Citrus Sinensis ID: 040974

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------37
FLITVSSESNEEADALLKWKASLQNHNRSLLSSWVKDTTNVSSKTSPCAWYGISCNDAGRVDNITLPAKGLKGKLHDFSFSLFPHLAYLDLSYNKLFGTIPPQISNLTNLIHLYFGGNQFSGNIPPEVGLMSHLMFLYIDTNHLDGSIPPELGQLSSIVELSLFSNHLNGSVPPSLSNLTDLFILFLQDNSFSGFIPPDIGNSKSMSVLYLSSNKFSGPIPLSFGNLSNLNSLHLYGNSVSGSIPSSLGKLKSLFNLQLKGNQLTGYIPSSFRNLTGLLSLLLSQNKLFGSIPDEIGKMRSLSILDLSQNQFKGVLPPSVSNLTNLKELVLLYNNLSGSIPPLLENPMLTQLSLDNNHFTGYLPHNVCR
cEEEcccccHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEEEcccccEEEEEccccccEEEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccccEEEccccEEEccccccccccccccEEEccccEEEEcccHHcccccccccEEccccccccccccccccccccccEEcccccccccccHHccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHcccccccccccccEEEEccccccccccccEEEccccEEEccccccccc
cEEEEEccccHHHHHHHHHHHHcccccccHccccccccccccccccccccEEEEEcccccEEEEEEccccccccccHHHHcccccccEEEcccccEEccccHHHHHcccccEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccEEccccccccccccEEEcccccccEEccHHHcccccEEEEcccccccccccHHccc
flitvsseSNEEADALLKWKASLQNHNRSLLSSWVKdttnvssktspcawygiscndagrvdnitlpakglkgklhdfsfslfphlayldlsynklfgtippqisnlTNLIHLYfggnqfsgnippevglMSHLMFLYIDtnhldgsippelgqlsSIVELSLfsnhlngsvppslsnlTDLFILFLqdnsfsgfippdignsksMSVLYLSsnkfsgpiplsfgnlsnlnslhlygnsvsgsipsslGKLKSLFNLqlkgnqltgyipssFRNLTGLLSLLLSQNklfgsipdeigKMRSLSILDlsqnqfkgvlppsvsnltnLKELVLLYNNlsgsippllenpmltqlsldnnhftgylphnvcr
flitvssesneEADALLKWKASLQNHNRSLLSSWVKDTTNVSSKTSPCAWYGISCNDAGRVDNITLPAKGLKGKLHDFSFSLFPHLAYLDLSYNKLFGTIPPQISNLTNLIHLYFGGNQFSGNIPPEVGLMSHLMFLYIDTNHLDGSIPPELGQLSSIVELSLFSNHLNGSVPPSLSNLTDLFILFLQDNSFSGFIPPDIGNSKSMSVLYLSSNKFSGPIPLSFGNLSNLNSLHLYGNSVSGSIPSSLGKLKSLFNLQLKGNQLTGYIPSSFRNLTGLLSLLLSQNKLFGSIPDEIGKMRSLSILDLSQNQFKGVLPPSVSNLTNLKELVLLYNNLSGSIPPLLENPMLTQLSLDNNHFTGYLPHNVCR
FLITVSSESNEEADALLKWKASLQNHNRSLLSSWVKDTTNVSSKTSPCAWYGISCNDAGRVDNITLPAKGLKGKLHDFSFSLFPHLAYLDLSYNKLFGTIPPQISNLTNLIHLYFGGNQFSGNIPPEVGLMSHLMFLYIDTNHLDGSIPPELGQLSSIVELSLFSNHLNGSVPPSLSNLTDLFILFLQDNSFSGFIPPDIGNSKSMSVLYLSSNKFSGPIPlsfgnlsnlnslhlygnsVSGSIPSSLGKLKSLFNLQLKGNQLTGYIPSSFRNLTGllslllsQNKLFGSIPDEIGKMRSLSILDLSQNQFKGVLPPSVSNLTNLKELVLLYNNLSGSIPPLLENPMLTQLSLDNNHFTGYLPHNVCR
****************LKWKASLQ*HNRSLLSSWVKDTTNVSSKTSPCAWYGISCNDAGRVDNITLPAKGLKGKLHDFSFSLFPHLAYLDLSYNKLFGTIPPQISNLTNLIHLYFGGNQFSGNIPPEVGLMSHLMFLYIDTNHLDGSIPPELGQLSSIVELSLFSNHLNGSVPPSLSNLTDLFILFLQDNSFSGFIPPDIGNSKSMSVLYLSSNKFSGPIPLSFGNLSNLNSLHLYGNSVSGSIPSSLGKLKSLFNLQLKGNQLTGYIPSSFRNLTGLLSLLLSQNKLFGSIPDEIGKMRSLSILDLSQNQFKGVLPPSVSNLTNLKELVLLYNNLSGSIPPLLENPMLTQLSLDNNHFTGYLPH****
FLITV**ESNEEADALLKWKASLQNHNRSLLSSWVKDTTNVSSKTSPCAWYGISCNDAGRVDNITLPAKGLKGKLHDFSFSLFPHLAYLDLSYNKLFGTIPPQISNLTNLIHLYFGGNQFSGNIPPEVGLMSHLMFLYIDTNHLDGSIPPELGQLSSIVELSLFSNHLNGSVPPSLSNLTDLFILFLQDNSFSGFIPPDIGNSKSMSVLYLSSNKFSGPIPLSFGNLSNLNSLHLYGNSVSGSIPSSLGKLKSLFNLQLKGNQLTGYIPSSFRNLTGLLSLLLSQNKLFGSIPDEIGKMRSLSILDLSQNQFKGVLPPSVSNLTNLKELVLLYNNLSGSIPPLLENPMLTQLSLDNNHFTGYLPHNVCR
*************DALLKWKASLQNHNRSLLSSWVKD********SPCAWYGISCNDAGRVDNITLPAKGLKGKLHDFSFSLFPHLAYLDLSYNKLFGTIPPQISNLTNLIHLYFGGNQFSGNIPPEVGLMSHLMFLYIDTNHLDGSIPPELGQLSSIVELSLFSNHLNGSVPPSLSNLTDLFILFLQDNSFSGFIPPDIGNSKSMSVLYLSSNKFSGPIPLSFGNLSNLNSLHLYGNSVSGSIPSSLGKLKSLFNLQLKGNQLTGYIPSSFRNLTGLLSLLLSQNKLFGSIPDEIGKMRSLSILDLSQNQFKGVLPPSVSNLTNLKELVLLYNNLSGSIPPLLENPMLTQLSLDNNHFTGYLPHNVCR
FLITVSSESNEEADALLKWKASLQNHNRSLLSSWVKDT***SSKTSPCAWYGISCNDAGRVDNITLPAKGLKGKLHDFSFSLFPHLAYLDLSYNKLFGTIPPQISNLTNLIHLYFGGNQFSGNIPPEVGLMSHLMFLYIDTNHLDGSIPPELGQLSSIVELSLFSNHLNGSVPPSLSNLTDLFILFLQDNSFSGFIPPDIGNSKSMSVLYLSSNKFSGPIPLSFGNLSNLNSLHLYGNSVSGSIPSSLGKLKSLFNLQLKGNQLTGYIPSSFRNLTGLLSLLLSQNKLFGSIPDEIGKMRSLSILDLSQNQFKGVLPPSVSNLTNLKELVLLYNNLSGSIPPLLENPMLTQLSLDNNHFTGYLPH**C*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FLITVSSESNEEADALLKWKASLQNHNRSLLSSWVKDTTNVSSKTSPCAWYGISCNDAGRVDNITLPAKGLKGKLHDFSFSLFPHLAYLDLSYNKLFGTIPPQISNLTNLIHLYFGGNQFSGNIPPEVGLMSHLMFLYIDTNHLDGSIPPELGQLSSIVELSLFSNHLNGSVPPSLSNLTDLFILFLQDNSFSGFIPPDIGNSKSMSVLYLSSNKFSGPIPLSFGNLSNLNSLHLYGNSVSGSIPSSLGKLKSLFNLQLKGNQLTGYIPSSFRNLTGLLSLLLSQNKLFGSIPDEIGKMRSLSILDLSQNQFKGVLPPSVSNLTNLKELVLLYNNLSGSIPPLLENPMLTQLSLDNNHFTGYLPHNVCR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query369 2.2.26 [Sep-21-2011]
Q9LP24 1120 Probable leucine-rich rep yes no 0.948 0.312 0.454 7e-76
Q8VZG8 1045 Probable LRR receptor-lik no no 0.967 0.341 0.434 6e-71
C0LGR3 1091 Probable LRR receptor-lik no no 0.940 0.318 0.399 9e-56
C0LGV1 1135 LRR receptor-like serine/ no no 0.975 0.317 0.377 2e-53
C0LGQ5 1249 LRR receptor-like serine/ no no 0.945 0.279 0.397 2e-53
Q9FL28 1173 LRR receptor-like serine/ no no 0.972 0.306 0.367 6e-51
Q9SHI2 1101 Leucine-rich repeat recep no no 0.948 0.317 0.376 7e-50
P93194 1109 Receptor-like protein kin N/A no 0.883 0.293 0.34 1e-49
Q9FRS6 1029 Leucine-rich repeat recep no no 0.983 0.352 0.351 2e-49
O49318 1124 Probable leucine-rich rep no no 0.869 0.285 0.366 1e-48
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function desciption
 Score =  284 bits (727), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 161/354 (45%), Positives = 221/354 (62%), Gaps = 4/354 (1%)

Query: 12  EADALLKWKASLQNHNRSLLSSWVKDTTNVSSKTSPCAWYGISCNDAGRVDNITLPAKGL 71
           EA+ALLKWK++  N ++  LSSWV D  N ++  S  +WYG+SCN  G ++ + L   G+
Sbjct: 33  EANALLKWKSTFTNSSK--LSSWVHDA-NTNTSFSCTSWYGVSCNSRGSIEELNLTNTGI 89

Query: 72  KGKLHDFSFSLFPHLAYLDLSYNKLFGTIPPQISNLTNLIHLYFGGNQFSGNIPPEVGLM 131
           +G   DF F    +LAY+DLS N L GTIPPQ  NL+ LI+     N  +G I P +G +
Sbjct: 90  EGTFQDFPFISLSNLAYVDLSMNLLSGTIPPQFGNLSKLIYFDLSTNHLTGEISPSLGNL 149

Query: 132 SHLMFLYIDTNHLDGSIPPELGQLSSIVELSLFSNHLNGSVPPSLSNLTDLFILFLQDNS 191
            +L  LY+  N+L   IP ELG + S+ +L+L  N L GS+P SL NL +L +L+L +N 
Sbjct: 150 KNLTVLYLHQNYLTSVIPSELGNMESMTDLALSQNKLTGSIPSSLGNLKNLMVLYLYENY 209

Query: 192 FSGFIPPDIGNSKSMSVLYLSSNKFSGPIPLSFGNLSNLNSLHLYGNSVSGSIPSSLGKL 251
            +G IPP++GN +SM+ L LS NK +G IP + GNL NL  L+LY N ++G IP  +G +
Sbjct: 210 LTGVIPPELGNMESMTDLALSQNKLTGSIPSTLGNLKNLMVLYLYENYLTGVIPPEIGNM 269

Query: 252 KSLFNLQLKGNQLTGYIPSSFRNLTGLLSLLLSQNKLFGSIPDEIGKMRSLSILDLSQNQ 311
           +S+ NL L  N+LTG IPSS  NL  L  L L QN L G IP ++G + S+  L+LS N+
Sbjct: 270 ESMTNLALSQNKLTGSIPSSLGNLKNLTLLSLFQNYLTGGIPPKLGNIESMIDLELSNNK 329

Query: 312 FKGVLPPSVSNLTNLKELVLLYNNLSGSIPPLLEN-PMLTQLSLDNNHFTGYLP 364
             G +P S+ NL NL  L L  N L+G IPP L N   +  L L+NN  TG +P
Sbjct: 330 LTGSIPSSLGNLKNLTILYLYENYLTGVIPPELGNMESMIDLQLNNNKLTGSIP 383

