~gl~~~~~g~~wr~~Rr~~~-~~f~~~~~~~~~~~~~i~~~~~~l~~~l~~~~~~~vd~~~~~~~~t~dvi  161 (494)
T 3swz_A           83 TLDIASNNRKGIAFADSGAHWQLHRRLAM-ATFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVI  161 (494)
T ss_dssp             HHHHHTTTTCSSSSSCSSHHHHHHHHHHH-HHTTTTSSSTTCHHHHHHHHHHHHHHHHHHTTTEEECCHHHHHHHHHHHH
T ss_pred             HHHHhccCCCCeEeCCCCHHHHHHHHHHH-HHHHHhcchHHHHHHHHHHHHHHHHHHHHHcCCCcccHHHHHHHHHHHHH
Confidence            55555445678888877999999999999 99974  456677777776      23322211                 


Q ss_pred             ------------hhHH---HHHh----------hhccccccccccccccchhhhhhhhHHHHHHHHHHHHHHhhcccccc
Q 040924          138 ------------RPLF---VELV----------LARGYFPFIGWIDKLTGMLQRPQNNFQEIDRVYQELIDKHLDPNRAK  192 (208)
Q Consensus       138 ------------~~~~---~~~~----------~~~~~~p~l~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~  192 (208)
                                  +..+   ..+.          .+.+++|++.+++.  ...+++..+...+.+++.++++++++..+. 
T Consensus       162 ~~~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~l~~~p~--~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~-  238 (494)
T 3swz_A          162 SLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPN--KTLEKLKSHVKIRNDLLNKILENYKEKFRS-  238 (494)
T ss_dssp             HHHHHSCCCCTTCTHHHHHHHHHHHHHHHHCSSSSCCSSCGGGTSCC--SHHHHHHHHHHHHHHHHHHHHHHHTTTCCT-
T ss_pred             HHHHcCCcCCCCCHHHHHHHHHHHHHHHhcccchHHHHHHHHHHcCc--HHHHHHHHHHHHHHHHHHHHHHHHHHhhcc-
Confidence                        1111   1110          23456777776652  345667778888889999999888776543 


Q ss_pred             hhccccccHHHhhhc
Q 040924          193 IEQLQQEDVIDVLLQ  207 (208)
Q Consensus       193 ~~~~~~~d~l~~ll~  207 (208)
                       ...  .|+++.|++
T Consensus       239 -~~~--~d~l~~ll~  250 (494)
T 3swz_A          239 -DSI--TNMLDTLMQ  250 (494)
T ss_dssp             -TCC--CSHHHHHHH
T ss_pred             -cch--hHHHHHHHH
Confidence             334  789988874
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 208
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 3e-32
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 2e-29
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 3e-28
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 9e-27
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 5e-24
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 5e-23
d1n97a_ 385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 2e-13
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 8e-13
d1odoa_ 401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 2e-10
d1ueda_ 403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 1e-04
d1z8oa1 402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 0.001
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2c9
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  119 bits (297), Expect = 3e-32
 Identities = 36/126 (28%), Positives = 54/126 (42%), Gaps = 2/126 (1%)

Query: 9   KLPPGPWGLPFIGTLHQLDVSKPHVLFWELSKKYGPLMSLRLGFSPSLVVSSAKMAKEIL 68
           KLPPGP  LP IG + Q+ +         LSK YGP+ +L  G  P +V+   +  KE L
Sbjct: 3   KLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEAL 62

Query: 69  KTHDLQFCSRPALVAQQKLSYNGLDLAFSPYDEYWREIRKICAIHLFNSNRGQNFRPIEK 128
                +F  R      ++ +  G  + FS   + W+EIR+   + L N   G+       
Sbjct: 63  IDLGEEFSGRGIFPLAERANR-GFGIVFS-NGKKWKEIRRFSLMTLRNFGMGKRSIEDRV 120

Query: 129 MNLIHQ 134
                 
Sbjct: 121 QEEARC 126
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.9
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.88
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.87
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.85
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.84
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.83
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.7
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.47
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.36
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.34
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.34
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.34
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.22
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.13
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 98.95
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 98.95
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 98.81
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 98.71
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 98.42
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 97.97
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 97.84
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 83.31
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome P450 bm-3
species: Bacillus megaterium [TaxId: 1404]

Probab=99.90  E-value=1.8e-23  Score=164.61  Aligned_cols=118  Identities=17%  Similarity=0.216  Sum_probs=97.5

Q ss_pred             CCCCCCCCCccccccccCCCCCchHHHHHHHHhhCCeEEEEcCCcCEEEecCHHHHHHHHHHcCccCCCCCChHHHHHhh
Q 040924            9 KLPPGPWGLPFIGTLHQLDVSKPHVLFWELSKKYGPLMSLRLGFSPSLVVSSAKMAKEILKTHDLQFCSRPALVAQQKLS   88 (208)
Q Consensus         9 ~~~pgp~~~p~~g~~~~~~~~~~~~~~~~~~~~yG~v~~~~~~~~~~v~i~dp~~~~~i~~~~~~~~~~~~~~~~~~~~~   88 (208)
                      +.+|||+++|++||++.+...+++..+.+++++|||||++++++.++|+|+||+++++++..+...+..+........+.
T Consensus         1 r~iPGP~~~p~lG~l~~l~~~~~~~~~~~~~~kyG~if~~~~~~~~~vvl~~~~~i~~v~~~~~~~~~~~~~~~~~~~~~   80 (453)
T d2ij2a1           1 KEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRDFA   80 (453)
T ss_dssp             CCCCCCCCCGGGTTGGGGCSSCHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHTCTTTEEECCCHHHHHHHHHH
T ss_pred             CCCccCCCcchhhCHHHhCCCCHHHHHHHHHHHhCCEEEEEeCCceEEEECCHHHHHHHHhcCCcccccccHhHHHHHhc
Confidence            45899999999999998866788999999999999999999999999999999999999976654454433333333333


Q ss_pred             cCCcceeeC-CCChHHHHHHHHHHHHhhccccccccccHHHH
Q 040924           89 YNGLDLAFS-PYDEYWREIRKICAIHLFNSNRGQNFRPIEKM  129 (208)
Q Consensus        89 ~~~~~l~~~-~~g~~w~~~Rk~l~~~~f~~~~l~~~~~~~~~  129 (208)
                        |+|++++ .+|+.|+++|++++ ++|+.+.++.+.+.+.+
T Consensus        81 --g~~~~~~~~~g~~wk~~Rk~l~-~~fs~~~l~~~~~~i~~  119 (453)
T d2ij2a1          81 --GDGLFTSWTHEKNWKKAHNILL-PSFSQQAMKGYHAMMVD  119 (453)
T ss_dssp             --TTSGGGSCTTSHHHHHHHHHHG-GGGSTTTHHHHHHHHHH
T ss_pred             --CCcEEecCCChHHHHHHHHHHH-HHhhhhhhhhhhhhHHH
Confidence              5677653 23999999999999 99999999999998877
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure