Citrus Sinensis ID: 040957
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 430 | 2.2.26 [Sep-21-2011] | |||||||
| Q8VHK0 | 320 | Acyl-coenzyme A thioester | yes | no | 0.660 | 0.887 | 0.412 | 7e-57 | |
| P58137 | 320 | Acyl-coenzyme A thioester | yes | no | 0.651 | 0.875 | 0.413 | 2e-56 | |
| O14734 | 319 | Acyl-coenzyme A thioester | yes | no | 0.648 | 0.874 | 0.409 | 4e-56 | |
| P0AGG2 | 286 | Acyl-CoA thioesterase 2 O | N/A | no | 0.618 | 0.930 | 0.419 | 3e-51 | |
| P0AGG3 | 286 | Acyl-CoA thioesterase 2 O | N/A | no | 0.618 | 0.930 | 0.419 | 3e-51 | |
| P44498 | 286 | Acyl-CoA thioesterase 2 O | yes | no | 0.634 | 0.954 | 0.364 | 1e-41 | |
| P41903 | 349 | Peroxisomal acyl-coenzyme | yes | no | 0.646 | 0.796 | 0.261 | 9e-17 | |
| P0C605 | 671 | cGMP-dependent protein ki | no | no | 0.244 | 0.156 | 0.336 | 1e-08 | |
| P00516 | 671 | cGMP-dependent protein ki | no | no | 0.244 | 0.156 | 0.336 | 2e-08 | |
| Q13976 | 671 | cGMP-dependent protein ki | no | no | 0.244 | 0.156 | 0.336 | 4e-08 |
| >sp|Q8VHK0|ACOT8_RAT Acyl-coenzyme A thioesterase 8 OS=Rattus norvegicus GN=Acot8 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 221 bits (564), Expect = 7e-57, Method: Compositional matrix adjust.
Identities = 121/293 (41%), Positives = 172/293 (58%), Gaps = 9/293 (3%)
Query: 135 LVENILHLEPVEVNIFQGITLPDAPKFGKVFGGQLVGQALAAASKTVDCLKIVHSLHCYF 194
LV ++L+LEP++ ++++G P ++FGGQ+VGQAL AA+K+V VHSLHCYF
Sbjct: 27 LVTSVLNLEPLDEDLYRGRHYW-VPTSQRLFGGQIVGQALVAAAKSVSEDVHVHSLHCYF 85
Query: 195 LLVGDLNIPIIYQVHRVRDGNSFATRRVDAIQKGNIIFTLLASFQKEEQGFEHQETTMPL 254
+ GD +P++Y V R R G SF+ R V A+Q G IF ASFQ+ + + +MP
Sbjct: 86 VRAGDPKVPVLYHVERTRTGASFSVRAVKAVQHGKAIFICQASFQQMQPSPLQHQFSMPT 145
Query: 255 VPAPEMLLSMEELRERRLTDPRLPRSYR---NKVASKEFVPWPIDIRFCEPNSYTNQSKS 311
VP PE LL E L ++ L DP L YR N++A++E PI+I+ P +
Sbjct: 146 VPPPEELLDHEALIDQYLRDPNLHEKYRVGLNRIAAREV---PIEIKLVNPPALNQLQTL 202
Query: 312 PPSLRYWFRAKGKLSD-DQALHRCVVAFASDLIFSSVSLNPHRRKGFRTASLSLDHSMWF 370
P +W RA+G + + D +H CV A+ SD F +L PH+ K +SLDHSMWF
Sbjct: 203 EPKQMFWVRARGYIGEGDIKMHCCVAAYISDYAFLGTALLPHQSKYKVNFMVSLDHSMWF 262
Query: 371 HRSFRADDWLLFVIVSPVASKARGFVSGEMFNTKGELLVSLTQEALLRSPKPK 423
H FRAD W+L+ SP A +RG V G ++ G L V+ QE ++RS KP+
Sbjct: 263 HAPFRADHWMLYECESPWAGGSRGLVHGRLWRRDGVLAVTCAQEGVIRS-KPR 314
|
Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. Major thioesterase in peroxisomes. Competes with BAAT (Bile acid CoA: amino acid N-acyltransferase) for bile acid-CoA (chenodeoxycholoyl-CoA) substrate. Shows a preference for medium-length fatty acyl-CoAs. May be involved in the metabolic regulation of peroxisome proliferation. Rattus norvegicus (taxid: 10116) EC: 3EC: .EC: 1EC: .EC: 2EC: .EC: 2EC: 7 |
| >sp|P58137|ACOT8_MOUSE Acyl-coenzyme A thioesterase 8 OS=Mus musculus GN=Acot8 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O14734|ACOT8_HUMAN Acyl-coenzyme A thioesterase 8 OS=Homo sapiens GN=ACOT8 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P0AGG2|TESB_ECOLI Acyl-CoA thioesterase 2 OS=Escherichia coli (strain K12) GN=tesB PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P0AGG3|TESB_ECO57 Acyl-CoA thioesterase 2 OS=Escherichia coli O157:H7 GN=tesB PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|P44498|TESB_HAEIN Acyl-CoA thioesterase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=tesB PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P41903|PTE1_YEAST Peroxisomal acyl-coenzyme A thioester hydrolase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TES1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P0C605|KGP1_MOUSE cGMP-dependent protein kinase 1 OS=Mus musculus GN=Prkg1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P00516|KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus GN=PRKG1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q13976|KGP1_HUMAN cGMP-dependent protein kinase 1 OS=Homo sapiens GN=PRKG1 PE=1 SV=3 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 430 | ||||||
| 255541574 | 429 | acyl-CoA thioesterase, putative [Ricinus | 0.995 | 0.997 | 0.767 | 0.0 | |
| 225454216 | 429 | PREDICTED: acyl-coenzyme A thioesterase | 0.995 | 0.997 | 0.751 | 0.0 | |
| 449432156 | 426 | PREDICTED: acyl-coenzyme A thioesterase | 0.988 | 0.997 | 0.735 | 0.0 | |
| 312282201 | 431 | unnamed protein product [Thellungiella h | 0.990 | 0.988 | 0.740 | 0.0 | |
| 224130260 | 415 | predicted protein [Populus trichocarpa] | 0.965 | 1.0 | 0.736 | 0.0 | |
| 297848334 | 427 | acyl-CoA thioesterase family protein [Ar | 0.990 | 0.997 | 0.719 | 0.0 | |
| 30678177 | 427 | palmitoyl-CoA hydrolase [Arabidopsis tha | 0.990 | 0.997 | 0.705 | 0.0 | |
| 26449786 | 427 | putative acyl CoA thioesterase [Arabidop | 0.990 | 0.997 | 0.705 | 0.0 | |
| 356568384 | 429 | PREDICTED: acyl-coenzyme A thioesterase | 0.967 | 0.969 | 0.715 | 1e-180 | |
| 356532008 | 429 | PREDICTED: acyl-coenzyme A thioesterase | 0.967 | 0.969 | 0.712 | 1e-179 |
| >gi|255541574|ref|XP_002511851.1| acyl-CoA thioesterase, putative [Ricinus communis] gi|223549031|gb|EEF50520.1| acyl-CoA thioesterase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 689 bits (1777), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 331/431 (76%), Positives = 373/431 (86%), Gaps = 3/431 (0%)
Query: 1 MDPDEVIEFLSCVPLLQRLPGSSLKRIADIVIVKRYGKGEYVVRDGDIGEGIYFIWEGEA 60
MD + VIEFL VPLLQRLP SSLK+I+ +V VK Y KGE+VVR+G+I EG+YFIWEGEA
Sbjct: 1 MDCESVIEFLGGVPLLQRLPSSSLKKISQLVKVKFYEKGEHVVREGEIAEGVYFIWEGEA 60
Query: 61 EVSVSDSVQAEEEDRPEFQLKRYDYFGHGSPTIFRQGDVIALTELTCLVLPHEHCNWLET 120
EVS SV AE++ RPEFQLKRYDYFG G +Q DVIALT+LTCLVLPHEHC L
Sbjct: 61 EVS--GSVHAEDDARPEFQLKRYDYFGDGVIASVQQADVIALTKLTCLVLPHEHCALLVP 118
Query: 121 KSIWSADKTVGTCSLVENILHLEPVEVNIFQGITLPDAPKFGKVFGGQLVGQALAAASKT 180
KS+WSADKT +C+LVE+ILHL P+EVNIFQGITLPDAPKFGKVFGGQ VGQALAAASKT
Sbjct: 119 KSMWSADKTPDSCTLVESILHLHPIEVNIFQGITLPDAPKFGKVFGGQFVGQALAAASKT 178
Query: 181 VDCLKIVHSLHCYFLLVGDLNIPIIYQVHRVRDGNSFATRRVDAIQKGNIIFTLLASFQK 240
VDCLKIVHSLHCYFLLVGD N+PI+Y+V RVRDG SFATRRV+AIQKGN++F L+ASFQK
Sbjct: 179 VDCLKIVHSLHCYFLLVGDFNMPILYEVERVRDGKSFATRRVNAIQKGNVVFILIASFQK 238
Query: 241 EEQGFEHQETTMPLVPAPEMLLSMEELRERRLTDPRLPRSYRNKVASKEFVPWPIDIRFC 300
EEQGFEHQE TMP VP PEMLLSMEELRERRLTDPRLPR+YRNKVA+K+FVPWPI+IRFC
Sbjct: 239 EEQGFEHQEVTMPNVPEPEMLLSMEELRERRLTDPRLPRTYRNKVAAKDFVPWPIEIRFC 298
Query: 301 EPNSYTNQSKSPPSLRYWFRAKGKLSDDQALHRCVVAFASDLIFSSVSLNPHRRKGFRTA 360
EPN+ TNQ+KSPPSLR+WFRA+GKLSDDQALHRCV A++SDLIF VS+NPHR K +TA
Sbjct: 299 EPNTNTNQTKSPPSLRFWFRARGKLSDDQALHRCVAAYSSDLIFLQVSMNPHRTKDLKTA 358
Query: 361 SLSLDHSMWFHRSFRADDWLLFVIVSPVASKARGFVSGEMFNTKGELLVSLTQEALLR-S 419
++SLDHSMWFHR FRADDW+LFVI SP AS ARGFVSG+MF+ KGE +VSLTQE LLR S
Sbjct: 359 NVSLDHSMWFHRPFRADDWILFVITSPAASHARGFVSGQMFSRKGEHIVSLTQEGLLRKS 418
Query: 420 PKPKPIPVSKL 430
P P SKL
Sbjct: 419 FNPIPAAASKL 429
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225454216|ref|XP_002273474.1| PREDICTED: acyl-coenzyme A thioesterase 8 [Vitis vinifera] gi|297745281|emb|CBI40361.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449432156|ref|XP_004133866.1| PREDICTED: acyl-coenzyme A thioesterase 8-like [Cucumis sativus] gi|449480188|ref|XP_004155824.1| PREDICTED: acyl-coenzyme A thioesterase 8-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|312282201|dbj|BAJ33966.1| unnamed protein product [Thellungiella halophila] | Back alignment and taxonomy information |
|---|
| >gi|224130260|ref|XP_002320791.1| predicted protein [Populus trichocarpa] gi|222861564|gb|EEE99106.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297848334|ref|XP_002892048.1| acyl-CoA thioesterase family protein [Arabidopsis lyrata subsp. lyrata] gi|297337890|gb|EFH68307.1| acyl-CoA thioesterase family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|30678177|ref|NP_563632.2| palmitoyl-CoA hydrolase [Arabidopsis thaliana] gi|332189204|gb|AEE27325.1| palmitoyl-CoA hydrolase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|26449786|dbj|BAC42016.1| putative acyl CoA thioesterase [Arabidopsis thaliana] gi|28950989|gb|AAO63418.1| At1g01710 [Arabidopsis thaliana] gi|38489920|gb|AAR21571.1| acyl-CoA thioesterase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356568384|ref|XP_003552391.1| PREDICTED: acyl-coenzyme A thioesterase 8-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356532008|ref|XP_003534566.1| PREDICTED: acyl-coenzyme A thioesterase 8-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 430 | ||||||
| TAIR|locus:2198205 | 427 | AT1G01710 [Arabidopsis thalian | 0.990 | 0.997 | 0.658 | 6.5e-154 | |
| TAIR|locus:2127078 | 425 | AT4G00520 [Arabidopsis thalian | 0.955 | 0.967 | 0.603 | 7.1e-132 | |
| UNIPROTKB|F6RWU6 | 317 | ACOT8 "Uncharacterized protein | 0.658 | 0.892 | 0.373 | 6.2e-46 | |
| TIGR_CMR|CPS_4827 | 285 | CPS_4827 "acyl-CoA thioesteras | 0.625 | 0.943 | 0.369 | 7.9e-46 | |
| UNIPROTKB|E2RN52 | 317 | ACOT8 "Uncharacterized protein | 0.658 | 0.892 | 0.369 | 2.7e-45 | |
| RGD|70368 | 320 | Acot8 "acyl-CoA thioesterase 8 | 0.672 | 0.903 | 0.365 | 4.4e-45 | |
| MGI|MGI:2158201 | 320 | Acot8 "acyl-CoA thioesterase 8 | 0.672 | 0.903 | 0.368 | 5.6e-45 | |
| UNIPROTKB|F1SC76 | 317 | ACOT8 "Uncharacterized protein | 0.672 | 0.911 | 0.368 | 1.5e-44 | |
| UNIPROTKB|J9NXP6 | 320 | ACOT8 "Uncharacterized protein | 0.658 | 0.884 | 0.366 | 3.9e-44 | |
| UNIPROTKB|O14734 | 319 | ACOT8 "Acyl-coenzyme A thioest | 0.665 | 0.896 | 0.363 | 3.9e-44 |
| TAIR|locus:2198205 AT1G01710 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1501 (533.4 bits), Expect = 6.5e-154, P = 6.5e-154
Identities = 284/431 (65%), Positives = 339/431 (78%)
Query: 1 MDPDEVIEFLSCVPLLQRLPGSSLKRIADIVIVKRYGKGEYVVRDGDIGEGIYFIWEGEA 60
M+ + V+EFL VPLLQ+LP SSLK+IA +V+ KRYGKG+YVVR+ +G YFI +GEA
Sbjct: 1 MNTESVVEFLGNVPLLQKLPSSSLKKIAQVVVPKRYGKGDYVVREDQTWDGCYFILQGEA 60
Query: 61 EVSVSDSVQAEEEDRPEFQLKRYDYFGHGSPTIFRQGDVIALTELTCLVLPHEHCNWLET 120
+VS D EE++R EF LK+YDYFG G D++A+++LTCLVLP +HC+ LET
Sbjct: 61 QVSGPD----EEDNRSEFLLKQYDYFGVGLSGNVHSADIVAMSQLTCLVLPRDHCHLLET 116
Query: 121 KSIWSADKTVGTCSLVENILHLEPVEVNIFQGITLPDAPKFGKVFXXXXXXXXXXXXSKT 180
SIW +D ++ CSLVE IL L+P+E+NIF+GITLPDAP FGKVF SKT
Sbjct: 117 NSIWQSDTSLDKCSLVERILQLDPLELNIFRGITLPDAPIFGKVFGGQFVGQALAAASKT 176
Query: 181 VDCLKIVHSLHCYFLLVGDLNIPIIYQVHRVRDGNSFATRRVDAIQKGNIIFTLLASFQK 240
VD LK+VHSLH YFLLVGD++IPIIYQVHR+RDGN+FATRRVDA+QKGNIIF LLASFQK
Sbjct: 177 VDFLKVVHSLHSYFLLVGDIDIPIIYQVHRIRDGNNFATRRVDAVQKGNIIFILLASFQK 236
Query: 241 EEQGFEHQETTMPLVPAPXXXXXXXXXXXXXXTDPRLPRSYRNKVASKEFVPWPIDIRFC 300
E+QGFEHQE+TMP VP P TDP LPRSYRNKVA++ FVPWPI+IRFC
Sbjct: 237 EQQGFEHQESTMPSVPDPDTLLSLEELRESRITDPHLPRSYRNKVATRNFVPWPIEIRFC 296
Query: 301 EPNSYTNQSKSPPSLRYWFRAKGKLSDDQALHRCVVAFASDLIFSSVSLNPHRRKGFRTA 360
EP++ TNQ+KSPP L YWFRAKG+LSDDQALHRCVVAFASDLIF V LNPHRRKG ++A
Sbjct: 297 EPSNSTNQTKSPPRLNYWFRAKGRLSDDQALHRCVVAFASDLIFCGVGLNPHRRKGVKSA 356
Query: 361 SLSLDHSMWFHRSFRADDWLLFVIVSPVASKARGFVSGEMFNTKGELLVSLTQEALLRSP 420
+LSLDH+MWFHR RAD+WLL+VIVSP A + RGFV+G+MFN KGEL+VSLTQEALLR
Sbjct: 357 ALSLDHAMWFHRPLRADEWLLYVIVSPTAHETRGFVTGQMFNRKGELVVSLTQEALLREA 416
Query: 421 KP-KPIPVSKL 430
+P KP SKL
Sbjct: 417 RPPKPSGTSKL 427
|
|
| TAIR|locus:2127078 AT4G00520 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6RWU6 ACOT8 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_4827 CPS_4827 "acyl-CoA thioesterase II" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RN52 ACOT8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|70368 Acot8 "acyl-CoA thioesterase 8" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2158201 Acot8 "acyl-CoA thioesterase 8" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SC76 ACOT8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NXP6 ACOT8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O14734 ACOT8 "Acyl-coenzyme A thioesterase 8" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.1.2 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
|||
 | grail3.0035017001 | acyl-CoA thioesterase family protein (EC-3.1.2.2) (416 aa) | |||||||||
(Populus trichocarpa) | |||||||||||
 | eugene3.00140447 | • | 0.529 | ||||||||
 | eugene3.111350001 | • | 0.515 | ||||||||
 | estExt_Genewise1_v1.C_LG_IX4777 | • | • | 0.493 | |||||||
 | fgenesh4_pg.C_scaffold_620000002 | • | 0.422 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 430 | |||
| PLN02868 | 413 | PLN02868, PLN02868, acyl-CoA thioesterase family p | 0.0 | |
| TIGR00189 | 271 | TIGR00189, tesB, acyl-CoA thioesterase II | 1e-110 | |
| COG1946 | 289 | COG1946, TesB, Acyl-CoA thioesterase [Lipid metabo | 6e-94 | |
| PRK10526 | 286 | PRK10526, PRK10526, acyl-CoA thioesterase II; Prov | 1e-80 | |
| cd03445 | 94 | cd03445, Thioesterase_II_repeat2, Thioesterase II | 2e-40 | |
| cd03444 | 104 | cd03444, Thioesterase_II_repeat1, Thioesterase II | 8e-40 | |
| cd00556 | 99 | cd00556, Thioesterase_II, Thioesterase II (TEII) i | 1e-27 | |
| pfam13622 | 200 | pfam13622, 4HBT_3, Thioesterase-like superfamily | 3e-23 | |
| cd00556 | 99 | cd00556, Thioesterase_II, Thioesterase II (TEII) i | 1e-22 | |
| pfam02551 | 130 | pfam02551, Acyl_CoA_thio, Acyl-CoA thioesterase | 5e-20 | |
| cd00038 | 115 | cd00038, CAP_ED, effector domain of the CAP family | 9e-13 | |
| pfam00027 | 91 | pfam00027, cNMP_binding, Cyclic nucleotide-binding | 2e-10 | |
| smart00100 | 120 | smart00100, cNMP, Cyclic nucleotide-monophosphate | 4e-09 | |
| COG0664 | 214 | COG0664, Crp, cAMP-binding proteins - catabolite g | 7e-06 | |
| cd03440 | 100 | cd03440, hot_dog, The hotdog fold was initially id | 4e-04 | |
| COG2905 | 610 | COG2905, COG2905, Predicted signal-transduction pr | 0.002 | |
| cd03440 | 100 | cd03440, hot_dog, The hotdog fold was initially id | 0.003 |
| >gnl|CDD|178459 PLN02868, PLN02868, acyl-CoA thioesterase family protein | Back alignment and domain information |
|---|
Score = 771 bits (1992), Expect = 0.0
Identities = 320/417 (76%), Positives = 358/417 (85%), Gaps = 4/417 (0%)
Query: 1 MDPDEVIEFLSCVPLLQRLPGSSLKRIADIVIVKRYGKGEYVVRDGDIGEGIYFIWEGEA 60
M+ + V+EFL VPLLQRLP SSLK+IA++V+ KRYGKGEYVVR+G+ G+G+YFIW+GEA
Sbjct: 1 MNTESVVEFLGSVPLLQRLPSSSLKKIAEVVVPKRYGKGEYVVREGEPGDGLYFIWKGEA 60
Query: 61 EVSVSDSVQAEEEDRPEFQLKRYDYFGHGSPTIFRQGDVIALTELTCLVLPHEHCNWLET 120
EVS AEEE RPEF LKRYDYFG+G DV+A++ELTCLVLPHEHC+ L
Sbjct: 61 EVSGP----AEEESRPEFLLKRYDYFGYGLSGSVHSADVVAVSELTCLVLPHEHCHLLSP 116
Query: 121 KSIWSADKTVGTCSLVENILHLEPVEVNIFQGITLPDAPKFGKVFGGQLVGQALAAASKT 180
KSIW +DKT CSLVE ILHLEP+EV+IF+GITLPDAP FGKVFGGQLVGQALAAASKT
Sbjct: 117 KSIWDSDKTPKDCSLVERILHLEPLEVDIFRGITLPDAPTFGKVFGGQLVGQALAAASKT 176
Query: 181 VDCLKIVHSLHCYFLLVGDLNIPIIYQVHRVRDGNSFATRRVDAIQKGNIIFTLLASFQK 240
VD LK+VHSLH YFLLVGD+N+PIIYQV R+RDG++FATRRVDAIQKG +IFTL ASFQK
Sbjct: 177 VDPLKLVHSLHAYFLLVGDINLPIIYQVERIRDGHNFATRRVDAIQKGKVIFTLFASFQK 236
Query: 241 EEQGFEHQETTMPLVPAPEMLLSMEELRERRLTDPRLPRSYRNKVASKEFVPWPIDIRFC 300
EEQGFEHQE+TMP VP PE LLS EELRERRLTDPRLPRSYRNKVA+K FVPWPI+IRFC
Sbjct: 237 EEQGFEHQESTMPHVPPPETLLSREELRERRLTDPRLPRSYRNKVAAKPFVPWPIEIRFC 296
Query: 301 EPNSYTNQSKSPPSLRYWFRAKGKLSDDQALHRCVVAFASDLIFSSVSLNPHRRKGFRTA 360
EPN+ TNQ+KSPP LRYWFRAKGKLSDDQALHRCV A+ASDLIF SLNPHR KG + A
Sbjct: 297 EPNNSTNQTKSPPRLRYWFRAKGKLSDDQALHRCVAAYASDLIFLGTSLNPHRTKGLKFA 356
Query: 361 SLSLDHSMWFHRSFRADDWLLFVIVSPVASKARGFVSGEMFNTKGELLVSLTQEALL 417
+LSLDHSMWFHR FRADDWLLFVIVSP A RGF +G MFN KGEL+VSLTQEALL
Sbjct: 357 ALSLDHSMWFHRPFRADDWLLFVIVSPAAHNGRGFATGHMFNRKGELVVSLTQEALL 413
|
Length = 413 |
| >gnl|CDD|232865 TIGR00189, tesB, acyl-CoA thioesterase II | Back alignment and domain information |
|---|
| >gnl|CDD|224857 COG1946, TesB, Acyl-CoA thioesterase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182519 PRK10526, PRK10526, acyl-CoA thioesterase II; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239529 cd03445, Thioesterase_II_repeat2, Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively | Back alignment and domain information |
|---|
| >gnl|CDD|239528 cd03444, Thioesterase_II_repeat1, Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively | Back alignment and domain information |
|---|
| >gnl|CDD|238311 cd00556, Thioesterase_II, Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively | Back alignment and domain information |
|---|
| >gnl|CDD|222270 pfam13622, 4HBT_3, Thioesterase-like superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238311 cd00556, Thioesterase_II, Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively | Back alignment and domain information |
|---|
| >gnl|CDD|217099 pfam02551, Acyl_CoA_thio, Acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor | Back alignment and domain information |
|---|
| >gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|223736 COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|239524 cd03440, hot_dog, The hotdog fold was initially identified in the E | Back alignment and domain information |
|---|
| >gnl|CDD|225457 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|239524 cd03440, hot_dog, The hotdog fold was initially identified in the E | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 430 | |||
| PLN02868 | 413 | acyl-CoA thioesterase family protein | 100.0 | |
| COG1946 | 289 | TesB Acyl-CoA thioesterase [Lipid metabolism] | 100.0 | |
| PRK10526 | 286 | acyl-CoA thioesterase II; Provisional | 100.0 | |
| KOG3016 | 294 | consensus Acyl-CoA thioesterase [Lipid transport a | 100.0 | |
| TIGR00189 | 271 | tesB acyl-CoA thioesterase II. Subunit: homotetram | 100.0 | |
| PF13622 | 255 | 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A | 100.0 | |
| PF02551 | 131 | Acyl_CoA_thio: Acyl-CoA thioesterase; InterPro: IP | 99.95 | |
| cd03444 | 104 | Thioesterase_II_repeat1 Thioesterase II (TEII) is | 99.92 | |
| cd03445 | 94 | Thioesterase_II_repeat2 Thioesterase II (TEII) is | 99.89 | |
| cd00556 | 99 | Thioesterase_II Thioesterase II (TEII) is thought | 99.58 | |
| PRK09392 | 236 | ftrB transcriptional activator FtrB; Provisional | 99.55 | |
| cd00038 | 115 | CAP_ED effector domain of the CAP family of transc | 99.45 | |
| PRK11753 | 211 | DNA-binding transcriptional dual regulator Crp; Pr | 99.44 | |
| KOG1113 | 368 | consensus cAMP-dependent protein kinase types I an | 99.41 | |
| PRK11161 | 235 | fumarate/nitrate reduction transcriptional regulat | 99.4 | |
| KOG0614 | 732 | consensus cGMP-dependent protein kinase [Signal tr | 99.38 | |
| smart00100 | 120 | cNMP Cyclic nucleotide-monophosphate binding domai | 99.36 | |
| PRK10402 | 226 | DNA-binding transcriptional activator YeiL; Provis | 99.35 | |
| COG0664 | 214 | Crp cAMP-binding proteins - catabolite gene activa | 99.34 | |
| PF00027 | 91 | cNMP_binding: Cyclic nucleotide-binding domain; In | 99.34 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.28 | |
| KOG0498 | 727 | consensus K+-channel ERG and related proteins, con | 99.24 | |
| PRK13918 | 202 | CRP/FNR family transcriptional regulator; Provisio | 99.23 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 99.23 | |
| KOG0614 | 732 | consensus cGMP-dependent protein kinase [Signal tr | 99.13 | |
| PRK09391 | 230 | fixK transcriptional regulator FixK; Provisional | 99.13 | |
| cd00556 | 99 | Thioesterase_II Thioesterase II (TEII) is thought | 99.12 | |
| KOG0500 | 536 | consensus Cyclic nucleotide-gated cation channel C | 99.01 | |
| TIGR03697 | 193 | NtcA_cyano global nitrogen regulator NtcA, cyanoba | 99.0 | |
| KOG1113 | 368 | consensus cAMP-dependent protein kinase types I an | 98.98 | |
| KOG0499 | 815 | consensus Cyclic nucleotide-gated cation channel C | 98.85 | |
| KOG0501 | 971 | consensus K+-channel KCNQ [Inorganic ion transport | 98.29 | |
| cd03443 | 113 | PaaI_thioesterase PaaI_thioesterase is a tetrameri | 98.04 | |
| TIGR02286 | 114 | PaaD phenylacetic acid degradation protein PaaD. S | 98.02 | |
| KOG2968 | 1158 | consensus Predicted esterase of the alpha-beta hyd | 97.98 | |
| PRK10254 | 137 | thioesterase; Provisional | 97.87 | |
| PLN02322 | 154 | acyl-CoA thioesterase | 97.82 | |
| TIGR00369 | 117 | unchar_dom_1 uncharacterized domain 1. Most protei | 97.79 | |
| COG2050 | 141 | PaaI HGG motif-containing thioesterase, possibly i | 97.77 | |
| PRK10293 | 136 | acyl-CoA esterase; Provisional | 97.74 | |
| TIGR02447 | 138 | yiiD_Cterm thioesterase domain, putative. This fam | 97.62 | |
| PRK11688 | 154 | hypothetical protein; Provisional | 97.54 | |
| PRK04424 | 185 | fatty acid biosynthesis transcriptional regulator; | 97.44 | |
| TIGR00369 | 117 | unchar_dom_1 uncharacterized domain 1. Most protei | 97.39 | |
| PF04831 | 153 | Popeye: Popeye protein conserved region; InterPro: | 97.36 | |
| PF03061 | 79 | 4HBT: Thioesterase superfamily; InterPro: IPR00668 | 97.3 | |
| PF02551 | 131 | Acyl_CoA_thio: Acyl-CoA thioesterase; InterPro: IP | 97.24 | |
| PRK11688 | 154 | hypothetical protein; Provisional | 97.18 | |
| KOG2968 | 1158 | consensus Predicted esterase of the alpha-beta hyd | 97.12 | |
| TIGR02286 | 114 | PaaD phenylacetic acid degradation protein PaaD. S | 97.11 | |
| PRK11832 | 207 | putative DNA-binding transcriptional regulator; Pr | 97.11 | |
| PRK10254 | 137 | thioesterase; Provisional | 96.94 | |
| PRK10694 | 133 | acyl-CoA esterase; Provisional | 96.88 | |
| PRK10293 | 136 | acyl-CoA esterase; Provisional | 96.8 | |
| cd03442 | 123 | BFIT_BACH Brown fat-inducible thioesterase (BFIT). | 96.79 | |
| cd03440 | 100 | hot_dog The hotdog fold was initially identified i | 96.69 | |
| KOG3542 | 1283 | consensus cAMP-regulated guanine nucleotide exchan | 96.66 | |
| cd03443 | 113 | PaaI_thioesterase PaaI_thioesterase is a tetrameri | 96.61 | |
| PLN02322 | 154 | acyl-CoA thioesterase | 96.49 | |
| cd03440 | 100 | hot_dog The hotdog fold was initially identified i | 96.48 | |
| KOG3328 | 148 | consensus HGG motif-containing thioesterase [Gener | 96.43 | |
| PF03061 | 79 | 4HBT: Thioesterase superfamily; InterPro: IPR00668 | 96.21 | |
| COG1607 | 157 | Acyl-CoA hydrolase [Lipid metabolism] | 96.07 | |
| cd01288 | 131 | FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier | 95.77 | |
| PRK00006 | 147 | fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Review | 95.63 | |
| KOG3328 | 148 | consensus HGG motif-containing thioesterase [Gener | 95.58 | |
| cd03455 | 123 | SAV4209 SAV4209 is a Streptomyces avermitilis prot | 95.58 | |
| TIGR01750 | 140 | fabZ beta-hydroxyacyl-[acyl carrier protein] dehyd | 95.56 | |
| COG2050 | 141 | PaaI HGG motif-containing thioesterase, possibly i | 95.38 | |
| cd00586 | 110 | 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Cat | 95.31 | |
| KOG3542 | 1283 | consensus cAMP-regulated guanine nucleotide exchan | 95.0 | |
| cd03453 | 127 | SAV4209_like SAV4209_like. Similar in sequence to | 94.85 | |
| PF03756 | 132 | AfsA: A-factor biosynthesis hotdog domain; InterPr | 94.47 | |
| cd00493 | 131 | FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier pr | 94.25 | |
| cd03449 | 128 | R_hydratase (R)-hydratase [(R)-specific enoyl-CoA | 93.89 | |
| cd03441 | 127 | R_hydratase_like (R)-hydratase [(R)-specific enoyl | 93.39 | |
| cd03451 | 146 | FkbR2 FkbR2 is a Streptomyces hygroscopicus protei | 93.05 | |
| cd03446 | 140 | MaoC_like MoaC_like Similar to the MaoC (monoamine | 92.96 | |
| cd00586 | 110 | 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Cat | 92.72 | |
| cd03442 | 123 | BFIT_BACH Brown fat-inducible thioesterase (BFIT). | 92.48 | |
| cd03447 | 126 | FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of t | 92.39 | |
| PRK10800 | 130 | acyl-CoA thioesterase YbgC; Provisional | 92.29 | |
| PRK13693 | 142 | (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Pro | 92.25 | |
| PLN02647 | 437 | acyl-CoA thioesterase | 91.93 | |
| TIGR02799 | 126 | thio_ybgC tol-pal system-associated acyl-CoA thioe | 91.55 | |
| COG0764 | 147 | FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl ca | 91.27 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 90.84 | |
| TIGR02447 | 138 | yiiD_Cterm thioesterase domain, putative. This fam | 90.54 | |
| PLN02647 | 437 | acyl-CoA thioesterase | 90.35 | |
| PRK13692 | 159 | (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Pro | 89.95 | |
| PRK13188 | 464 | bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetyl | 89.84 | |
| PRK08190 | 466 | bifunctional enoyl-CoA hydratase/phosphate acetylt | 88.9 | |
| PF13452 | 132 | MaoC_dehydrat_N: N-terminal half of MaoC dehydrata | 88.84 | |
| cd03448 | 122 | HDE_HSD HDE_HSD The R-hydratase-like hot dog fold | 88.31 | |
| PF07977 | 138 | FabA: FabA-like domain; InterPro: IPR013114 Fatty | 88.18 | |
| PF09500 | 144 | YiiD_Cterm: Putative thioesterase (yiiD_Cterm); In | 87.96 | |
| cd03451 | 146 | FkbR2 FkbR2 is a Streptomyces hygroscopicus protei | 86.91 | |
| cd03449 | 128 | R_hydratase (R)-hydratase [(R)-specific enoyl-CoA | 86.86 | |
| cd03454 | 140 | YdeM YdeM is a Bacillus subtilis protein that belo | 86.82 | |
| TIGR02799 | 126 | thio_ybgC tol-pal system-associated acyl-CoA thioe | 86.69 | |
| cd01287 | 150 | FabA FabA, beta-hydroxydecanoyl-acyl carrier prote | 85.85 | |
| PRK13691 | 166 | (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Pro | 85.54 | |
| cd01289 | 138 | FabA_like Domain of unknown function, appears to b | 85.15 | |
| COG0824 | 137 | FcbC Predicted thioesterase [General function pred | 84.9 | |
| PLN02864 | 310 | enoyl-CoA hydratase | 84.6 | |
| PRK13692 | 159 | (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Pro | 84.56 | |
| cd03452 | 142 | MaoC_C MaoC_C The C-terminal hot dog fold of the M | 84.32 | |
| PF01575 | 122 | MaoC_dehydratas: MaoC like domain; InterPro: IPR00 | 83.45 | |
| COG0824 | 137 | FcbC Predicted thioesterase [General function pred | 83.13 | |
| PF14539 | 132 | DUF4442: Domain of unknown function (DUF4442); PDB | 81.71 | |
| PRK05174 | 172 | 3-hydroxydecanoyl-(acyl carrier protein) dehydrata | 81.13 |
| >PLN02868 acyl-CoA thioesterase family protein | Back alignment and domain information |
|---|
Probab=100.00 E-value=1e-76 Score=584.58 Aligned_cols=413 Identities=77% Similarity=1.269 Sum_probs=370.8
Q ss_pred CChhHHHHHhcCCCCCCCCCHHHHHHHHhhceEEEecCCCEEEeCCCcCCeEEEEEeeEEEEEEecccccccCCcceEEe
Q 040957 1 MDPDEVIEFLSCVPLLQRLPGSSLKRIADIVIVKRYGKGEYVVRDGDIGEGIYFIWEGEAEVSVSDSVQAEEEDRPEFQL 80 (430)
Q Consensus 1 M~~~~~~~~l~~~~~f~~l~~~~~~~l~~~~~~~~~~~ge~i~~~g~~~~~ly~I~~G~v~~~~~~~~~~g~~~~~~~~~ 80 (430)
|+.+++.++|+++++|+.|+++++..|+..++.++|++|++|+++|+..+++|+|++|.++++ ..+.+| + .++..+
T Consensus 1 ~~~~~~~~~L~~~~~F~~L~~~~l~~l~~~~~~~~~~~Ge~I~~~Gd~~~~lyiI~~G~V~v~--~~~~~g-e-~~l~~l 76 (413)
T PLN02868 1 MNTESVVEFLGSVPLLQRLPSSSLKKIAEVVVPKRYGKGEYVVREGEPGDGLYFIWKGEAEVS--GPAEEE-S-RPEFLL 76 (413)
T ss_pred CCHHHHHHHHhcCcccccCCHHHHHHHHHhceEEEECCCCEEEeCCCcCceEEEEEeCEEEEE--EECCCC-c-EEEEEe
Confidence 788899999999999999999999999999999999999999999999999999999999999 665555 4 788999
Q ss_pred ccCCeeccCCCCCcceeeEEEecceEEEEeccccccccccccccccccccCcccchhhhcccCccccceeecccCCCCCC
Q 040957 81 KRYDYFGHGSPTIFRQGDVIALTELTCLVLPHEHCNWLETKSIWSADKTVGTCSLVENILHLEPVEVNIFQGITLPDAPK 160 (430)
Q Consensus 81 ~~G~~fGe~~~~~~~~~~v~A~~~~~~l~i~~~~f~~l~~~~~~~~~~~~~~~~~l~~~l~l~~~~~~~f~~~~~~~~~~ 160 (430)
++|++||+.+.+.++.++++|.++|+++.|+++.|..+...++|.+++....++.+++.++++++++++|++...+.|++
T Consensus 77 ~~Gd~fG~~l~~~~~~~~~~A~~d~~v~~ip~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~f~~~~~~~~~~ 156 (413)
T PLN02868 77 KRYDYFGYGLSGSVHSADVVAVSELTCLVLPHEHCHLLSPKSIWDSDKTPKDCSLVERILHLEPLEVDIFRGITLPDAPT 156 (413)
T ss_pred CCCCEeehhhCCCCcccEEEECCCEEEEEEcHHHHhhhcccccccccCChhhHHHHHhhcCcEeccCCeEECCcCCCCcc
Confidence 99999997677788999999999999999999999999999999999999999999999999999999999999988877
Q ss_pred CceeehhHHHHHHHHHHhccCCCCCcceeeeeeeccCcCCCCCeEEEEEEeeeCCCeeEEEEEEEECCeeEEEEEEeccc
Q 040957 161 FGKVFGGQLVGQALAAASKTVDCLKIVHSLHCYFLLVGDLNIPIIYQVHRVRDGNSFATRRVDAIQKGNIIFTLLASFQK 240 (430)
Q Consensus 161 ~~~~~GG~~~a~al~Aa~~~~~~~~~~~s~~~~Fl~~~~~~~pi~~~V~~lr~Gr~~s~~~V~~~Q~g~~~~~~~~sf~~ 240 (430)
++++|||+++|||+.||.+++++++.|||+|+||+++++++.|++|+|++||+||||++|+|+++|+|+++++++++|++
T Consensus 157 ~~~~fGG~~~aqal~Aa~~~~~~~~~~~s~~~~Fl~~~~~~~pv~~~V~~lr~Grs~~~r~v~~~Q~g~~~~~~~~sf~~ 236 (413)
T PLN02868 157 FGKVFGGQLVGQALAAASKTVDPLKLVHSLHAYFLLVGDINLPIIYQVERIRDGHNFATRRVDAIQKGKVIFTLFASFQK 236 (413)
T ss_pred cccccchHHHHHHHHHHHccCCCCCCceEeeeeecCCCCCCCCEEEEEEEEcCCCceEeeEEEEEECCeeEEEEeecccc
Confidence 78999999999999999999998999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCCcccCccCCCCCCCCCCCCCHHHHHHhhcCCCCCchhhHhhhhccCCCCCCeEEEEcCCCCCCCCCCCCCeeEEEEe
Q 040957 241 EEQGFEHQETTMPLVPAPEMLLSMEELRERRLTDPRLPRSYRNKVASKEFVPWPIDIRFCEPNSYTNQSKSPPSLRYWFR 320 (430)
Q Consensus 241 ~~~~~~~~~~~~p~~p~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~r~~~~~~~~~~~~~~~~~~~W~R 320 (430)
.++++.|+..++|++|+||+|+...+.......++.++..+.+.+....+..++||+|++++..+.......++.+.|+|
T Consensus 237 ~~~~~~~~~~~~p~~p~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~r~~~~~~~~~~~~~~~~~~~W~R 316 (413)
T PLN02868 237 EEQGFEHQESTMPHVPPPETLLSREELRERRLTDPRLPRSYRNKVAAKPFVPWPIEIRFCEPNNSTNQTKSPPRLRYWFR 316 (413)
T ss_pred CCCCcccccCCCCCCcCcccCcCHHHHHHhhccccccCHHHHHHhhhcccCCCCCEEEEcCCccccCCCCCCceEEEEEE
Confidence 98888888877899999999988777655443333344433332221223345799999998766654444577889999
Q ss_pred cCCCCCCChHHHHHHHHHHhhhhhhhhhcccCccCCCcceeeecceeeeccCCCCCCCeEEeEEeecceeCCeeeEEEEE
Q 040957 321 AKGKLSDDQALHRCVVAFASDLIFSSVSLNPHRRKGFRTASLSLDHSMWFHRSFRADDWLLFVIVSPVASKARGFVSGEM 400 (430)
Q Consensus 321 ~~~~~~~~~~~~~~~la~~sD~~~~~~~~~~~~~~~~~~~~~sld~si~f~~~~~~~~W~l~~~~~~~~~~gr~~~~~~i 400 (430)
.++++++|+.+|.++|||+||.+++.++++||.....+...+||||+||||++++.++|++++++++++++||++++|+|
T Consensus 317 ~~~~~~~d~~~~~a~lay~sD~~~l~~~l~~~~~~~~~~~~aSLdhsi~Fh~~~~~d~W~l~~~~s~~a~~gr~~~~g~l 396 (413)
T PLN02868 317 AKGKLSDDQALHRCVAAYASDLIFLGTSLNPHRTKGLKFAALSLDHSMWFHRPFRADDWLLFVIVSPAAHNGRGFATGHM 396 (413)
T ss_pred ECCCCCCCHHHHHHHHHHHhhhhhhHhhhccccCCCCceEEEEcceeEEEecCCCCCceEEEEEECCccCCCcceEEEEE
Confidence 99999999999999999999999999999998664444568999999999999999999999999999999999999999
Q ss_pred EccCCCEEEEEecccee
Q 040957 401 FNTKGELLVSLTQEALL 417 (430)
Q Consensus 401 ~~~~G~lvA~~~Q~~l~ 417 (430)
||++|+||||++||||+
T Consensus 397 ~~~~G~LvAs~~Qe~l~ 413 (413)
T PLN02868 397 FNRKGELVVSLTQEALL 413 (413)
T ss_pred ECCCCCEEEEEEeeecC
Confidence 99999999999999986
|
|
| >COG1946 TesB Acyl-CoA thioesterase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK10526 acyl-CoA thioesterase II; Provisional | Back alignment and domain information |
|---|
| >KOG3016 consensus Acyl-CoA thioesterase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00189 tesB acyl-CoA thioesterase II | Back alignment and domain information |
|---|
| >PF13622 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 3RQB_A 3CJY_A 3RD7_A 3BBJ_B | Back alignment and domain information |
|---|
| >PF02551 Acyl_CoA_thio: Acyl-CoA thioesterase; InterPro: IPR003703 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH) | Back alignment and domain information |
|---|
| >cd03444 Thioesterase_II_repeat1 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively | Back alignment and domain information |
|---|
| >cd03445 Thioesterase_II_repeat2 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively | Back alignment and domain information |
|---|
| >cd00556 Thioesterase_II Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively | Back alignment and domain information |
|---|
| >PRK09392 ftrB transcriptional activator FtrB; Provisional | Back alignment and domain information |
|---|
| >cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor | Back alignment and domain information |
|---|
| >PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional | Back alignment and domain information |
|---|
| >KOG1113 consensus cAMP-dependent protein kinase types I and II, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00100 cNMP Cyclic nucleotide-monophosphate binding domain | Back alignment and domain information |
|---|
| >PRK10402 DNA-binding transcriptional activator YeiL; Provisional | Back alignment and domain information |
|---|
| >COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13918 CRP/FNR family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09391 fixK transcriptional regulator FixK; Provisional | Back alignment and domain information |
|---|
| >cd00556 Thioesterase_II Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively | Back alignment and domain information |
|---|
| >KOG0500 consensus Cyclic nucleotide-gated cation channel CNGA1-3 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial | Back alignment and domain information |
|---|
| >KOG1113 consensus cAMP-dependent protein kinase types I and II, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria | Back alignment and domain information |
|---|
| >TIGR02286 PaaD phenylacetic acid degradation protein PaaD | Back alignment and domain information |
|---|
| >KOG2968 consensus Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10254 thioesterase; Provisional | Back alignment and domain information |
|---|
| >PLN02322 acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >TIGR00369 unchar_dom_1 uncharacterized domain 1 | Back alignment and domain information |
|---|
| >COG2050 PaaI HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK10293 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >TIGR02447 yiiD_Cterm thioesterase domain, putative | Back alignment and domain information |
|---|
| >PRK11688 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR00369 unchar_dom_1 uncharacterized domain 1 | Back alignment and domain information |
|---|
| >PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle | Back alignment and domain information |
|---|
| >PF03061 4HBT: Thioesterase superfamily; InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases | Back alignment and domain information |
|---|
| >PF02551 Acyl_CoA_thio: Acyl-CoA thioesterase; InterPro: IPR003703 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH) | Back alignment and domain information |
|---|
| >PRK11688 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2968 consensus Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02286 PaaD phenylacetic acid degradation protein PaaD | Back alignment and domain information |
|---|
| >PRK11832 putative DNA-binding transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10254 thioesterase; Provisional | Back alignment and domain information |
|---|
| >PRK10694 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >PRK10293 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT) | Back alignment and domain information |
|---|
| >cd03440 hot_dog The hotdog fold was initially identified in the E | Back alignment and domain information |
|---|
| >KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria | Back alignment and domain information |
|---|
| >PLN02322 acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >cd03440 hot_dog The hotdog fold was initially identified in the E | Back alignment and domain information |
|---|
| >KOG3328 consensus HGG motif-containing thioesterase [General function prediction only] | Back alignment and domain information |
|---|
| >PF03061 4HBT: Thioesterase superfamily; InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases | Back alignment and domain information |
|---|
| >COG1607 Acyl-CoA hydrolase [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway | Back alignment and domain information |
|---|
| >PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed | Back alignment and domain information |
|---|
| >KOG3328 consensus HGG motif-containing thioesterase [General function prediction only] | Back alignment and domain information |
|---|
| >cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit | Back alignment and domain information |
|---|
| >TIGR01750 fabZ beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ | Back alignment and domain information |
|---|
| >COG2050 PaaI HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT) | Back alignment and domain information |
|---|
| >KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd03453 SAV4209_like SAV4209_like | Back alignment and domain information |
|---|
| >PF03756 AfsA: A-factor biosynthesis hotdog domain; InterPro: IPR005509 The AfsA family are key enzymes in A-factor biosynthesis, which is essential for streptomycin production and resistance | Back alignment and domain information |
|---|
| >cd00493 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation | Back alignment and domain information |
|---|
| >cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway | Back alignment and domain information |
|---|
| >cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase] | Back alignment and domain information |
|---|
| >cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes | Back alignment and domain information |
|---|
| >cd03446 MaoC_like MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain | Back alignment and domain information |
|---|
| >cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT) | Back alignment and domain information |
|---|
| >cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT) | Back alignment and domain information |
|---|
| >cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit | Back alignment and domain information |
|---|
| >PRK10800 acyl-CoA thioesterase YbgC; Provisional | Back alignment and domain information |
|---|
| >PRK13693 (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Provisional | Back alignment and domain information |
|---|
| >PLN02647 acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >COG0764 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >TIGR02447 yiiD_Cterm thioesterase domain, putative | Back alignment and domain information |
|---|
| >PLN02647 acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional | Back alignment and domain information |
|---|
| >PRK13188 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed | Back alignment and domain information |
|---|
| >PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated | Back alignment and domain information |
|---|
| >PF13452 MaoC_dehydrat_N: N-terminal half of MaoC dehydratase; PDB: 3HMJ_H 2UV8_I 2VKZ_G 1S9C_K 3OML_A 3KHP_A | Back alignment and domain information |
|---|
| >cd03448 HDE_HSD HDE_HSD The R-hydratase-like hot dog fold of the 17-beta-hydroxysteriod dehydrogenase (HSD), and Hydratase-Dehydrogenase-Epimerase (HDE) proteins | Back alignment and domain information |
|---|
| >PF07977 FabA: FabA-like domain; InterPro: IPR013114 Fatty acids biosynthesis occurs by two distinct pathways: in fungi, mammals and mycobacteria, type I or associative fatty-acid biosynthesis (type I FAS) is accomplished by multifunctional proteins in which distinct domains catalyse specific reactions; in plants and most bacteria, type II or dissociative fatty-acid biosynthesis (type II FAS) is accomplished by distinct enzymes [] | Back alignment and domain information |
|---|
| >PF09500 YiiD_Cterm: Putative thioesterase (yiiD_Cterm); InterPro: IPR012660 This entry consists of a broadly distributed uncharacterised domain found often as a standalone protein | Back alignment and domain information |
|---|
| >cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes | Back alignment and domain information |
|---|
| >cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway | Back alignment and domain information |
|---|
| >cd03454 YdeM YdeM is a Bacillus subtilis protein that belongs to a family of prokaryotic proteins of unkown function | Back alignment and domain information |
|---|
| >TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >cd01287 FabA FabA, beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase: Bacterial protein of the type II, fatty acid synthase system that binds ACP and catalyzes both dehydration and isomerization reactions, apparently in the same active site | Back alignment and domain information |
|---|
| >PRK13691 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional | Back alignment and domain information |
|---|
| >cd01289 FabA_like Domain of unknown function, appears to be related to a diverse group of beta-hydroxydecanoyl ACP dehydratases (FabA) and beta-hydroxyacyl ACP dehydratases (FabZ) | Back alignment and domain information |
|---|
| >COG0824 FcbC Predicted thioesterase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02864 enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional | Back alignment and domain information |
|---|
| >cd03452 MaoC_C MaoC_C The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein | Back alignment and domain information |
|---|
| >PF01575 MaoC_dehydratas: MaoC like domain; InterPro: IPR002539 The C terminus of the MaoC protein is found to share similarity with a wide variety of enzymes | Back alignment and domain information |
|---|
| >COG0824 FcbC Predicted thioesterase [General function prediction only] | Back alignment and domain information |
|---|
| >PF14539 DUF4442: Domain of unknown function (DUF4442); PDB: 1YOC_B 1SH8_B | Back alignment and domain information |