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=1 SV=1 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description
>sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=2 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query369
225456161 1037 PREDICTED: probable LRR receptor-like se 0.989 0.351 0.504 4e-89
225456159 1038 PREDICTED: probable LRR receptor-like se 0.989 0.351 0.509 6e-89
147767326 1032 hypothetical protein VITISV_008862 [Viti 0.986 0.352 0.495 3e-85
359491509 1032 PREDICTED: probable LRR receptor-like se 0.986 0.352 0.490 3e-84
3894387 944 Hcr2-0B [Solanum lycopersicum] 0.964 0.377 0.480 2e-77
3894383 968 disease resistance protein [Solanum lyco 0.964 0.367 0.480 6e-77
3894393 1016 Hcr2-5D [Solanum lycopersicum var. ceras 0.964 0.350 0.480 1e-76
359491512 1078 PREDICTED: probable LRR receptor-like se 0.967 0.331 0.441 1e-76
1184075 1112 Cf-2.1 [Solanum pimpinellifolium] gi|603 0.967 0.321 0.471 6e-76
1184077 1112 Cf-2.2 [Solanum pimpinellifolium] gi|603 0.967 0.321 0.471 6e-76
>gi|225456161|ref|XP_002278590.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  334 bits (857), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 188/373 (50%), Positives = 244/373 (65%), Gaps = 8/373 (2%)

Query: 5   VSSESNEEADALLKWKASLQNHNRSLLSSWV-------KDTTNVSSKTSPCAWYGISCND 57
           VSS SNEE  ALLKWKA+L NHN S L SW          +T++ ++ SPC WYGISCN 
Sbjct: 27  VSSYSNEETQALLKWKATLHNHNHSSLLSWTLYPNNFTNSSTHLGTEVSPCKWYGISCNH 86

Query: 58  AGRVDNITLPAKGLKGKLHDFSFSLFPHLAYLDLSYNKLFGTIPPQISNLTNLIHLYFGG 117
           AG V  I L   GL G L  FSFS FP+LAY+D+S N L G IPPQI  L+ L +L    
Sbjct: 87  AGSVIRINLTESGLGGTLQAFSFSSFPNLAYVDISMNNLSGPIPPQIGLLSKLKYLDLSI 146

Query: 118 NQFSGNIPPEVGLMSHLMFLYIDTNHLDGSIPPELGQLSSIVELSLFSNHLNGSVPPSLS 177
           NQFSG IPPE+GL+++L  L++  N L+GSIP E+GQL+S+ EL+L++N L GS+P SL 
Sbjct: 147 NQFSGGIPPEIGLLTNLEVLHLVQNQLNGSIPHEIGQLTSLYELALYTNQLEGSIPASLG 206

Query: 178 NLTDLFILFLQDNSFSGFIPPDIGNSKSMSVLYLSSNKFSGPIPLSFGNLSNLNSLHLYG 237
           NL++L  L+L +N  SG IPP++GN  ++  LY  +N  +GPIP +FGNL +L  L+L+ 
Sbjct: 207 NLSNLASLYLYENQLSGSIPPEMGNLTNLVQLYSDTNNLTGPIPSTFGNLKHLTVLYLFN 266

Query: 238 NSVSGSIPSSLGKLKSLFNLQLKGNQLTGYIPSSFRNLTGLLSLLLSQNKLFGSIPDEIG 297
           NS+SG IP  +G LKSL  L L GN L+G IP S  +L+GL  L L  N+L G IP EIG
Sbjct: 267 NSLSGPIPPEIGNLKSLQGLSLYGNNLSGPIPVSLCDLSGLTLLHLYANQLSGPIPQEIG 326

Query: 298 KMRSLSILDLSQNQFKGVLPPSVSNLTNLKELVLLYNNLSGSIPPLLEN-PMLTQLSLDN 356
            ++SL  L+LS+NQ  G +P S+ NLTNL+ L L  N LSG  P  +     L  L +D 
Sbjct: 327 NLKSLVDLELSENQLNGSIPTSLGNLTNLEILFLRDNRLSGYFPQEIGKLHKLVVLEIDT 386

Query: 357 NHFTGYLPHNVCR 369
           N   G LP  +C+
Sbjct: 387 NQLFGSLPEGICQ 399

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225456159|ref|XP_002278561.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147767326|emb|CAN68996.1| hypothetical protein VITISV_008862 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491509|ref|XP_002278522.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|3894387|gb|AAC78593.1| Hcr2-0B [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|3894383|gb|AAC78591.1| disease resistance protein [Solanum lycopersicum var. cerasiforme] Back     alignment and taxonomy information
>gi|3894393|gb|AAC78596.1| Hcr2-5D [Solanum lycopersicum var. cerasiforme] Back     alignment and taxonomy information
>gi|359491512|ref|XP_002278614.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|1184075|gb|AAC15779.1| Cf-2.1 [Solanum pimpinellifolium] gi|60327192|gb|AAX19019.1| Cf-2.1 [Solanum pimpinellifolium] gi|1587673|prf||2207203A Cf-2 gene Back     alignment and taxonomy information
>gi|1184077|gb|AAC15780.1| Cf-2.2 [Solanum pimpinellifolium] gi|60327194|gb|AAX19020.1| Cf-2.2 [Solanum pimpinellifolium] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query369
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.964 0.317 0.416 9.4e-70
TAIR|locus:2138268 1045 AT4G08850 [Arabidopsis thalian 0.970 0.342 0.408 1.8e-64
TAIR|locus:2131518 1091 AT4G26540 [Arabidopsis thalian 0.943 0.318 0.369 6.5e-52
TAIR|locus:2161825 1090 AT5G56040 [Arabidopsis thalian 0.943 0.319 0.364 1.8e-51
TAIR|locus:2154344 1135 AT5G48940 [Arabidopsis thalian 0.975 0.317 0.347 1.3e-49
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.943 0.278 0.365 2.5e-48
TAIR|locus:2007918 1088 PEPR2 "PEP1 receptor 2" [Arabi 0.981 0.332 0.334 7.9e-48
TAIR|locus:2025545 1029 AT1G08590 [Arabidopsis thalian 0.981 0.351 0.326 8.7e-48
TAIR|locus:2055772 983 RLP19 "receptor like protein 1 0.951 0.357 0.364 1.2e-47
TAIR|locus:2043540 960 AT2G25790 [Arabidopsis thalian 0.945 0.363 0.352 1e-45
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 713 (256.0 bits), Expect = 9.4e-70, P = 9.4e-70
 Identities = 150/360 (41%), Positives = 210/360 (58%)

Query:     6 SSESNEEADALLKWKASLQNHNRSLLSSWVKDTTNVSSKTSPCAWYGISCNDAGRVDNIT 65
             +S +  EA+ALLKWK++  N ++  LSSWV D  N ++  S  +WYG+SCN  G ++ + 
Sbjct:    27 ASATIAEANALLKWKSTFTNSSK--LSSWVHDA-NTNTSFSCTSWYGVSCNSRGSIEELN 83

Query:    66 LPAKGLKGKLHDFSFSLFPHLAYLDLSYNKLFGTIPPQISNLTNLIHLYFGGNQFSGNIP 125
             L   G++G   DF F    +LAY+DLS N L GTIPPQ  NL+ LI+     N  +G I 
Sbjct:    84 LTNTGIEGTFQDFPFISLSNLAYVDLSMNLLSGTIPPQFGNLSKLIYFDLSTNHLTGEIS 143

Query:   126 PEVGLMSHLMFLYIDTNHLDGSIPPELGQLSSIVELSLFSNHLNGSVPPSLSNLTDLFIL 185
             P +G + +L  LY+  N+L   IP ELG + S+ +L+L  N L GS+P SL NL +L +L
Sbjct:   144 PSLGNLKNLTVLYLHQNYLTSVIPSELGNMESMTDLALSQNKLTGSIPSSLGNLKNLMVL 203

Query:   186 FLQDNSFSGFIPPDIGNSKSMSVLYLSSNKFSGPIPXXXXXXXXXXXXXXXXXXVSGSIP 245
             +L +N  +G IPP++GN +SM+ L LS NK +G IP                  ++G IP
Sbjct:   204 YLYENYLTGVIPPELGNMESMTDLALSQNKLTGSIPSTLGNLKNLMVLYLYENYLTGVIP 263

Query:   246 SSLGKLKSLFNLQLKGNQLTGYIPSSFRNLTGXXXXXXXQNKLFGSIPDEIGKMRSLSIL 305
               +G ++S+ NL L  N+LTG IPSS  NL         QN L G IP ++G + S+  L
Sbjct:   264 PEIGNMESMTNLALSQNKLTGSIPSSLGNLKNLTLLSLFQNYLTGGIPPKLGNIESMIDL 323

Query:   306 DLSQNQFKGVLPPSVSNLTNLKELVLLYNNLSGSIPPLLEN-PMLTQLSLDNNHFTGYLP 364
             +LS N+  G +P S+ NL NL  L L  N L+G IPP L N   +  L L+NN  TG +P
Sbjct:   324 ELSNNKLTGSIPSSLGNLKNLTILYLYENYLTGVIPPELGNMESMIDLQLNNNKLTGSIP 383
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=ISS
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0009814 "defense response, incompatible interaction" evidence=RCA
TAIR|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131518 AT4G26540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161825 AT5G56040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154344 AT5G48940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2007918 PEPR2 "PEP1 receptor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025545 AT1G08590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043540 AT2G25790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00017830001
SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (846 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query369
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-65
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-50
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-47
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-47
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-42
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-42
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-38
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-14
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-10
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 1e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-07
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-06
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-04
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  222 bits (566), Expect = 5e-65
 Identities = 143/360 (39%), Positives = 206/360 (57%), Gaps = 13/360 (3%)

Query: 11  EEADALLKWKASLQNHNRSLLSSWVKDTTNVSSKTSPCAWYGISCNDAGRVDNITLPAKG 70
           EE + LL +K+S+ +  +  LS+W       +S    C W GI+CN++ RV +I L  K 
Sbjct: 29  EELELLLSFKSSINDPLK-YLSNW-------NSSADVCLWQGITCNNSSRVVSIDLSGKN 80

Query: 71  LKGKLHDFSFSLFPHLAYLDLSYNKLFGTIPPQISNLT-NLIHLYFGGNQFSGNIPPEVG 129
           + GK+    F L P++  ++LS N+L G IP  I   + +L +L    N F+G+IP   G
Sbjct: 81  ISGKISSAIFRL-PYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--G 137

Query: 130 LMSHLMFLYIDTNHLDGSIPPELGQLSSIVELSLFSNHLNGSVPPSLSNLTDLFILFLQD 189
            + +L  L +  N L G IP ++G  SS+  L L  N L G +P SL+NLT L  L L  
Sbjct: 138 SIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLAS 197

Query: 190 NSFSGFIPPDIGNSKSMSVLYLSSNKFSGPIPLSFGNLSNLNSLHLYGNSVSGSIPSSLG 249
           N   G IP ++G  KS+  +YL  N  SG IP   G L++LN L L  N+++G IPSSLG
Sbjct: 198 NQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLG 257

Query: 250 KLKSLFNLQLKGNQLTGYIPSSFRNLTGLLSLLLSQNKLFGSIPDEIGKMRSLSILDLSQ 309
            LK+L  L L  N+L+G IP S  +L  L+SL LS N L G IP+ + ++++L IL L  
Sbjct: 258 NLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFS 317

Query: 310 NQFKGVLPPSVSNLTNLKELVLLYNNLSGSIPPLL-ENPMLTQLSLDNNHFTGYLPHNVC 368
           N F G +P ++++L  L+ L L  N  SG IP  L ++  LT L L  N+ TG +P  +C
Sbjct: 318 NNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLC 377