|---|
| >PRK05174 3-hydroxydecanoyl-(acyl carrier protein) dehydratase; Validated | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 430 | ||||
| 4gwh_A | 288 | Crystal Structure Of Acyl-Coa Thioesterase Tesb Fro | 3e-49 | ||
| 1c8u_A | 285 | Crystal Structure Of The E.Coli Thioesterase Ii, A | 9e-44 | ||
| 3u0a_A | 285 | Crystal Structure Of An Acyl-Coa Thioesterase Ii Te | 2e-41 | ||
| 3rd7_A | 286 | Crystal Structure Of Acyl-Coa Thioesterase From Myc | 5e-29 | ||
| 3shr_A | 299 | Crystal Structure Of Cgmp-Dependent Protein Kinase | 3e-09 | ||
| 1tbu_A | 118 | Crystal Structure Of N-terminal Domain Of Yeast Per | 3e-05 | ||
| 3of1_A | 246 | Crystal Structure Of Bcy1, The Yeast Regulatory Sub | 1e-04 | ||
| 3tnq_A | 416 | Structure And Allostery Of The Pka Riib Tetrameric | 3e-04 | ||
| 3tnp_B | 416 | Structure And Allostery Of The Pka Riib Tetrameric | 3e-04 |
| >pdb|4GWH|A Chain A, Crystal Structure Of Acyl-Coa Thioesterase Tesb From Yersinia Pestis Length = 288 | Back alignment and structure |
|
| >pdb|1C8U|A Chain A, Crystal Structure Of The E.Coli Thioesterase Ii, A Homologue Of The Human Nef-Binding Enzyme Length = 285 | Back alignment and structure |
| >pdb|3U0A|A Chain A, Crystal Structure Of An Acyl-Coa Thioesterase Ii Tesb2 From Mycobacterium Marinum Length = 285 | Back alignment and structure |
| >pdb|3RD7|A Chain A, Crystal Structure Of Acyl-Coa Thioesterase From Mycobacterium Avium Length = 286 | Back alignment and structure |
| >pdb|3SHR|A Chain A, Crystal Structure Of Cgmp-Dependent Protein Kinase Reveals Novel Site Of Interchain Communication Length = 299 | Back alignment and structure |
| >pdb|1TBU|A Chain A, Crystal Structure Of N-terminal Domain Of Yeast Peroxisomal Thioesterase-1 Length = 118 | Back alignment and structure |
| >pdb|3OF1|A Chain A, Crystal Structure Of Bcy1, The Yeast Regulatory Subunit Of Pka Length = 246 | Back alignment and structure |
| >pdb|3TNQ|A Chain A, Structure And Allostery Of The Pka Riib Tetrameric Holoenzyme Length = 416 | Back alignment and structure |
| >pdb|3TNP|B Chain B, Structure And Allostery Of The Pka Riib Tetrameric Holoenzyme Length = 416 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1c8u_A Acyl-COA thioesterase II; internal repeats, hydrolase; HET: LDA; 1.90A {Escherichia coli} SCOP: d.38.1.3 d.38.1.3 Length = 285 | Back alignment and structure |
|---|
Score = 313 bits (803), Expect = e-105
Identities = 117/286 (40%), Positives = 162/286 (56%), Gaps = 11/286 (3%)
Query: 136 VENILHLEPVEVNIFQGITLPDAPKFGKVFGGQLVGQALAAASKTVDCLKIVHSLHCYFL 195
+ +L+LE +E +F+G + +VFGGQ+VGQAL AA +TV ++VHS H YFL
Sbjct: 7 LLTLLNLEKIEEGLFRGQSEDLGL--RQVFGGQVVGQALYAAKETVPEERLVHSFHSYFL 64
Query: 196 LVGDLNIPIIYQVHRVRDGNSFATRRVDAIQKGNIIFTLLASFQKEEQGFEHQETTMPLV 255
GD PIIY V +RDGNSF+ RRV AIQ G IF + ASFQ E GFEHQ+ TMP
Sbjct: 65 RPGDSKKPIIYDVETLRDGNSFSARRVAAIQNGKPIFYMTASFQAPEAGFEHQK-TMPSA 123
Query: 256 PAPEMLLSMEELRERRLTDPRLPRSYRNKVASKEFVPWPIDIRFCEPNSYTNQSKSPPSL 315
PAP+ L S ++ L + K P+++R E ++ + P
Sbjct: 124 PAPDGLPSETQIA------QSLAHLLPPVLKDKFICDRPLEVRPVEFHNPLKGHVAEPHR 177
Query: 316 RYWFRAKGKLSDDQALHRCVVAFASDLIFSSVSLNPHRRKGF--RTASLSLDHSMWFHRS 373
+ W RA G + DD +H+ ++ +ASDL F V+L PH ++DHSMWFHR
Sbjct: 178 QVWIRANGSVPDDLRVHQYLLGYASDLNFLPVALQPHGIGFLEPGIQIATIDHSMWFHRP 237
Query: 374 FRADDWLLFVIVSPVASKARGFVSGEMFNTKGELLVSLTQEALLRS 419
F ++WLL+ + S AS ARGFV GE + G L+ S QE ++R+
Sbjct: 238 FNLNEWLLYSVESTSASSARGFVRGEFYTQDGVLVASTVQEGVMRN 283
|
| >3u0a_A Acyl-COA thioesterase II TESB2; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, hydrolase; 2.50A {Mycobacterium marinum} Length = 285 | Back alignment and structure |
|---|
| >3rd7_A Acyl-COA thioesterase; seattle structur genomics center for infectious disease, ssgcid, hydrolase; 1.95A {Mycobacterium avium} Length = 286 | Back alignment and structure |
|---|
| >3cjy_A Putative thioesterase; YP_496845.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans} Length = 259 | Back alignment and structure |
|---|
| >3rqb_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MSE; 2.80A {Alicyclobacillus acidocaldarius subsp} Length = 275 | Back alignment and structure |
|---|
| >3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca} Length = 272 | Back alignment and structure |
|---|
| >1tbu_A Peroxisomal acyl-coenzyme A thioester hydrolase 1; yeast peroxisomal thioesterase, , domain swapping, iodine SOAK, siras; 2.20A {Saccharomyces cerevisiae} SCOP: d.38.1.3 Length = 118 | Back alignment and structure |
|---|
| >1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Length = 138 | Back alignment and structure |
|---|
| >3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 | Back alignment and structure |
|---|
| >3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 | Back alignment and structure |
|---|
| >3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 | Back alignment and structure |
|---|
| >3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 | Back alignment and structure |
|---|
| >3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 | Back alignment and structure |
|---|
| >3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 | Back alignment and structure |
|---|
| >3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 | Back alignment and structure |
|---|
| >2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 | Back alignment and structure |
|---|
| >2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 | Back alignment and structure |
|---|
| >4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 | Back alignment and structure |
|---|
| >4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 | Back alignment and structure |
|---|
| >3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 | Back alignment and structure |
|---|
| >2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 | Back alignment and structure |
|---|
| >1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 | Back alignment and structure |
|---|
| >1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 | Back alignment and structure |
|---|
| >2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 | Back alignment and structure |
|---|
| >1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Length = 137 | Back alignment and structure |
|---|
| >3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Length = 161 | Back alignment and structure |
|---|
| >3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Length = 154 | Back alignment and structure |
|---|
| >3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Length = 260 | Back alignment and structure |
|---|
| >4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Length = 333 | Back alignment and structure |
|---|
| >3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Length = 139 | Back alignment and structure |
|---|
| >3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 | Back alignment and structure |
|---|
| >3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Length = 220 | Back alignment and structure |
|---|
| >4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Length = 160 | Back alignment and structure |
|---|
| >3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 | Back alignment and structure |
|---|
| >2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Length = 220 | Back alignment and structure |
|---|
| >1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Length = 222 | Back alignment and structure |
|---|
| >3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 | Back alignment and structure |
|---|
| >3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Length = 230 | Back alignment and structure |
|---|
| >3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Length = 237 | Back alignment and structure |
|---|
| >3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Length = 202 | Back alignment and structure |
|---|
| >2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Length = 198 | Back alignment and structure |
|---|
| >4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 | Back alignment and structure |
|---|
| >3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Length = 227 | Back alignment and structure |
|---|
| >3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Length = 210 | Back alignment and structure |
|---|
| >2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Length = 232 | Back alignment and structure |
|---|
| >1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Length = 232 | Back alignment and structure |
|---|
| >1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Length = 213 | Back alignment and structure |
|---|
| >3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Length = 250 | Back alignment and structure |
|---|
| >2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Length = 207 | Back alignment and structure |
|---|
| >2byv_E RAP guanine nucleotide exchange factor 4; EPAC2, CAMP-GEF2, CAMP, cyclic nucleotide, regulation, auto-inhibition, CDC25 homology domain; 2.7A {Mus musculus} Length = 999 | Back alignment and structure |
|---|
| >2byv_E RAP guanine nucleotide exchange factor 4; EPAC2, CAMP-GEF2, CAMP, cyclic nucleotide, regulation, auto-inhibition, CDC25 homology domain; 2.7A {Mus musculus} Length = 999 | Back alignment and structure |
|---|
| >3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Length = 243 | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Length = 195 | Back alignment and structure |
|---|
| >2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Length = 238 | Back alignment and structure |
|---|
| >2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Length = 202 | Back alignment and structure |
|---|
| >3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Length = 194 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 430 | |||
| 3rd7_A | 286 | Acyl-COA thioesterase; seattle structur genomics c | 100.0 | |
| 3u0a_A | 285 | Acyl-COA thioesterase II TESB2; structural genomic | 100.0 | |
| 1c8u_A | 285 | Acyl-COA thioesterase II; internal repeats, hydrol | 100.0 | |
| 3rqb_A | 275 | Uncharacterized protein; structural genomics, PSI- | 100.0 | |
| 3cjy_A | 259 | Putative thioesterase; YP_496845.1, structural gen | 100.0 | |
| 3bbj_A | 272 | Putative thioesterase II; structural genomics, joi | 100.0 | |
| 1tbu_A | 118 | Peroxisomal acyl-coenzyme A thioester hydrolase 1; | 99.96 | |
| 2z69_A | 154 | DNR protein; beta barrel, dimerization helix, tran | 99.71 | |
| 2pqq_A | 149 | Putative transcriptional regulator; APC7345, strep | 99.7 | |
| 3mdp_A | 142 | Cyclic nucleotide-binding domain (CNMP-BD) protei; | 99.7 | |
| 3idb_B | 161 | CAMP-dependent protein kinase type II-beta regulat | 99.7 | |
| 3gyd_A | 187 | CNMP-BD protein, cyclic nucleotide-binding domain; | 99.69 | |
| 3dkw_A | 227 | DNR protein; CRP-FNR, HTH, beta barrel, dimerizati | 99.65 | |
| 3dn7_A | 194 | Cyclic nucleotide binding regulatory protein; stru | 99.65 | |
| 3fx3_A | 237 | Cyclic nucleotide-binding protein; helix_TURN_heli | 99.65 | |
| 1zyb_A | 232 | Transcription regulator, CRP family; NP_813211.1, | 99.64 | |
| 3ocp_A | 139 | PRKG1 protein; serine/threonine kinase, TF2I and I | 99.64 | |
| 3d0s_A | 227 | Transcriptional regulatory protein; CAMP receptor | 99.64 | |
| 3e97_A | 231 | Transcriptional regulator, CRP/FNR family; YP_6044 | 99.62 | |
| 3pna_A | 154 | CAMP-dependent protein kinase type I-alpha regula | 99.62 | |
| 4ev0_A | 216 | Transcription regulator, CRP family; CAMP binding, | 99.61 | |
| 3iwz_A | 230 | CAP-like, catabolite activation-like protein; XCC, | 99.61 | |
| 3dv8_A | 220 | Transcriptional regulator, CRP/FNR family; cyclic | 99.6 | |
| 4f8a_A | 160 | Potassium voltage-gated channel subfamily H membe; | 99.6 | |
| 2d93_A | 134 | RAP guanine nucleotide exchange factor 6; CNMP_bin | 99.6 | |
| 1vp6_A | 138 | CNBD, cyclic-nucleotide binding domain of mesorhiz | 99.58 | |
| 1wgp_A | 137 | Probable cyclic nucleotide-gated ION channel 6; cy | 99.58 | |
| 4ava_A | 333 | Lysine acetyltransferase; allosteric regulation, d | 99.57 | |
| 2ptm_A | 198 | Hyperpolarization-activated (IH) channel; ION chan | 99.56 | |
| 3tnp_B | 416 | CAMP-dependent protein kinase type II-beta regula | 99.55 | |
| 3of1_A | 246 | CAMP-dependent protein kinase regulatory subunit; | 99.55 | |
| 3ryp_A | 210 | Catabolite gene activator; CAMP receptor protein ( | 99.54 | |
| 2gau_A | 232 | Transcriptional regulator, CRP/FNR family; structu | 99.54 | |
| 3shr_A | 299 | CGMP-dependent protein kinase 1; cyclic nucleotide | 99.53 | |
| 3shr_A | 299 | CGMP-dependent protein kinase 1; cyclic nucleotide | 99.52 | |
| 3ukn_A | 212 | Novel protein similar to vertebrate potassium VOL | 99.52 | |
| 2qcs_B | 291 | CAMP-dependent protein kinase type I-alpha regula | 99.52 | |
| 2oz6_A | 207 | Virulence factor regulator; winged helix, helix-tu | 99.52 | |
| 3bpz_A | 202 | Potassium/sodium hyperpolarization-activated cycli | 99.51 | |
| 3kcc_A | 260 | Catabolite gene activator; helix-turn-helix, CAMP, | 99.5 | |
| 1o7f_A | 469 | CAMP-dependent RAP1 guanine-nucleotide exchange fa | 99.49 | |
| 4din_B | 381 | CAMP-dependent protein kinase type I-beta regulat | 99.49 | |
| 3tnp_B | 416 | CAMP-dependent protein kinase type II-beta regula | 99.48 | |
| 3e6c_C | 250 | CPRK, cyclic nucleotide-binding protein; CPRK, hal | 99.48 | |
| 3of1_A | 246 | CAMP-dependent protein kinase regulatory subunit; | 99.47 | |
| 1o5l_A | 213 | Transcriptional regulator, CRP family; TM1171, str | 99.47 | |
| 2qcs_B | 291 | CAMP-dependent protein kinase type I-alpha regula | 99.46 | |