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 369
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.87
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.85
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.83
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
KOG4237498 consensus Extracellular matrix protein slit, conta 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.8
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.78
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.78
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.77
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
PLN03150623 hypothetical protein; Provisional 99.51
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.32
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.24
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.2
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.2
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.2
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.19
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.15
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.15
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.08
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.07
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.03
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.02
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.02
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.02
PLN03150623 hypothetical protein; Provisional 99.01
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.85
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.82
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.82
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.77
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.66
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.59
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.55
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.52
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.51
KOG4341483 consensus F-box protein containing LRR [General fu 98.49
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.44
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.31
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.3
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.3
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.15
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.11
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.06
PRK15386426 type III secretion protein GogB; Provisional 97.94
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.92
PRK15386 426 type III secretion protein GogB; Provisional 97.84
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.81
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.79
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.76
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.75
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.72
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.67
KOG4341483 consensus F-box protein containing LRR [General fu 97.55
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.22
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.19
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.18
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.07
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.06
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.6
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.1
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.11
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.15
KOG4308 478 consensus LRR-containing protein [Function unknown 93.46
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.02
KOG4308 478 consensus LRR-containing protein [Function unknown 90.84
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.68
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 90.19
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.77
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 88.31
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.46
smart0037026 LRR Leucine-rich repeats, outliers. 84.46
KOG0473326 consensus Leucine-rich repeat protein [Function un 84.32
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=7.6e-43  Score=357.52  Aligned_cols=349  Identities=40%  Similarity=0.652  Sum_probs=266.1

Q ss_pred             CHHHHHHHHHHHHhcccCCccccCCCcCCCCCCCCCCCCccccceeeCCCCCEEEEEcCCCCCccccCCcccCCCCCCCE
Q 040974            9 SNEEADALLKWKASLQNHNRSLLSSWVKDTTNVSSKTSPCAWYGISCNDAGRVDNITLPAKGLKGKLHDFSFSLFPHLAY   88 (369)
Q Consensus         9 ~~~~~~~l~~~~~~~~~~~~~~~~~W~~~~~~~~~~~~~c~~~~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~~~~~L~~   88 (369)
                      .+.|+.||++|++.+. ++.....+|.       ...++|.|.|+.|...++|+.++++++.+.+.++.. +..+++|+.
T Consensus        27 ~~~~~~~l~~~~~~~~-~~~~~~~~w~-------~~~~~c~w~gv~c~~~~~v~~L~L~~~~i~~~~~~~-~~~l~~L~~   97 (968)
T PLN00113         27 HAEELELLLSFKSSIN-DPLKYLSNWN-------SSADVCLWQGITCNNSSRVVSIDLSGKNISGKISSA-IFRLPYIQT   97 (968)
T ss_pred             CHHHHHHHHHHHHhCC-CCcccCCCCC-------CCCCCCcCcceecCCCCcEEEEEecCCCccccCChH-HhCCCCCCE
Confidence            6689999999999985 4555668898       667899999999987789999999999998887665 889999999


Q ss_pred             EeCCCCcccccCCcCC-CCCCCCCEEECCCCcCcccCCccccCCCCCcEEEccCCcCCCCCCccccCCCCCcEEEeeccc
Q 040974           89 LDLSYNKLFGTIPPQI-SNLTNLIHLYFGGNQFSGNIPPEVGLMSHLMFLYIDTNHLDGSIPPELGQLSSIVELSLFSNH  167 (369)
Q Consensus        89 L~l~~~~l~~~~~~~l-~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~  167 (369)
                      |++++|.+++.+|..+ ..+++|++|++++|.+.+.+|.  ..+++|++|++++|.+++..|..+.++++|++|++++|.
T Consensus        98 L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~  175 (968)
T PLN00113         98 INLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNV  175 (968)
T ss_pred             EECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCc
Confidence            9999999987777654 4888899999988888766664  346778888888877777777777777788888888777


Q ss_pred             cCCCCCccCCCCCCCCEEEccCccccccCCcCCcCCCCCcEEEccCCcCCCCCcccccCCCCcceeeccccccccccCcc
Q 040974          168 LNGSVPPSLSNLTDLFILFLQDNSFSGFIPPDIGNSKSMSVLYLSSNKFSGPIPLSFGNLSNLNSLHLYGNSVSGSIPSS  247 (369)
Q Consensus       168 ~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~  247 (369)
                      +.+..|..+.++++|++|++++|.+....+..+.++++|++|++++|.+.+..|..+..+++|++|++++|.+.+..|..
T Consensus       176 l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~  255 (968)
T PLN00113        176 LVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSS  255 (968)
T ss_pred             ccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChh
Confidence            77677777777777888877777777666777777777777777777777667777777777777777777776667777


Q ss_pred             ccCCCCCCEEEccCCCCccccchhhhcCCCCCEEEccCCcCcccCCccccCCCCCCEEEccCCcCcccCCccccCCCCCC
Q 040974          248 LGKLKSLFNLQLKGNQLTGYIPSSFRNLTGLLSLLLSQNKLFGSIPDEIGKMRSLSILDLSQNQFKGVLPPSVSNLTNLK  327 (369)
Q Consensus       248 l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~i~~~~~~~l~~~~~L~  327 (369)
                      +..+++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+..|..+..+++|+
T Consensus       256 l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~  335 (968)
T PLN00113        256 LGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQ  335 (968)
T ss_pred             HhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCC
Confidence            77777777777777777666666777777777777777777666666666777777777777777666666666677777


Q ss_pred             EEEccCCcccccCCccCcC-CCCCEEEccCCeecccCCCCcc
Q 040974          328 ELVLLYNNLSGSIPPLLEN-PMLTQLSLDNNHFTGYLPHNVC  368 (369)
Q Consensus       328 ~L~l~~n~~~~~~~~~~~~-~~L~~L~l~~n~~~~~ip~~~~  368 (369)
                      .|++++|.+.+.+|..+.. ++|+.|++++|++++.+|+++|
T Consensus       336 ~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~  377 (968)
T PLN00113        336 VLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLC  377 (968)
T ss_pred             EEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHh
Confidence            7777777776666655544 6677777777776666666554

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query369
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-28
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-28
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-20
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-11
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 6e-04
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 9e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score =  123 bits (308), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 136/285 (47%), Gaps = 4/285 (1%)
Query: 64  ITLPAKGLKGKLHDFSFSLFPHLAYLDLSYNKLFGTIPPQISNLTNLIHLYFGGNQFSGN 123
           ++L      G++ DF       L  LDLS N  +G +PP   + + L  L    N FSG 
Sbjct: 271 LSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGE 330
Query: 124 IPPEVGL-MSHLMFLYIDTNHLDGSIPPELGQLS-SIVELSLFSNHLNGSVPPSLSN--L 179
           +P +  L M  L  L +  N   G +P  L  LS S++ L L SN+ +G + P+L     
Sbjct: 331 LPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPK 390
Query: 180 TDLFILFLQDNSFSGFIPPDIGNSKSMSVLYLSSNKFSGPIPXXXXXXXXXXXXXXXXXX 239
             L  L+LQ+N F+G IPP + N   +  L+LS N  SG IP                  
Sbjct: 391 NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNM 450
Query: 240 VSGSIPSSLGKLKSLFNLQLKGNQLTGYIPSSFRNLTGXXXXXXXQNKLFGSIPDEIGKM 299
           + G IP  L  +K+L  L L  N LTG IPS   N T         N+L G IP  IG++
Sbjct: 451 LEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRL 510
Query: 300 RSLSILDLSQNQFKGVLPPSVSNLTNLKELVLLYNNLSGSIPPLL 344
            +L+IL LS N F G +P  + +  +L  L L  N  +G+IP  +
Sbjct: 511 ENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAM 555
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query369
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-87
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-66
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-19
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-85
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-77
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-75
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-75
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-30
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-53
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-51
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-50
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-50
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-47
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-43
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-29
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-21
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-52
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-47
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-46
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-40
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-33
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-32
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-32
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-45
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-43
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-39
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-37
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-20
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-14
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-44
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-42
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-39
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-36
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-35
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-34
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-34
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-32
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-42
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-42
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-42
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-40
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-37
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-31
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-42
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-31
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-41
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-39
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-39
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-27
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 7e-20
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 5e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-37
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-35
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-34
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-32
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-31
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-27
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-35
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-34
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-31
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-30
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-28
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-35
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-34
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-34
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-33
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-34
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-33
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-32
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-32
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-27
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-33
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-22
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-33
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-30
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-32
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-31
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-24
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 6e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-17
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-30
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-29
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-25
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-25
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-23
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-27
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-24
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-21
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-26
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-25
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-23
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-23
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-18
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-25
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-24
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-24
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-23
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-23
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-23
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-22
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-25
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-23
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-25
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-24
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-25
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-15
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-23
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-24
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-24
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-24
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-20
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-21
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-20
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-19
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-14
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-20
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-20
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-20
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-19
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-18
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-19
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-18
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-15
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-13
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-12
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-12
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-15
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-13
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-10
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-19
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-18
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-14
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-16
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-16
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-15
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-15
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-14
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-11
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-13
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-12
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-07
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-06
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 8e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-07
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-05
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 8e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-06
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  264 bits (677), Expect = 5e-87
 Identities = 95/339 (28%), Positives = 149/339 (43%), Gaps = 37/339 (10%)

Query: 9   SNEEADALLKWKASLQNHNRSLLSSWVKDTTNVSSKTSPCAWYGISCNDAGRVDNITLPA 68
           + ++  ALL+ K  L N   + LSSW       ++      W G+ C+   +   +    
Sbjct: 4   NPQDKQALLQIKKDLGNP--TTLSSW-----LPTTDCCNRTWLGVLCDTDTQTYRVN--- 53

Query: 69  KGLKGKLHDFSFSLFPHLAYLDLSYNKLFGT--IPPQISNLTNLIHLYFGG-NQFSGNIP 125
                               LDLS   L     IP  ++NL  L  LY GG N   G IP
Sbjct: 54  -------------------NLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIP 94

Query: 126 PEVGLMSHLMFLYIDTNHLDGSIPPELGQLSSIVELSLFSNHLNGSVPPSLSNLTDLFIL 185
           P +  ++ L +LYI   ++ G+IP  L Q+ ++V L    N L+G++PPS+S+L +L  +
Sbjct: 95  PAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGI 154

Query: 186 FLQDNSFSGFIPPDIGNSKSMS-VLYLSSNKFSGPIPLSFGNLSNLNSLHLYGNSVSGSI 244
               N  SG IP   G+   +   + +S N+ +G IP +F NL NL  + L  N + G  
Sbjct: 155 TFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANL-NLAFVDLSRNMLEGDA 213

Query: 245 PSSLGKLKSLFNLQLKGNQLTGYIPSSFRNLTGLLSLLLSQNKLFGSIPDEIGKMRSLSI 304
               G  K+   + L  N L   +         L  L L  N+++G++P  + +++ L  
Sbjct: 214 SVLFGSDKNTQKIHLAKNSLAFDLGK-VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHS 272

Query: 305 LDLSQNQFKGVLPPSVSNLTNLKELVLLYNN-LSGSIPP 342
           L++S N   G +P    NL          N  L GS  P
Sbjct: 273 LNVSFNNLCGEIPQG-GNLQRFDVSAYANNKCLCGSPLP 310
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query369
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.98
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.9
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.73
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.73
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.64
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.63
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.49
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.45
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.4
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.39
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.39
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.38
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.37
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.35
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.3
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.25
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.25
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.13
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.1
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.9
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.89
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.49
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.44
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.32
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.23
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.16
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.01
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.32
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.02
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.02
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=7.5e-45  Score=362.45  Aligned_cols=351  Identities=30%  Similarity=0.446  Sum_probs=214.3

Q ss_pred             CceecCCCCHHHHHHHHHHHHhcccCCccccCCCcCCCCCCCCCCCCccccceeeCCCCCEEEEEcCCCCCccc---cCC
Q 040974            1 FLITVSSESNEEADALLKWKASLQNHNRSLLSSWVKDTTNVSSKTSPCAWYGISCNDAGRVDNITLPAKGLKGK---LHD   77 (369)
Q Consensus         1 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~W~~~~~~~~~~~~~c~~~~~~~~~~~~l~~l~l~~~~~~~~---~~~   77 (369)
                      |+.+++++.++|++||++|++++.+ +. .+.+|.       .+.+||.|.||.|. .++|+.++++++.+.|.   ++.
T Consensus         2 ~~~~~~~~~~~~~~all~~k~~~~~-~~-~l~~W~-------~~~~~C~w~gv~C~-~~~v~~L~L~~~~l~g~~~~l~~   71 (768)
T 3rgz_A            2 FQASPSQSLYREIHQLISFKDVLPD-KN-LLPDWS-------SNKNPCTFDGVTCR-DDKVTSIDLSSKPLNVGFSAVSS   71 (768)
T ss_dssp             ------CCHHHHHHHHHHHHTTCSC-TT-SSTTCC-------TTSCGGGSTTEEEE-TTEEEEEECTTSCCCEEHHHHHH
T ss_pred             CcCccccCCHHHHHHHHHHHhhCCC-cc-cccCCC-------CCCCCcCCcceEEC-CCcEEEEECCCCCcCCccCccCh
Confidence            3445666678899999999999984 44 778998       67799999999998 68999999999998876   443