| 4din_B | 381 | CAMP-dependent protein kinase type I-beta regulat | 99.45 | |
| 2fmy_A | 220 | COOA, carbon monoxide oxidation system transcripti | 99.43 | |
| 4f7z_A | 999 | RAP guanine nucleotide exchange factor 4; cyclic n | 99.41 | |
| 1ft9_A | 222 | Carbon monoxide oxidation system transcription reg | 99.4 | |
| 1o7f_A | 469 | CAMP-dependent RAP1 guanine-nucleotide exchange fa | 99.39 | |
| 2bgc_A | 238 | PRFA; bacterial infection, human pathogen, transcr | 99.33 | |
| 3la7_A | 243 | Global nitrogen regulator; activator, DNA-binding, | 99.31 | |
| 3cf6_E | 694 | RAP guanine nucleotide exchange factor (GEF) 4; EP | 99.3 | |
| 3b02_A | 195 | Transcriptional regulator, CRP family; structural | 99.28 | |
| 4f7z_A | 999 | RAP guanine nucleotide exchange factor 4; cyclic n | 99.27 | |
| 2zcw_A | 202 | TTHA1359, transcriptional regulator, FNR/CRP famil | 99.22 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 99.18 | |
| 3f1t_A | 148 | Uncharacterized protein Q9I3C8_pseae; PAR319A, NES | 98.35 | |
| 3e29_A | 144 | Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, | 98.31 | |
| 3dkz_A | 142 | Thioesterase superfamily protein; Q7W9W5, borpa, P | 98.25 | |
| 1sc0_A | 138 | Hypothetical protein HI1161; structural genomics, | 98.2 | |
| 1vh9_A | 149 | P15, hypothetical protein YBDB; structural genomic | 98.2 | |
| 3f5o_A | 148 | Thioesterase superfamily member 2; hotdog fold, hy | 98.2 | |
| 2gvh_A | 288 | AGR_L_2016P; 15159470, acyl-COA hydrolase, structu | 98.18 | |
| 3nwz_A | 176 | BH2602 protein; structural genomics, PSI-biology, | 98.18 | |
| 1zki_A | 133 | Hypothetical protein PA5202; structural genomics, | 98.17 | |
| 2h4u_A | 145 | Thioesterase superfamily member 2; structural geno | 98.16 | |
| 2qwz_A | 159 | Phenylacetic acid degradation-related protein; put | 98.15 | |
| 1wlu_A | 136 | PAAI protein, phenylacetic acid degradation protei | 98.13 | |
| 4i82_A | 137 | Putative uncharacterized protein; PAAI/YDII-like, | 98.12 | |
| 1o0i_A | 138 | Hypothetical protein HI1161; structural genomics, | 98.11 | |
| 2pim_A | 141 | Phenylacetic acid degradation-related protein; thi | 98.07 | |
| 1vh5_A | 148 | Hypothetical protein YDII; PSI, protein structure | 98.05 | |
| 2hbo_A | 158 | Hypothetical protein (NP_422103.1); thioesterase/t | 98.03 | |
| 3e8p_A | 164 | Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG | 98.02 | |
| 3s4k_A | 144 | Putative esterase RV1847/MT1895; seattle structura | 97.99 | |
| 3e1e_A | 141 | Thioesterase family protein; structural genomics, | 97.97 | |
| 2fs2_A | 151 | Phenylacetic acid degradation protein PAAI; operon | 97.96 | |
| 3gek_A | 146 | Putative thioesterase YHDA; structure genomics, NE | 97.95 | |
| 3lw3_A | 145 | HP0420 homologue; hotdog-fold, structural genomics | 97.95 | |
| 1ixl_A | 131 | Hypothetical protein PH1136; alpha+beta, hot-DOG-f | 97.94 | |
| 3lbe_A | 163 | Putative uncharacterized protein SMU.793; hypothet | 97.92 | |
| 2f41_A | 121 | Transcription factor FAPR; 'HOT-DOG' fold, gene re | 97.89 | |
| 3bnv_A | 152 | CJ0977; virulence factor, hot-DOG fold, flagel unk | 97.86 | |
| 1q4t_A | 151 | Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A | 97.86 | |
| 3b7k_A | 333 | Acyl-coenzyme A thioesterase 12; hotdog fold, stru | 97.78 | |
| 3gek_A | 146 | Putative thioesterase YHDA; structure genomics, NE | 97.76 | |
| 2f3x_A | 157 | Transcription factor FAPR; 'HOT-DOG' fold / malony | 97.75 | |
| 3hdu_A | 157 | Putative thioesterase; structural genomics, joint | 97.75 | |
| 2ov9_A | 216 | Hypothetical protein; rhodococcus SP. RHA1, RHA085 | 97.69 | |
| 1sc0_A | 138 | Hypothetical protein HI1161; structural genomics, | 97.67 | |
| 2prx_A | 160 | Thioesterase superfamily protein; ZP_00837258.1, s | 97.64 | |
| 4a0z_A | 190 | Transcription factor FAPR; lipid homeostasis; HET: | 97.49 | |
| 1vh9_A | 149 | P15, hypothetical protein YBDB; structural genomic | 97.48 | |
| 3s4k_A | 144 | Putative esterase RV1847/MT1895; seattle structura | 97.46 | |
| 1yoc_A | 147 | Hypothetical protein PA1835; structural genomics, | 97.44 | |
| 3dkz_A | 142 | Thioesterase superfamily protein; Q7W9W5, borpa, P | 97.43 | |
| 4i82_A | 137 | Putative uncharacterized protein; PAAI/YDII-like, | 97.42 | |
| 1o0i_A | 138 | Hypothetical protein HI1161; structural genomics, | 97.41 | |
| 3lbe_A | 163 | Putative uncharacterized protein SMU.793; hypothet | 97.33 | |
| 3nwz_A | 176 | BH2602 protein; structural genomics, PSI-biology, | 97.32 | |
| 3f1t_A | 148 | Uncharacterized protein Q9I3C8_pseae; PAR319A, NES | 97.31 | |
| 3d6l_A | 137 | Putative hydrolase; hot DOG fold, thioesterase, ac | 97.28 | |
| 4ien_A | 163 | Putative acyl-COA hydrolase; hot DOG fold; HET: CO | 97.28 | |
| 1vh5_A | 148 | Hypothetical protein YDII; PSI, protein structure | 97.27 | |
| 4ae8_A | 211 | Thioesterase superfamily member 4; hydrolase, hotd | 97.27 | |
| 1sh8_A | 154 | Hypothetical protein PA5026; structural genomics, | 97.26 | |
| 3f5o_A | 148 | Thioesterase superfamily member 2; hotdog fold, hy | 97.24 | |
| 3hdu_A | 157 | Putative thioesterase; structural genomics, joint | 97.21 | |
| 4ae7_A | 220 | Thioesterase superfamily member 5; hydrolase, hotd | 97.1 | |
| 2q2b_A | 179 | Cytosolic acyl coenzyme A thioester hydrolase; ACO | 97.05 | |
| 2fs2_A | 151 | Phenylacetic acid degradation protein PAAI; operon | 97.03 | |
| 3e29_A | 144 | Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, | 97.01 | |
| 3e1e_A | 141 | Thioesterase family protein; structural genomics, | 96.96 | |
| 2qq2_A | 193 | Cytosolic acyl coenzyme A thioester hydrolase; ACO | 96.93 | |
| 1q4t_A | 151 | Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A | 96.88 | |
| 4ae7_A | 220 | Thioesterase superfamily member 5; hydrolase, hotd | 96.87 | |
| 2qwz_A | 159 | Phenylacetic acid degradation-related protein; put | 96.87 | |
| 1y7u_A | 174 | Acyl-COA hydrolase; structural genomics, coenzyme | 96.85 | |
| 2eis_A | 133 | Hypothetical protein TTHB207; COA binding motif, N | 96.84 | |
| 3bjk_A | 153 | Acyl-COA thioester hydrolase HI0827; hotdog fold, | 96.78 | |
| 4ae8_A | 211 | Thioesterase superfamily member 4; hydrolase, hotd | 96.77 | |
| 2h4u_A | 145 | Thioesterase superfamily member 2; structural geno | 96.72 | |
| 2hbo_A | 158 | Hypothetical protein (NP_422103.1); thioesterase/t | 96.7 | |
| 3e8p_A | 164 | Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG | 96.65 | |
| 1vpm_A | 169 | Acyl-COA hydrolase; NP_241664.1, structural genomi | 96.65 | |
| 2ov9_A | 216 | Hypothetical protein; rhodococcus SP. RHA1, RHA085 | 96.63 | |
| 1iq6_A | 134 | (R)-hydratase, (R)-specific enoyl-COA hydratase; p | 96.57 | |
| 1sh8_A | 154 | Hypothetical protein PA5026; structural genomics, | 96.56 | |
| 2b3n_A | 159 | Hypothetical protein AF1124; structural genomics, | 96.5 | |
| 1t82_A | 155 | Hypothetical acetyltransferase; structural genomic | 96.41 | |
| 2cye_A | 133 | TTHA1846, putative thioesterase; structural genomi | 96.41 | |
| 2v1o_A | 151 | Cytosolic acyl coenzyme A thioester hydrolase; acy | 96.28 | |
| 1zki_A | 133 | Hypothetical protein PA5202; structural genomics, | 96.26 | |
| 1ixl_A | 131 | Hypothetical protein PH1136; alpha+beta, hot-DOG-f | 96.18 | |
| 2oiw_A | 136 | Putative 4-hydroxybenzoyl-COA thioesterase; struct | 96.17 | |
| 1yoc_A | 147 | Hypothetical protein PA1835; structural genomics, | 96.15 | |
| 2pim_A | 141 | Phenylacetic acid degradation-related protein; thi | 96.11 | |
| 2egj_A | 128 | Hypothetical protein AQ_1494; structural genomics; | 95.86 | |
| 2gvh_A | 288 | AGR_L_2016P; 15159470, acyl-COA hydrolase, structu | 95.85 | |
| 2gf6_A | 135 | Conserved hypothetical protein; putative thioester | 95.84 | |
| 1wlu_A | 136 | PAAI protein, phenylacetic acid degradation protei | 95.72 | |
| 3b7k_A | 333 | Acyl-coenzyme A thioesterase 12; hotdog fold, stru | 95.69 | |
| 1q6w_A | 161 | Monoamine oxidase regulatory protein, putative; st | 95.65 | |
| 1z54_A | 132 | Probable thioesterase; hypothetical protein, struc | 95.55 | |
| 2own_A | 262 | Putative oleoyl-[acyl-carrier protein] thioestera; | 95.41 | |
| 3exz_A | 154 | MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A | 95.39 | |
| 2cwz_A | 141 | Thioesterase family protein; structural genomics, | 95.34 | |
| 4i83_A | 152 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; | 95.3 | |
| 2oaf_A | 151 | Thioesterase superfamily; YP_508616.1, structural | 95.29 | |
| 2cwz_A | 141 | Thioesterase family protein; structural genomics, | 95.18 | |
| 2fuj_A | 137 | Conserved hypothetical protein; structural genomic | 95.06 | |
| 1s5u_A | 138 | Protein YBGC; structural genomics, hypothetical pr | 95.06 | |
| 2prx_A | 160 | Thioesterase superfamily protein; ZP_00837258.1, s | 95.06 | |
| 3lmb_A | 165 | Uncharacterized protein; protein OLEI01261, unknow | 94.88 | |
| 2hx5_A | 152 | Hypothetical protein; thioesterase/thiol ester deh | 94.81 | |
| 1lo7_A | 141 | 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, c | 94.75 | |
| 3d6x_A | 146 | (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; | 94.48 | |
| 3ir3_A | 148 | HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc | 94.41 | |
| 1t82_A | 155 | Hypothetical acetyltransferase; structural genomic | 94.37 | |
| 2q78_A | 153 | Uncharacterized protein; structural genomics, join | 94.35 | |
| 2gll_A | 171 | FABZ, (3R)-hydroxymyristoyl-acyl carrier protein d | 94.25 | |
| 3ck1_A | 150 | Putative thioesterase; structural genomics, joint | 94.07 | |
| 3kuv_A | 139 | Fluoroacetyl coenzyme A thioesterase; fluoroacetyl | 94.07 | |
| 2nuj_A | 163 | Thioesterase superfamily; YP_509914.1, structural | 94.03 | |
| 2eis_A | 133 | Hypothetical protein TTHB207; COA binding motif, N | 93.8 | |
| 1njk_A | 156 | Hypothetical protein YBAW; structural genomics, th | 93.75 | |
| 4h4g_A | 160 | (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; | 93.51 | |
| 2o5u_A | 148 | Thioesterase; putative thioesterese,, hydrolase; 1 | 93.38 | |
| 2hlj_A | 157 | Hypothetical protein; putative thioesterase, struc | 93.31 | |
| 2ess_A | 248 | Acyl-ACP thioesterase; NP_810988.1, structural gen | 93.2 | |
| 1u1z_A | 168 | (3R)-hydroxymyristoyl-[acyl carrier protein] dehyd | 93.09 | |
| 2ali_A | 158 | Hypothetical protein PA2801; structural genomics, | 92.91 | |
| 2pzh_A | 135 | Hypothetical protein HP_0496; lipid, acyl-COA, bac | 92.82 | |
| 2w3x_A | 147 | CALE7; hydrolase, hotdog fold, thioesterase, enedi | 92.81 | |
| 1z6b_A | 154 | Pffabz, fatty acid synthesis protein; malaria, bet | 92.78 | |
| 1q6w_A | 161 | Monoamine oxidase regulatory protein, putative; st | 92.7 | |
| 3k67_A | 159 | Putative dehydratase AF1124; hypothetical protein | 92.7 | |
| 3d6l_A | 137 | Putative hydrolase; hot DOG fold, thioesterase, ac | 92.58 | |
| 2xem_A | 150 | DYNE7, TEBC; biosynthetic protein, polyketide bios | 92.56 | |
| 3bnv_A | 152 | CJ0977; virulence factor, hot-DOG fold, flagel unk | 92.48 | |
| 2egj_A | 128 | Hypothetical protein AQ_1494; structural genomics; | 92.0 | |
| 3ck1_A | 150 | Putative thioesterase; structural genomics, joint | 91.78 | |
| 2fuj_A | 137 | Conserved hypothetical protein; structural genomic | 91.65 | |
| 4ffu_A | 176 | Oxidase; structural genomics, protein structure in | 91.48 | |
| 2cye_A | 133 | TTHA1846, putative thioesterase; structural genomi | 91.41 | |
| 2hlj_A | 157 | Hypothetical protein; putative thioesterase, struc | 91.39 | |
| 2q2b_A | 179 | Cytosolic acyl coenzyme A thioester hydrolase; ACO | 91.09 | |
| 2oiw_A | 136 | Putative 4-hydroxybenzoyl-COA thioesterase; struct | 90.66 | |
| 2qq2_A | 193 | Cytosolic acyl coenzyme A thioester hydrolase; ACO | 90.55 | |
| 3hm0_A | 167 | Probable thioesterase; niaid, ssgcid, decode, UW, | 90.43 | |
| 3exz_A | 154 | MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A | 90.33 | |
| 1njk_A | 156 | Hypothetical protein YBAW; structural genomics, th | 90.2 | |
| 1s5u_A | 138 | Protein YBGC; structural genomics, hypothetical pr | 90.17 | |
| 3qoo_A | 138 | Uncharacterized protein; structural genomics, PSI- | 89.97 | |
| 3r87_A | 135 | Putative uncharacterized protein; unknown function | 89.81 | |
| 2gf6_A | 135 | Conserved hypothetical protein; putative thioester | 89.49 | |
| 2nuj_A | 163 | Thioesterase superfamily; YP_509914.1, structural | 89.47 | |
| 2w3x_A | 147 | CALE7; hydrolase, hotdog fold, thioesterase, enedi | 89.28 | |
| 3r87_A | 135 | Putative uncharacterized protein; unknown function | 89.25 | |
| 3bjk_A | 153 | Acyl-COA thioester hydrolase HI0827; hotdog fold, | 89.15 | |
| 2f41_A | 121 | Transcription factor FAPR; 'HOT-DOG' fold, gene re | 88.99 | |
| 2own_A | 262 | Putative oleoyl-[acyl-carrier protein] thioestera; | 88.81 | |
| 2hx5_A | 152 | Hypothetical protein; thioesterase/thiol ester deh | 88.63 | |
| 2o5u_A | 148 | Thioesterase; putative thioesterese,, hydrolase; 1 | 88.48 | |
| 2xem_A | 150 | DYNE7, TEBC; biosynthetic protein, polyketide bios | 88.47 | |
| 1iq6_A | 134 | (R)-hydratase, (R)-specific enoyl-COA hydratase; p | 88.44 | |
| 3ir3_A | 148 | HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc | 87.89 | |
| 2v1o_A | 151 | Cytosolic acyl coenzyme A thioester hydrolase; acy | 87.87 | |
| 1lo7_A | 141 | 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, c | 87.83 | |
| 1z54_A | 132 | Probable thioesterase; hypothetical protein, struc | 87.82 | |
| 3khp_A | 311 | MAOC family protein; dehydrogenase, oxidoreductase | 87.15 | |
| 1vpm_A | 169 | Acyl-COA hydrolase; NP_241664.1, structural genomi | 86.87 | |
| 2oaf_A | 151 | Thioesterase superfamily; YP_508616.1, structural | 86.7 | |
| 2ali_A | 158 | Hypothetical protein PA2801; structural genomics, | 86.58 | |
| 4i4j_A | 159 | ACP-polyene thioesterase; structural genomics, PSI | 86.44 | |
| 1s9c_A | 298 | Peroxisomal multifunctional enzyme type 2; hot-DOG | 86.42 | |
| 2q78_A | 153 | Uncharacterized protein; structural genomics, join | 86.35 | |
| 2c2i_A | 151 | RV0130; hotdog, hydratase, lyase, structural prote | 86.27 | |
| 2b3n_A | 159 | Hypothetical protein AF1124; structural genomics, | 86.05 | |
| 1y7u_A | 174 | Acyl-COA hydrolase; structural genomics, coenzyme | 85.95 | |
| 4ien_A | 163 | Putative acyl-COA hydrolase; hot DOG fold; HET: CO | 85.6 | |
| 3kh8_A | 332 | MAOC-like dehydratase; hot DOG domain, lyase; 2.00 | 83.63 | |
| 4i4j_A | 159 | ACP-polyene thioesterase; structural genomics, PSI | 83.62 | |
| 2pzh_A | 135 | Hypothetical protein HP_0496; lipid, acyl-COA, bac | 83.51 | |
| 1pn2_A | 280 | Peroxisomal hydratase-dehydrogenase-epimerase; hot | 83.13 | |
| 3qoo_A | 138 | Uncharacterized protein; structural genomics, PSI- | 83.11 | |
| 3d6x_A | 146 | (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; | 83.04 | |
| 4ffu_A | 176 | Oxidase; structural genomics, protein structure in | 82.79 | |
| 3hm0_A | 167 | Probable thioesterase; niaid, ssgcid, decode, UW, | 82.73 | |
| 4b0b_A | 171 | 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; | 81.91 | |
| 3kuv_A | 139 | Fluoroacetyl coenzyme A thioesterase; fluoroacetyl | 81.81 | |
| 3lw3_A | 145 | HP0420 homologue; hotdog-fold, structural genomics | 81.66 | |
| 3khp_A | 311 | MAOC family protein; dehydrogenase, oxidoreductase | 81.31 | |
| 2bi0_A | 337 | Hypothetical protein RV0216; conserved hypothetica | 81.22 | |
| 3q62_A | 175 | 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; | 80.45 |
| >3rd7_A Acyl-COA thioesterase; seattle structur genomics center for infectious disease, ssgcid, hydrolase; 1.95A {Mycobacterium avium} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.4e-61 Score=450.43 Aligned_cols=274 Identities=32% Similarity=0.537 Sum_probs=238.0
Q ss_pred ccchhhhcccCccccceeecccCCCCCCCceeehhHHHHHHHHHHhccCCCCCcceeeeeeeccCcCCCCCeEEEEEEee
Q 040957 133 CSLVENILHLEPVEVNIFQGITLPDAPKFGKVFGGQLVGQALAAASKTVDCLKIVHSLHCYFLLVGDLNIPIIYQVHRVR 212 (430)
Q Consensus 133 ~~~l~~~l~l~~~~~~~f~~~~~~~~~~~~~~~GG~~~a~al~Aa~~~~~~~~~~~s~~~~Fl~~~~~~~pi~~~V~~lr 212 (430)
+..++++|+|++++++.|++..++ .+++++|||+++|||+.||.++ ++++.|||+|+||++||+++.|++|+|+++|
T Consensus 7 ~~~l~~~l~le~i~~~~f~g~~~~--~~~~~vfGG~v~Aqal~AA~~t-~~~~~~hSlh~yFl~pg~~~~Pi~y~Ve~lR 83 (286)
T 3rd7_A 7 LEDVLSLLDLQQIDDAAFVGTQPD--TPNHHIIGSQVAAQALMAAGRT-TPGRLAHSMHMYFLRRGDARQPIQYDVTPLR 83 (286)
T ss_dssp HHHHHHHTCCEEEETTEEEECCCC--CTTCBCCHHHHHHHHHHHHHHT-STTCEEEEEEEEECSCCBTTSCEEEEEEEEE
T ss_pred HHHHHHhcceEEcCCCeEEcccCC--CCCCcccHHHHHHHHHHHHHhC-CCCCCcEEEEEEccCCCCCCCCEEEEEEEEE
Confidence 567899999999999999999876 3677999999999999999999 8899999999999999999999999999999
Q ss_pred eCCCeeEEEEEEEECCeeEEEEEEeccccCCCcccCccCCCCCCCCCCCCCHHHHHHhhcCCCCCchhhHhhhhccCCCC
Q 040957 213 DGNSFATRRVDAIQKGNIIFTLLASFQKEEQGFEHQETTMPLVPAPEMLLSMEELRERRLTDPRLPRSYRNKVASKEFVP 292 (430)
Q Consensus 213 ~Gr~~s~~~V~~~Q~g~~~~~~~~sf~~~~~~~~~~~~~~p~~p~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 292 (430)
+||||++|+|+++|+|+++|++++||++.+++++|+.. ||++|+||+|+..++....+.. ..+++ +. ..
T Consensus 84 dGRSfstr~V~a~Q~g~~i~~~~asF~~~e~~~~h~~~-~P~vp~Pe~~~~~~~~~~~~~~--~~~~~----~~----~~ 152 (286)
T 3rd7_A 84 DGGTISSRRVTASQSGVVLFEALASFTIIADDVDWQQR-MPDVAGPSAVHGLEDLLAPYAE--EFGDW----WP----QQ 152 (286)
T ss_dssp ECSSEEEEEEEEEETTEEEEEEEEEEECCCCCCCEECC-CCCCCCGGGSCBHHHHHGGGGG--GC--------------C
T ss_pred CCCcEEEEEEEEEECCEEEEEEEEecccCCCCccccCC-CCCCCChhhccchHHHHHhhhH--HHHHH----hc----cC
Confidence 99999999999999999999999999999999999865 9999999999988765432110 01111 10 14
Q ss_pred CCeEEEEcCCC-CCCC--CCCCCCeeEEEEecCCCCCCChHHHHHHHHHHhhhhhhhhhc--ccCccCCCcceeeeccee
Q 040957 293 WPIDIRFCEPN-SYTN--QSKSPPSLRYWFRAKGKLSDDQALHRCVVAFASDLIFSSVSL--NPHRRKGFRTASLSLDHS 367 (430)
Q Consensus 293 ~~~e~r~~~~~-~~~~--~~~~~~~~~~W~R~~~~~~~~~~~~~~~la~~sD~~~~~~~~--~~~~~~~~~~~~~sld~s 367 (430)
.++|+|++++. .+.. ....+++..+|+|.++++++|+.+|.++|||+||.+++.+++ .+|. ......++||||+
T Consensus 153 ~~~e~R~~~~~~~~~~~~~~~~~~~~~~W~R~~~~~p~d~~~~~~~Lay~sD~~~l~~~l~~~~h~-~~~~~~~aSLdhs 231 (286)
T 3rd7_A 153 RPFTMRYLDAPPRVALDLSDPPPPRLRIWLRANGEVTDDPLVNSCVVAYLSALTLLECVMTTMRTT-PVGPRLSALVDHT 231 (286)
T ss_dssp CSEEEEESSCCHHHHTTSSSCCCSEEEEEEEESSCCCSCHHHHHHHHHHHHHHSTTHHHHHHTTCB-TTBSSCEEECEEE
T ss_pred CCEEEEEcCCccCcccCCCCCCCCeeEEEEEECCCCCCchHHHHHHHHHHHhhhhHHHHHhhccCC-CcccceeeeeeEE
Confidence 57999999986 4443 122568899999999999999999999999999999999999 8886 3334678999999
Q ss_pred eeccCCCCCCCeEEeEEeecceeCCeeeEEEEEEccCCCEEEEEeccceeccCC
Q 040957 368 MWFHRSFRADDWLLFVIVSPVASKARGFVSGEMFNTKGELLVSLTQEALLRSPK 421 (430)
Q Consensus 368 i~f~~~~~~~~W~l~~~~~~~~~~gr~~~~~~i~~~~G~lvA~~~Q~~l~r~~~ 421 (430)
||||++++.++|++|+++++++++||++++|+|||+||+|||+++||||+|.++
T Consensus 232 i~Fh~~~~~d~Wll~~~~s~~a~~gr~~~~g~i~~~~G~LVAs~~Qegl~R~~~ 285 (286)
T 3rd7_A 232 IWFHRAADFTDWLLFDQFSPSIVGRRGLATGTLYNRSGELVCIATQEGYFAEQR 285 (286)
T ss_dssp EEECSCCCTTSCEEEEEEEEEEETTEEEEEEEEEETTSCEEEEEEEEEEECC--
T ss_pred EEEeCCCCCCceEEEEEEeceecCceEEEEEEEECCCCCEEEEEEehheeeccc
Confidence 999999999999999999999999999999999999999999999999999763
|
| >3u0a_A Acyl-COA thioesterase II TESB2; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, hydrolase; 2.50A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1c8u_A Acyl-COA thioesterase II; internal repeats, hydrolase; HET: LDA; 1.90A {Escherichia coli} SCOP: d.38.1.3 d.38.1.3 | Back alignment and structure |
|---|
| >3rqb_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MSE; 2.80A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3cjy_A Putative thioesterase; YP_496845.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca} | Back alignment and structure |
|---|
| >1tbu_A Peroxisomal acyl-coenzyme A thioester hydrolase 1; yeast peroxisomal thioesterase, , domain swapping, iodine SOAK, siras; 2.20A {Saccharomyces cerevisiae} SCOP: d.38.1.3 | Back alignment and structure |
|---|
| >2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* | Back alignment and structure |
|---|
| >3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* | Back alignment and structure |
|---|
| >1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* | Back alignment and structure |
|---|
| >3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* | Back alignment and structure |
|---|
| >3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} | Back alignment and structure |
|---|
| >3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* | Back alignment and structure |
|---|
| >4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} | Back alignment and structure |
|---|
| >4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A | Back alignment and structure |
|---|
| >1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 | Back alignment and structure |
|---|
| >4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* | Back alignment and structure |
|---|
| >2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} | Back alignment and structure |
|---|
| >3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* | Back alignment and structure |
|---|
| >3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... | Back alignment and structure |
|---|
| >2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} | Back alignment and structure |
|---|
| >3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} | Back alignment and structure |
|---|
| >3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B | Back alignment and structure |
|---|
| >2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* | Back alignment and structure |
|---|
| >2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* | Back alignment and structure |
|---|
| >3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} | Back alignment and structure |
|---|
| >1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 | Back alignment and structure |
|---|
| >4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* | Back alignment and structure |
|---|
| >3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A | Back alignment and structure |
|---|
| >3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 | Back alignment and structure |
|---|
| >2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* | Back alignment and structure |
|---|
| >4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* | Back alignment and structure |
|---|
| >4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E | Back alignment and structure |
|---|
| >1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 | Back alignment and structure |
|---|
| >1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 | Back alignment and structure |
|---|
| >2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A | Back alignment and structure |
|---|
| >3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* | Back alignment and structure |
|---|
| >3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A | Back alignment and structure |
|---|
| >4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E | Back alignment and structure |
|---|
| >2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* | Back alignment and structure |
|---|
| >3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} SCOP: d.38.1.0 | Back alignment and structure |
|---|
| >3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1sc0_A Hypothetical protein HI1161; structural genomics, unknown function, PSI-2, protein structure initiative; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 2b6e_A 3lz7_A | Back alignment and structure |
|---|
| >1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} SCOP: d.38.1.5 PDB: 2f0x_A* 2cy9_A | Back alignment and structure |
|---|
| >2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 | Back alignment and structure |
|---|
| >3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} | Back alignment and structure |
|---|
| >1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A | Back alignment and structure |
|---|
| >4i82_A Putative uncharacterized protein; PAAI/YDII-like, hot DOG fold, thioesterase, hydrolase; 2.50A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} PDB: 1sc0_A 2b6e_A 3lz7_A | Back alignment and structure |
|---|
| >2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A | Back alignment and structure |
|---|
| >2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} SCOP: d.38.1.0 | Back alignment and structure |
|---|
| >3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A | Back alignment and structure |
|---|
| >3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A | Back alignment and structure |
|---|
| >1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A* | Back alignment and structure |
|---|
| >2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3bnv_A CJ0977; virulence factor, hot-DOG fold, flagel unknown function; HET: MSE; 2.60A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A* | Back alignment and structure |
|---|
| >3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3hdu_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.50A {Syntrophus aciditrophicus SB} | Back alignment and structure |
|---|
| >2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >1sc0_A Hypothetical protein HI1161; structural genomics, unknown function, PSI-2, protein structure initiative; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 2b6e_A 3lz7_A | Back alignment and structure |
|---|
| >2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.50A {Shewanella loihica} | Back alignment and structure |
|---|
| >4a0z_A Transcription factor FAPR; lipid homeostasis; HET: MLC; 1.90A {Staphylococcus aureus} PDB: 4a0y_A 4a0x_A* 4a12_A | Back alignment and structure |
|---|
| >1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} SCOP: d.38.1.0 | Back alignment and structure |
|---|
| >1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >4i82_A Putative uncharacterized protein; PAAI/YDII-like, hot DOG fold, thioesterase, hydrolase; 2.50A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} PDB: 1sc0_A 2b6e_A 3lz7_A | Back alignment and structure |
|---|
| >3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A* | Back alignment and structure |
|---|
| >3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >4ien_A Putative acyl-COA hydrolase; hot DOG fold; HET: COA GDP; 2.00A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A | Back alignment and structure |
|---|
| >4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} PDB: 4gah_A* | Back alignment and structure |
|---|
| >1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} SCOP: d.38.1.5 PDB: 2f0x_A* 2cy9_A | Back alignment and structure |
|---|
| >3hdu_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.50A {Syntrophus aciditrophicus SB} | Back alignment and structure |
|---|
| >4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A | Back alignment and structure |
|---|
| >3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} SCOP: d.38.1.0 | Back alignment and structure |
|---|
| >3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A* | Back alignment and structure |
|---|
| >4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} | Back alignment and structure |
|---|
| >1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* | Back alignment and structure |
|---|
| >4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} PDB: 4gah_A* | Back alignment and structure |
|---|
| >2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A | Back alignment and structure |
|---|
| >2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 | Back alignment and structure |
|---|
| >1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A 3k67_A | Back alignment and structure |
|---|
| >1t82_A Hypothetical acetyltransferase; structural genomics, alpha-beta dimeric protein with A fold resembling A hotdog, PSI; 1.70A {Shewanella oneidensis} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus} | Back alignment and structure |
|---|
| >1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >2egj_A Hypothetical protein AQ_1494; structural genomics; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A | Back alignment and structure |
|---|
| >2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 | Back alignment and structure |
|---|
| >2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A | Back alignment and structure |
|---|
| >3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4 | Back alignment and structure |
|---|
| >1z54_A Probable thioesterase; hypothetical protein, structural genom NPPSFA, riken structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 | Back alignment and structure |
|---|
| >3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structur genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.85A {Thermus thermophilus} SCOP: d.38.1.7 | Back alignment and structure |
|---|
| >4i83_A 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; FABZ, hot DOG fold, thioesterase, lyase; 2.60A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.85A {Thermus thermophilus} SCOP: d.38.1.7 | Back alignment and structure |
|---|
| >2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.50A {Shewanella loihica} | Back alignment and structure |
|---|
| >3lmb_A Uncharacterized protein; protein OLEI01261, unknown function, chlorobaculum tepidum T structural genomics, PSI2, MCSG; HET: MSE; 2.10A {Oleispira antarctica rb-8} SCOP: d.38.1.0 | Back alignment and structure |
|---|
| >2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A* | Back alignment and structure |
|---|
| >3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; FABZ, hot DOG fold, dehydratase, lipid biosynthesis, lipid synthesis, lyase; HET: MSE; 2.59A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >1t82_A Hypothetical acetyltransferase; structural genomics, alpha-beta dimeric protein with A fold resembling A hotdog, PSI; 1.70A {Shewanella oneidensis} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2q78_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE MLC; 2.20A {Thermotoga maritima MSB8} SCOP: d.38.1.7 | Back alignment and structure |
|---|
| >2gll_A FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A* | Back alignment and structure |
|---|
| >3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3kuv_A Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA thioesterase FLK, hot DOG folding, thioeste hydrolase; 1.50A {Streptomyces cattleya} PDB: 3kuw_A 3kvu_A* 3p2q_A 3p2r_A 3p2s_A 3kv7_A 3kv8_A 3kvz_A* 3kw1_A* 3kx7_A 3kx8_A 3kvi_A 3p3i_A 3p3f_A | Back alignment and structure |
|---|
| >2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >4h4g_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.65A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A | Back alignment and structure |
|---|
| >2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.00A {Pseudomonas putida} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 | Back alignment and structure |
|---|
| >1u1z_A (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa} SCOP: d.38.1.6 | Back alignment and structure |
|---|
| >2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A | Back alignment and structure |
|---|
| >2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioest hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >1z6b_A Pffabz, fatty acid synthesis protein; malaria, beta-hydroxyacyl-ACP dehydra fatty acid biosynthesis, SAD phasing, lyase; 2.09A {Plasmodium falciparum} SCOP: d.38.1.6 PDB: 3az8_A* 3az9_A* 3aza_A* 3azb_A* 1zhg_A 2oki_A 2okh_A | Back alignment and structure |
|---|
| >1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4 | Back alignment and structure |
|---|
| >3k67_A Putative dehydratase AF1124; hypothetical protein AF1124, structural genomics, PSI, protein structure initiative; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A | Back alignment and structure |
|---|
| >3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A | Back alignment and structure |
|---|
| >3bnv_A CJ0977; virulence factor, hot-DOG fold, flagel unknown function; HET: MSE; 2.60A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >2egj_A Hypothetical protein AQ_1494; structural genomics; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A | Back alignment and structure |
|---|
| >3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >4ffu_A Oxidase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgrc, PS biology; HET: MSE; 1.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.00A {Pseudomonas putida} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae} | Back alignment and structure |
|---|
| >3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structur genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >3qoo_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, hot-DOG superfamily; 1.25A {Thermanaerovibrio acidaminovorans} | Back alignment and structure |
|---|
| >3r87_A Putative uncharacterized protein; unknown function; 1.05A {Photobacterium profundum} | Back alignment and structure |
|---|
| >2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >3r87_A Putative uncharacterized protein; unknown function; 1.05A {Photobacterium profundum} | Back alignment and structure |
|---|
| >3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* | Back alignment and structure |
|---|
| >2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 | Back alignment and structure |
|---|
| >2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A | Back alignment and structure |
|---|
| >2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A | Back alignment and structure |
|---|
| >1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 | Back alignment and structure |
|---|
| >3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus} | Back alignment and structure |
|---|
| >1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A* | Back alignment and structure |
|---|
| >1z54_A Probable thioesterase; hypothetical protein, structural genom NPPSFA, riken structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} | Back alignment and structure |
|---|
| >1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A | Back alignment and structure |
|---|
| >2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A | Back alignment and structure |
|---|
| >4i4j_A ACP-polyene thioesterase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: TAR; 2.78A {Streptomyces globisporus} | Back alignment and structure |
|---|
| >1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S | Back alignment and structure |
|---|
| >2q78_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE MLC; 2.20A {Thermotoga maritima MSB8} SCOP: d.38.1.7 | Back alignment and structure |
|---|
| >2c2i_A RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} SCOP: d.38.1.4 | Back alignment and structure |
|---|
| >2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A 3k67_A | Back alignment and structure |
|---|
| >1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >4ien_A Putative acyl-COA hydrolase; hot DOG fold; HET: COA GDP; 2.00A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} | Back alignment and structure |
|---|
| >4i4j_A ACP-polyene thioesterase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: TAR; 2.78A {Streptomyces globisporus} | Back alignment and structure |
|---|
| >2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioest hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* | Back alignment and structure |
|---|
| >3qoo_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, hot-DOG superfamily; 1.25A {Thermanaerovibrio acidaminovorans} | Back alignment and structure |
|---|
| >3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; FABZ, hot DOG fold, dehydratase, lipid biosynthesis, lipid synthesis, lyase; HET: MSE; 2.59A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >4ffu_A Oxidase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgrc, PS biology; HET: MSE; 1.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae} | Back alignment and structure |
|---|
| >4b0b_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; lyase, fatty acid biosynthesis, bacterial virulence, drug DI; HET: 54F; 1.90A {Pseudomonas aeruginosa} PDB: 4b0c_A* 4b0j_A* 4b8u_A* 4b0i_A* | Back alignment and structure |
|---|
| >3kuv_A Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA thioesterase FLK, hot DOG folding, thioeste hydrolase; 1.50A {Streptomyces cattleya} PDB: 3kuw_A 3kvu_A* 3p2q_A 3p2r_A 3p2s_A 3kv7_A 3kv8_A 3kvz_A* 3kw1_A* 3kx7_A 3kx8_A 3kvi_A 3p3i_A 3p3f_A | Back alignment and structure |
|---|
| >3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A | Back alignment and structure |
|---|
| >3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} | Back alignment and structure |
|---|
| >2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 | Back alignment and structure |
|---|
| >3q62_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; structural genomics, center for structural genomics of infec diseases, csgid; HET: MES; 1.40A {Yersinia pseudotuberculosis} SCOP: d.38.1.2 PDB: 1mka_A* 1mkb_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 430 | ||||
| d1c8ua2 | 171 | d.38.1.3 (A:116-286) Thioesterase II (TesB) {Esche | 3e-44 | |
| d1c8ua1 | 114 | d.38.1.3 (A:2-115) Thioesterase II (TesB) {Escheri | 3e-42 | |
| d1tbua1 | 104 | d.38.1.3 (A:13-116) Peroxisomal long-chain acyl-Co | 6e-41 | |
| d1cx4a2 | 147 | b.82.3.2 (A:266-412) Regulatory subunit of Protein | 2e-11 | |
| d1o7fa2 | 155 | b.82.3.2 (A:13-167) Regulatory domain of Epac2, do | 6e-10 | |
| d1vp6a_ | 133 | b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizo | 6e-10 | |
| d1ne6a2 | 132 | b.82.3.2 (A:245-376) Regulatory subunit of Protein | 6e-10 | |
| d1cx4a1 | 136 | b.82.3.2 (A:130-265) Regulatory subunit of Protein | 1e-09 | |
| d1ne6a1 | 136 | b.82.3.2 (A:109-244) Regulatory subunit of Protein | 2e-09 | |
| d1i5za2 | 132 | b.82.3.2 (A:6-137) Catabolite gene activator prote | 1e-08 | |
| d1o7fa3 | 124 | b.82.3.2 (A:322-445) Regulatory domain of Epac2, d | 2e-08 | |
| d1wgpa_ | 137 | b.82.3.2 (A:) Probable cyclic nucleotide-gated ion | 1e-07 | |
| d2gaua2 | 142 | b.82.3.2 (A:10-151) Transcriptional regulator PG03 | 1e-06 | |
| d2oz6a2 | 134 | b.82.3.2 (A:9-142) Cyclic AMP receptor-like protei | 4e-05 | |
| d3e5ua2 | 139 | b.82.3.2 (A:9-147) Chlorophenol reduction protein | 6e-05 | |
| d1zyba2 | 147 | b.82.3.2 (A:1-147) Probable transcription regulato | 1e-04 | |
| d1ft9a2 | 132 | b.82.3.1 (A:2-133) CO-sensing protein CooA, N-term | 0.001 | |
| d1o5la1 | 129 | b.82.3.2 (A:1-129) CRP-like transcriptional regula | 0.002 |
| >d1c8ua2 d.38.1.3 (A:116-286) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]} Length = 171 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Thioesterase/thiol ester dehydrase-isomerase superfamily: Thioesterase/thiol ester dehydrase-isomerase family: Acyl-CoA thioesterase domain: Thioesterase II (TesB) species: Escherichia coli [TaxId: 562]
Score = 149 bits (378), Expect = 3e-44
Identities = 62/176 (35%), Positives = 94/176 (53%), Gaps = 9/176 (5%)
Query: 246 EHQETTMPLVPAPEMLLSMEELRERRLTDPRLPRSYRNKVASKEFVPWPIDIRFCEPNSY 305
EHQ+T MP PAP+ L S ++ + LP ++K P+++R E ++
Sbjct: 1 EHQKT-MPSAPAPDGLPSETQIAQSL--AHLLPPVLKDKFIC----DRPLEVRPVEFHNP 53
Query: 306 TNQSKSPPSLRYWFRAKGKLSDDQALHRCVVAFASDLIFSSVSLNPHRRKGFRTA--SLS 363
+ P + W RA G + DD +H+ ++ +ASDL F V+L PH +
Sbjct: 54 LKGHVAEPHRQVWIRANGSVPDDLRVHQYLLGYASDLNFLPVALQPHGIGFLEPGIQIAT 113
Query: 364 LDHSMWFHRSFRADDWLLFVIVSPVASKARGFVSGEMFNTKGELLVSLTQEALLRS 419
+DHSMWFHR F ++WLL+ + S AS ARGFV GE + G L+ S QE ++R+
Sbjct: 114 IDHSMWFHRPFNLNEWLLYSVESTSASSARGFVRGEFYTQDGVLVASTVQEGVMRN 169
|
| >d1c8ua1 d.38.1.3 (A:2-115) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]} Length = 114 | Back information, alignment and structure |
|---|
| >d1tbua1 d.38.1.3 (A:13-116) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 104 | Back information, alignment and structure |
|---|
| >d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 147 | Back information, alignment and structure |
|---|
| >d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 155 | Back information, alignment and structure |
|---|
| >d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Length = 133 | Back information, alignment and structure |
|---|
| >d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 132 | Back information, alignment and structure |
|---|
| >d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 | Back information, alignment and structure |
|---|
| >d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 136 | Back information, alignment and structure |
|---|
| >d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 132 | Back information, alignment and structure |
|---|
| >d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 124 | Back information, alignment and structure |
|---|
| >d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 137 | Back information, alignment and structure |
|---|
| >d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Length = 142 | Back information, alignment and structure |
|---|
| >d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 | Back information, alignment and structure |
|---|
| >d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Length = 139 | Back information, alignment and structure |
|---|
| >d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 147 | Back information, alignment and structure |
|---|
| >d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Length = 132 | Back information, alignment and structure |
|---|
| >d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 129 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 430 | |||
| d1c8ua2 | 171 | Thioesterase II (TesB) {Escherichia coli [TaxId: 5 | 100.0 | |
| d1c8ua1 | 114 | Thioesterase II (TesB) {Escherichia coli [TaxId: 5 | 99.97 | |
| d1tbua1 | 104 | Peroxisomal long-chain acyl-CoA thioesterase 1, TE | 99.96 | |
| d1ne6a2 | 132 | Regulatory subunit of Protein kinase A {Cow (Bos t | 99.74 | |
| d1cx4a2 | 147 | Regulatory subunit of Protein kinase A {Rat (Rattu | 99.71 | |
| d1cx4a1 | 136 | Regulatory subunit of Protein kinase A {Rat (Rattu | 99.71 | |
| d1zyba2 | 147 | Probable transcription regulator BT4300, N-termina | 99.7 | |
| d1o7fa2 | 155 | Regulatory domain of Epac2, domains 1 and 3 {Mouse | 99.7 | |
| d1ne6a1 | 136 | Regulatory subunit of Protein kinase A {Cow (Bos t | 99.69 | |
| d1wgpa_ | 137 | Probable cyclic nucleotide-gated ion channel 6 {Th | 99.68 | |
| d1o7fa3 | 124 | Regulatory domain of Epac2, domains 1 and 3 {Mouse | 99.66 | |
| d1vp6a_ | 133 | Putative ion channel CnbD {Mesorhizobium loti [Tax | 99.63 | |
| d2gaua2 | 142 | Transcriptional regulator PG0396, N-terminal domai | 99.61 | |
| d1i5za2 | 132 | Catabolite gene activator protein, N-terminal doma | 99.6 | |
| d2oz6a2 | 134 | Cyclic AMP receptor-like protein Vfr {Pseudomonas | 99.57 | |
| d3e5ua2 | 139 | Chlorophenol reduction protein CprK {Desulfitobact | 99.56 | |
| d1ft9a2 | 132 | CO-sensing protein CooA, N-terminal domain {Rhodos | 99.5 | |
| d2zcwa2 | 112 | Transcriptional regulator TTHA1359, N-terminal dom | 99.49 | |
| d1q3ea_ | 193 | HCN pacemaker channel {Mouse (Mus musculus) [TaxId | 99.48 | |
| d1o5la1 | 129 | CRP-like transcriptional regulator TM1171, N-termi | 99.48 | |
| d1vh5a_ | 138 | Hypothetical protein YdiI {Escherichia coli [TaxId | 98.35 | |
| d1zkia1 | 126 | Hypothetical protein PA5202 {Pseudomonas aeruginos | 98.33 | |
| d1ixla_ | 130 | Hypothetical protein PH1136 {Archaeon Pyrococcus h | 98.31 | |
| d1wlua1 | 116 | Phenylacetic acid degradation protein PaaI {Thermu | 98.28 | |
| d1sc0a_ | 137 | Hypothetical protein HI1161 {Haemophilus influenza | 98.28 | |
| d1vh9a_ | 138 | Hypothetical protein YbdB {Escherichia coli [TaxId | 98.27 | |
| d2f0xa1 | 136 | Hypothetical protein Them2 {Human (Homo sapiens) [ | 98.15 | |
| d2fs2a1 | 131 | Phenylacetic acid degradation protein PaaI {Escher | 98.14 | |
| d1q4ua_ | 140 | 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp | 98.03 | |
| d2hboa1 | 142 | Hypothetical protein CC3309 {Caulobacter crescentu | 98.0 | |
| d2f41a1 | 111 | Transcription factor FapR, C-terminal domain {Baci | 97.9 | |
| d1sc0a_ | 137 | Hypothetical protein HI1161 {Haemophilus influenza | 97.76 | |
| d1vh5a_ | 138 | Hypothetical protein YdiI {Escherichia coli [TaxId | 97.74 | |
| d1vh9a_ | 138 | Hypothetical protein YbdB {Escherichia coli [TaxId | 97.67 | |
| d1q4ua_ | 140 | 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp | 97.62 | |
| d2gvha1 | 135 | Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter | 97.44 | |
| d2f0xa1 | 136 | Hypothetical protein Them2 {Human (Homo sapiens) [ | 97.41 | |
| d2fs2a1 | 131 | Phenylacetic acid degradation protein PaaI {Escher | 97.34 | |
| d2ov9a1 | 203 | Hypothetical protein RHA1_ro05818 {Rhodococcus sp. | 97.33 | |
| d1t82a_ | 143 | Putative thioesterase SO4397 {Shewanella oneidensi | 97.19 | |
| d1wlua1 | 116 | Phenylacetic acid degradation protein PaaI {Thermu | 97.07 | |
| d2hboa1 | 142 | Hypothetical protein CC3309 {Caulobacter crescentu | 97.06 | |
| d2gvha2 | 116 | Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter | 96.94 | |
| d1ylia1 | 142 | Putative acyl-coa thioester hydrolase HI0827 {Haem | 96.91 | |
| d1y7ua1 | 164 | Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: | 96.86 | |
| d1ixla_ | 130 | Hypothetical protein PH1136 {Archaeon Pyrococcus h | 96.79 | |
| d1zkia1 | 126 | Hypothetical protein PA5202 {Pseudomonas aeruginos | 96.6 | |
| d1sh8a_ | 153 | Hypothetical protein PA5026 {Pseudomonas aeruginos | 96.51 | |
| d1vpma_ | 155 | Acyl-CoA hydrolase BH0798 {Bacillus halodurans [Ta | 96.47 | |
| d1yoca1 | 145 | Hypothetical protein PA1835 {Pseudomonas aeruginos | 96.43 | |
| d2ov9a1 | 203 | Hypothetical protein RHA1_ro05818 {Rhodococcus sp. | 96.28 | |
| d2cwza1 | 138 | Hypothetical protein TTHA0967 {Thermus thermophilu | 95.55 | |
| d1u1za_ | 145 | (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomo | 95.07 | |
| d1sh8a_ | 153 | Hypothetical protein PA5026 {Pseudomonas aeruginos | 94.93 | |
| d2cwza1 | 138 | Hypothetical protein TTHA0967 {Thermus thermophilu | 94.59 | |
| d2b3na1 | 154 | Hypothetical protein AF1124 {Archaeon Archaeoglobu | 94.41 | |
| d1iq6a_ | 132 | (R)-specific enoyl-CoA hydratase {Aeromonas caviae | 94.18 | |
| d2f41a1 | 111 | Transcription factor FapR, C-terminal domain {Baci | 93.84 | |
| d1s5ua_ | 129 | Hypothetical protein YbgC {Escherichia coli [TaxId | 93.77 | |
| d2owna2 | 109 | Putative oleoyl-ACP thioesterase LP0708 {Lactobaci | 93.54 | |
| d2oiwa1 | 131 | GK1870 orthologue {Bacillus stearothermophilus [Ta | 93.48 | |
| d2essa1 | 149 | Acyl-ACP thioesterase {Bacteroides thetaiotaomicro | 93.33 | |
| d2oafa1 | 143 | Hypothetical protein Jann0674 {Jannaschia sp. ccs1 | 92.81 | |
| d2gf6a1 | 134 | Hypothetical protein SSO2295 {Archaeon Sulfolobus | 91.02 | |
| d1pn2a2 | 124 | 2-enoyl-coa hydratase domain of multifunctional pe | 90.93 | |
| d2hx5a1 | 144 | Hypothetical protein PMT2055 {Prochlorococcus mari | 90.6 | |
| d1t82a_ | 143 | Putative thioesterase SO4397 {Shewanella oneidensi | 90.47 | |
| d1z54a1 | 132 | Probable thioesterase TTHA0908 {Thermus thermophil | 90.47 | |
| d2fuja1 | 118 | Hypothetical protein XCC1147 {Xanthomonas campestr | 90.13 | |
| d2cyea1 | 132 | Probable thioesterase TTHA1846 {Thermus thermophil | 90.12 | |
| d2owna1 | 147 | Putative oleoyl-ACP thioesterase LP0708 {Lactobaci | 90.09 | |
| d1yoca1 | 145 | Hypothetical protein PA1835 {Pseudomonas aeruginos | 89.83 | |
| d1s9ca2 | 154 | 2-enoyl-coa hydratase domain of multifunctional pe | 89.69 | |
| d2bi0a1 | 178 | Hypothetical protein Rv0216/MT0226 {Mycobacterium | 89.25 | |
| d2hlja1 | 156 | Hypothetical protein PP0301 {Pseudomonas putida [T | 88.84 | |
| d2hx5a1 | 144 | Hypothetical protein PMT2055 {Prochlorococcus mari | 88.72 | |
| d1pn2a1 | 148 | 2-enoyl-coa hydratase domain of multifunctional pe | 88.14 | |
| d1yhfa1 | 112 | Hypothetical protein SPy1581 {Streptococcus pyogen | 88.12 | |
| d1z54a1 | 132 | Probable thioesterase TTHA0908 {Thermus thermophil | 87.05 | |
| d2nuja1 | 159 | Hypothetical protein Jann_1972 {Jannaschia sp. CCS | 86.88 | |
| d2bgca2 | 131 | Listeriolysin regulatory protein PrfA, N-terminal | 86.61 | |
| d2oafa1 | 143 | Hypothetical protein Jann0674 {Jannaschia sp. ccs1 | 86.53 | |
| d1z6ba1 | 146 | (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria | 86.51 | |
| d1s9ca1 | 126 | 2-enoyl-coa hydratase domain of multifunctional pe | 86.44 | |
| d1s5ua_ | 129 | Hypothetical protein YbgC {Escherichia coli [TaxId | 86.25 | |
| d1njka_ | 133 | Hypothetical protein YbaW {Escherichia coli [TaxId | 85.85 | |
| d2o5ua1 | 139 | Hypothetical thioesterase PA5185 {Pseudomonas aeru | 85.14 | |
| d2bi0a1 | 178 | Hypothetical protein Rv0216/MT0226 {Mycobacterium | 84.03 | |
| d1lo7a_ | 140 | 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp. | 83.98 | |
| d1lo7a_ | 140 | 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp. | 83.95 | |
| d2gf6a1 | 134 | Hypothetical protein SSO2295 {Archaeon Sulfolobus | 83.72 | |
| d1q6wa_ | 151 | Monoamine oxidase regulatory protein {Archaeon Arc | 83.61 | |
| d2essa2 | 98 | Acyl-ACP thioesterase {Bacteroides thetaiotaomicro | 83.54 | |
| d1q6wa_ | 151 | Monoamine oxidase regulatory protein {Archaeon Arc | 82.55 | |
| d2cyea1 | 132 | Probable thioesterase TTHA1846 {Thermus thermophil | 81.97 | |
| d2owna1 | 147 | Putative oleoyl-ACP thioesterase LP0708 {Lactobaci | 81.53 | |
| d2gvha1 | 135 | Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter | 81.43 | |
| d2essa1 | 149 | Acyl-ACP thioesterase {Bacteroides thetaiotaomicro | 81.01 | |
| d1o5ua_ | 88 | Hypothetical protein TM1112 {Thermotoga maritima [ | 80.45 | |
| d2fuja1 | 118 | Hypothetical protein XCC1147 {Xanthomonas campestr | 80.21 |
| >d1c8ua2 d.38.1.3 (A:116-286) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Thioesterase/thiol ester dehydrase-isomerase superfamily: Thioesterase/thiol ester dehydrase-isomerase family: Acyl-CoA thioesterase domain: Thioesterase II (TesB) species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=2.8e-36 Score=258.84 Aligned_cols=169 Identities=37% Similarity=0.649 Sum_probs=144.0
Q ss_pred ccCccCCCCCCCCCCCCCHHHHHHhhcCCCCCchhhHhhhhccCCCCCCeEEEEcCCCCCCCCCCCCCeeEEEEecCCCC
Q 040957 246 EHQETTMPLVPAPEMLLSMEELRERRLTDPRLPRSYRNKVASKEFVPWPIDIRFCEPNSYTNQSKSPPSLRYWFRAKGKL 325 (430)
Q Consensus 246 ~~~~~~~p~~p~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~r~~~~~~~~~~~~~~~~~~~W~R~~~~~ 325 (430)
+||.. ||+||+||+|++..+....+. ..+|....+.+ ....+||+|.+.+.........+++..+|+|.++.+
T Consensus 1 EHq~~-MP~VP~PE~lp~~~e~~~~~~--~~~~~~~~~~~----~~~rp~e~R~~~~~~~~~~~~~~~~~~~W~R~~~~l 73 (171)
T d1c8ua2 1 EHQKT-MPSAPAPDGLPSETQIAQSLA--HLLPPVLKDKF----ICDRPLEVRPVEFHNPLKGHVAEPHRQVWIRANGSV 73 (171)
T ss_dssp CEECC-CCCCCCSTTCCCHHHHHHHHT--CCSCHHHHTTS----CSCCSEEEEESSCCCTTTCCCCCSEEEEEEEESSCC
T ss_pred CCCCC-CCCCcCcccCCCHHHHHHHhh--ccCCHHHhhcc----ccCCceeEEecccCCccccccccceEEEEEeccCCC
Confidence 36655 999999999999888776553 23555543322 224689999998877665566778999999999999
Q ss_pred CCChHHHHHHHHHHhhhhhhhhhcccCccC--CCcceeeecceeeeccCCCCCCCeEEeEEeecceeCCeeeEEEEEEcc
Q 040957 326 SDDQALHRCVVAFASDLIFSSVSLNPHRRK--GFRTASLSLDHSMWFHRSFRADDWLLFVIVSPVASKARGFVSGEMFNT 403 (430)
Q Consensus 326 ~~~~~~~~~~la~~sD~~~~~~~~~~~~~~--~~~~~~~sld~si~f~~~~~~~~W~l~~~~~~~~~~gr~~~~~~i~~~ 403 (430)
++++.+|.++|||+||+.++.+++.||+.. .....++||||+||||+|+++++|+||+++++++++||++++|+|||+
T Consensus 74 ~dd~~~h~a~LAy~SD~~ll~ta~~~~~~~~~~~~~~~aSLDH~~wFH~~~~~~~WlL~~~~s~~a~~gRgl~~g~i~~~ 153 (171)
T d1c8ua2 74 PDDLRVHQYLLGYASDLNFLPVALQPHGIGFLEPGIQIATIDHSMWFHRPFNLNEWLLYSVESTSASSARGFVRGEFYTQ 153 (171)
T ss_dssp CSCHHHHHHHHHHHTTSSSGGGGGGGGTCCTTSTTEEEEEEEEEEEECSCCCTTSCEEEEEEEEEEETTEEEEEEEEEET
T ss_pred CccHHHHHHHHHHhhhhHHHHHHhhhccccccCCceeeEeeeeEEEEecCcccceeEEEEEECccccCCeeEEEEEEECC
Confidence 999999999999999999999999998754 233568999999999999999999999999999999999999999999
Q ss_pred CCCEEEEEeccceeccCC
Q 040957 404 KGELLVSLTQEALLRSPK 421 (430)
Q Consensus 404 ~G~lvA~~~Q~~l~r~~~ 421 (430)
||+||||++||||+|.++
T Consensus 154 dG~LvAs~~QEgl~R~~~ 171 (171)
T d1c8ua2 154 DGVLVASTVQEGVMRNHN 171 (171)
T ss_dssp TCCEEEEEEEEEEEEECC
T ss_pred CCCEEEEEEEEEEEEecC
Confidence 999999999999999763
|
| >d1c8ua1 d.38.1.3 (A:2-115) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tbua1 d.38.1.3 (A:13-116) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} | Back information, alignment and structure |
|---|
| >d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]} | Back information, alignment and structure |
|---|
| >d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]} | Back information, alignment and structure |
|---|
| >d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d1t82a_ d.38.1.5 (A:) Putative thioesterase SO4397 {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sh8a_ d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1yoca1 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1u1za_ d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sh8a_ d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2b3na1 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]} | Back information, alignment and structure |
|---|
| >d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]} | Back information, alignment and structure |
|---|
| >d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1pn2a2 d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]} | Back information, alignment and structure |
|---|
| >d1t82a_ d.38.1.5 (A:) Putative thioesterase SO4397 {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]} | Back information, alignment and structure |
|---|
| >d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d1yoca1 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1s9ca2 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]} | Back information, alignment and structure |
|---|
| >d1pn2a1 d.38.1.4 (A:4-151) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]} | Back information, alignment and structure |
|---|
| >d2bgca2 b.82.3.3 (A:7-137) Listeriolysin regulatory protein PrfA, N-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]} | Back information, alignment and structure |
|---|
| >d1z6ba1 d.38.1.6 (A:84-229) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1s9ca1 d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1q6wa_ d.38.1.4 (A:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2essa2 d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1q6wa_ d.38.1.4 (A:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]} | Back information, alignment and structure |
|---|