Q ss_pred             ----------------------cccCCCCCCCEEeCCCCcccccCCc--CCCCCCCCCEEECCCCcCcccCCccc-cCCC
Q 040974           78 ----------------------FSFSLFPHLAYLDLSYNKLFGTIPP--QISNLTNLIHLYFGGNQFSGNIPPEV-GLMS  132 (369)
Q Consensus        78 ----------------------~~~~~~~~L~~L~l~~~~l~~~~~~--~l~~l~~L~~L~l~~~~~~~~~~~~l-~~l~  132 (369)
                                            ..+.++++|++|++++|.+++..+.  .++++++|++|++++|.+.+..|..+ .+++
T Consensus        72 ~l~~L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~  151 (768)
T 3rgz_A           72 SLLSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLN  151 (768)
T ss_dssp             HTTTCTTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCT
T ss_pred             hHhccCcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCC
Confidence                                  1256667777777777777665565  66677777777777776665555544 5666


Q ss_pred             CCcEEEccCCcCCCCCCcc---ccCCCCCcEEEeeccccCCCCCccCCCCCCCCEEEccCccccccCCcCCcCCCCCcEE
Q 040974          133 HLMFLYIDTNHLDGSIPPE---LGQLSSIVELSLFSNHLNGSVPPSLSNLTDLFILFLQDNSFSGFIPPDIGNSKSMSVL  209 (369)
Q Consensus       133 ~L~~L~l~~~~~~~~~~~~---~~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L  209 (369)
                      +|++|++++|.+++..+..   +.++++|++|++++|.+.+..+  +..+++|++|++++|.+....+. +..+++|++|
T Consensus       152 ~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~--~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L  228 (768)
T 3rgz_A          152 SLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHL  228 (768)
T ss_dssp             TCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCB--CTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEE
T ss_pred             CCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCC--cccCCcCCEEECcCCcCCCCCcc-cccCCCCCEE
Confidence            6666666666666544443   4555666666666665543332  25566666666666666654444 6666666666


Q ss_pred             EccCCcCCCCCcccccCCCCcceeeccccccccccCccccCCCCCCEEEccCCCCccccchhhhcC-CCCCEEEccCCcC
Q 040974          210 YLSSNKFSGPIPLSFGNLSNLNSLHLYGNSVSGSIPSSLGKLKSLFNLQLKGNQLTGYIPSSFRNL-TGLLSLLLSQNKL  288 (369)
Q Consensus       210 ~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~-~~L~~L~l~~~~~  288 (369)
                      ++++|.+.+..+..+..+++|++|++++|.+++..|..  .+++|++|++++|.+.+..|..+... ++|+.|++++|.+
T Consensus       229 ~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l  306 (768)
T 3rgz_A          229 DISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHF  306 (768)
T ss_dssp             ECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC--CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEE
T ss_pred             ECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc--ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcC
Confidence            66666666555666666666666666666655444432  44555555555555554444444332 5555555555555


Q ss_pred             cccCCccccCCCCCCEEEccCCcCcccCCcc-ccCCCCCCEEEccCCcccccCCccCcC-C-CCCEEEccCCeecccCCC
Q 040974          289 FGSIPDEIGKMRSLSILDLSQNQFKGVLPPS-VSNLTNLKELVLLYNNLSGSIPPLLEN-P-MLTQLSLDNNHFTGYLPH  365 (369)
Q Consensus       289 ~~~~~~~~~~~~~L~~L~l~~~~i~~~~~~~-l~~~~~L~~L~l~~n~~~~~~~~~~~~-~-~L~~L~l~~n~~~~~ip~  365 (369)
                      .+..|..+..+++|+.|++++|.+.+.+|.. +..+++|++|++++|.+.+.+|..+.. + +|++|++++|++++.+|.
T Consensus       307 ~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~  386 (768)
T 3rgz_A          307 YGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILP  386 (768)
T ss_dssp             EECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCT
T ss_pred             CCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcCh
Confidence            5555555555555555555555555444432 455555555555555555544444433 2 444444444444444444


Q ss_pred             C
Q 040974          366 N  366 (369)
Q Consensus       366 ~  366 (369)
                      .
T Consensus       387 ~  387 (768)
T 3rgz_A          387 N  387 (768)
T ss_dssp             T
T ss_pred             h
Confidence            3
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 369
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-25
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-16
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-19
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-09
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 8e-07
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.002
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score =  100 bits (250), Expect = 6e-25
 Identities = 84/335 (25%), Positives = 135/335 (40%), Gaps = 36/335 (10%)

Query: 11  EEADALLKWKASLQNHNRSLLSSWVKDTTNVSSKTSPCAWYGISCNDAGRVDNITLPAKG 70
           ++  ALL+ K  L N     LSSW       ++      W G+ C+   +          
Sbjct: 6   QDKQALLQIKKDLGNPTT--LSSW-----LPTTDCCNRTWLGVLCDTDTQT--------- 49

Query: 71  LKGKLHDFSFSLFPHLAYLDLSYNKLFG--TIPPQISNLTNLIHLYFGGN-QFSGNIPPE 127
                          +  LDLS   L     IP  ++NL  L  LY GG     G IPP 
Sbjct: 50  -------------YRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPA 96

Query: 128 VGLMSHLMFLYIDTNHLDGSIPPELGQLSSIVELSLFSNHLNGSVPPSLSNLTDLFILFL 187
           +  ++ L +LYI   ++ G+IP  L Q+ ++V L    N L+G++PPS+S+L +L  +  
Sbjct: 97  IAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITF 156

Query: 188 QDNSFSGFIPPDIGNS-KSMSVLYLSSNKFSGPIPLSFGNLSNLNSLHLYGNSVSGSIPS 246
             N  SG IP   G+  K  + + +S N+ +G IP +F NL+          ++     S
Sbjct: 157 DGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAF--VDLSRNMLEGDAS 214

Query: 247 SLGKLKSLFNLQLKGNQLTGYIPSSFRNLTGLLSLLLSQNKLFGSIPDEIGKMRSLSILD 306
            L                  +          L  L L  N+++G++P  + +++ L  L+
Sbjct: 215 VLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLN 274

Query: 307 LSQNQFKGVLPPSVSNLTNLKELVLLYNNLSGSIP 341
           +S N   G +P    NL          N      P
Sbjct: 275 VSFNNLCGEIPQG-GNLQRFDVSAYANNKCLCGSP 308
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query369
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.78
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.68
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.68
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.63
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.61
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.54
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.54
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.47
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.24
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.23
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.22
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.18
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.29
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.18
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.78
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.77
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.09
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.07
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=9e-37  Score=270.77  Aligned_cols=290  Identities=29%  Similarity=0.518  Sum_probs=184.1

Q ss_pred             CHHHHHHHHHHHHhcccCCccccCCCcCCCCCCCCCCCCcc--ccceeeCCCC---CEEEEEcCCCCCccc--cCCcccC
Q 040974            9 SNEEADALLKWKASLQNHNRSLLSSWVKDTTNVSSKTSPCA--WYGISCNDAG---RVDNITLPAKGLKGK--LHDFSFS   81 (369)
Q Consensus         9 ~~~~~~~l~~~~~~~~~~~~~~~~~W~~~~~~~~~~~~~c~--~~~~~~~~~~---~l~~l~l~~~~~~~~--~~~~~~~   81 (369)
                      .++||+||++|++.+.++  ..+.+|.       .+.|||.  |.||.|...+   +|+.++|+++.+.+.  +|.. +.
T Consensus         4 ~~~e~~aLl~~k~~~~~~--~~l~sW~-------~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~-l~   73 (313)
T d1ogqa_           4 NPQDKQALLQIKKDLGNP--TTLSSWL-------PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSS-LA   73 (313)
T ss_dssp             CHHHHHHHHHHHHHTTCC--GGGTTCC-------TTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGG-GG
T ss_pred             CHHHHHHHHHHHHHCCCC--CcCCCCC-------CCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChH-Hh
Confidence            478999999999999874  4578998       6789994  9999998543   799999999988764  4444 77


Q ss_pred             CCCCCCEEeCCC-CcccccCCcCCCCCCCCCEEECCCCcCcccCCccccCCCCCcEEEccCCcCCCCCCccccCCCCCcE
Q 040974           82 LFPHLAYLDLSY-NKLFGTIPPQISNLTNLIHLYFGGNQFSGNIPPEVGLMSHLMFLYIDTNHLDGSIPPELGQLSSIVE  160 (369)
Q Consensus        82 ~~~~L~~L~l~~-~~l~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~  160 (369)
                      ++++|++|+|++ |++++.+|..|+++++|++|++++|.+.+..+..+..+.+|+++++++|.+.+.+|..+..+++|++
T Consensus        74 ~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~  153 (313)
T d1ogqa_          74 NLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVG  153 (313)
T ss_dssp             GCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCE
T ss_pred             cCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccce
Confidence            777777777775 5677677777777777777777777777666666777777777777777766666666777777777


Q ss_pred             EEeeccccCCCCCccCCCCCCC-CEEEccCccccccCCcCCcCCCCCcEEEccCCcCCCCCcccccCCCCcceeeccccc
Q 040974          161 LSLFSNHLNGSVPPSLSNLTDL-FILFLQDNSFSGFIPPDIGNSKSMSVLYLSSNKFSGPIPLSFGNLSNLNSLHLYGNS  239 (369)
Q Consensus       161 L~l~~~~~~~~~~~~l~~l~~L-~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~  239 (369)
                      +++++|.+.+..|..+..+..+ +.+.++.|.+++..+..+..+.. ..+++..+...+..+..+..++.++.+++.++.
T Consensus       154 l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~-~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~  232 (313)
T d1ogqa_         154 ITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNL-AFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNS  232 (313)
T ss_dssp             EECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCC-SEEECCSSEEEECCGGGCCTTSCCSEEECCSSE
T ss_pred             eecccccccccccccccccccccccccccccccccccccccccccc-ccccccccccccccccccccccccccccccccc
Confidence            7777776665566655555544 55555555555444444443332 235555444444444444444455555555544


Q ss_pred             cccccCccccCCCCCCEEEccCCCCccccchhhhcCCCCCEEEccCCcCcccCCccccCCCCCCEEEccCCcCcccCCcc
Q 040974          240 VSGSIPSSLGKLKSLFNLQLKGNQLTGYIPSSFRNLTGLLSLLLSQNKLFGSIPDEIGKMRSLSILDLSQNQFKGVLPPS  319 (369)
Q Consensus       240 ~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~i~~~~~~~  319 (369)
                      +.+.++                         .+..+++|+.|++++|++.+..|..+..+++|+.|++++|++++.+|. 
T Consensus       233 l~~~~~-------------------------~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-  286 (313)
T d1ogqa_         233 LAFDLG-------------------------KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-  286 (313)
T ss_dssp             ECCBGG-------------------------GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-
T ss_pred             cccccc-------------------------ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-
Confidence            443322                         333444555555555555544555555555555555555555544442 


Q ss_pred             ccCCCCCCEEEccCCc
Q 040974          320 VSNLTNLKELVLLYNN  335 (369)
Q Consensus       320 l~~~~~L~~L~l~~n~  335 (369)
                      +..+++|+.+++++|+
T Consensus       287 ~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         287 GGNLQRFDVSAYANNK  302 (313)
T ss_dssp             STTGGGSCGGGTCSSS
T ss_pred             cccCCCCCHHHhCCCc
Confidence            3445555555555554
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure