Citrus Sinensis ID: 040997

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MSSPHVLVMPGPAQGHVIPLLEFSQCLAKHGFRVTFVNTDYYHKRVVESLQGKNYLEEQIRLVSIPDGMEPWEDRNDFGKLIENFLQVMPGKLEKLIEEINSREDEKIDCFIADGNMGWSLEVAKKMN
ccccEEEEEEccccccHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHccccccccccEEEEcccccccccccccHHHHHHHHHHHcHHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHcc
ccccEEEEEEccccccHHHHHHHHHHHHHcccEEEEEEccHcHHHHHHHcccccccccccEEEEcccccccccccccHHHHHHHHHHHccHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHcc
mssphvlvmpgpaqghvipllefsqclakhgfrvtfvntdYYHKRVVESlqgknyleEQIRLvsipdgmepwedrNDFGKLIENFLQVMPGKLEKLIEEINSredekidcfiadgnmgwSLEVAKKMN
mssphvlvMPGPAQGHVIPLLEFSQCLAKHGFRVTFVNTDYYHKRVVeslqgknyleEQIRLVSIPDGMEPWEDRNDFGKLIENFLQVMPGKLEKLIEEINSREDEKIDCFIADGNMGWSLEVAKKMN
MSSPHVLVMPGPAQGHVIPLLEFSQCLAKHGFRVTFVNTDYYHKRVVESLQGKNYLEEQIRLVSIPDGMEPWEDRNDFGKLIENFLQVMPGKLEKLIEEINSREDEKIDCFIADGNMGWSLEVAKKMN
***********PAQGHVIPLLEFSQCLAKHGFRVTFVNTDYYHKRVVESLQGKNYLEEQIRLVSIPDGMEPWEDRNDFGKLIENFLQVMPGKLEKLIEEINSREDEKIDCFIADGNMGWSLE******
*SSPHVLVMPGPAQGHVIPLLEFSQCLAKHGFRVTFVNTDYYHK***************IRLVSIPDGMEPWEDRNDFGKLIENFLQVMPGKLEKLIEEINSREDEKIDCFIADGNMGWSLEVAKKMN
MSSPHVLVMPGPAQGHVIPLLEFSQCLAKHGFRVTFVNTDYYHKRVVESLQGKNYLEEQIRLVSIPDGMEPWEDRNDFGKLIENFLQVMPGKLEKLIEEINSREDEKIDCFIADGNMGWSLEVAKKMN
*SSPHVLVMPGPAQGHVIPLLEFSQCLAKHGFRVTFVNTDYYHKRVVESLQGKNYLEEQIRLVSIPDGMEPWEDRNDFGKLIENFLQVMPGKLEKLIEEINSREDEKIDCFIADGNMGWSLEVAKKM*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSPHVLVMPGPAQGHVIPLLEFSQCLAKHGFRVTFVNTDYYHKRVVESLQGKNYLEEQIRLVSIPDGMEPWEDRNDFGKLIENFLQVMPGKLEKLIEEINSREDEKIDCFIADGNMGWSLEVAKKMN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query128 2.2.26 [Sep-21-2011]
Q9SGA8 464 UDP-glycosyltransferase 8 yes no 0.992 0.273 0.481 9e-29
Q9M9E7 489 UDP-glycosyltransferase 8 no no 0.953 0.249 0.369 2e-18
Q9LMF0 479 UDP-glycosyltransferase 8 no no 0.953 0.254 0.369 2e-17
Q9SJL0 490 UDP-glycosyltransferase 8 no no 0.976 0.255 0.325 2e-16
Q9LMF1 488 UDP-glycosyltransferase 8 no no 0.960 0.252 0.364 9e-16
Q9ZWJ3 481 UDP-glycosyltransferase 8 no no 0.945 0.251 0.348 2e-15
Q9SK82 489 UDP-glycosyltransferase 8 no no 0.953 0.249 0.353 6e-15
Q9LME8 487 UDP-glycosyltransferase 8 no no 0.929 0.244 0.353 7e-14
Q9SBL1 492 Cyanohydrin beta-glucosyl N/A no 0.867 0.225 0.303 6e-11
Q9ZUV0 482 UDP-glycosyltransferase 8 no no 0.921 0.244 0.293 2e-07
>sp|Q9SGA8|U83A1_ARATH UDP-glycosyltransferase 83A1 OS=Arabidopsis thaliana GN=UGT83A1 PE=2 SV=1 Back     alignment and function desciption
 Score =  125 bits (313), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 93/133 (69%), Gaps = 6/133 (4%)

Query: 1   MSSPHVLVMPGPAQGHVIPLLEFSQCLAKHGFRVTFVNTDYYHKRVVESLQG---KNYLE 57
           M  PHV+V+P PAQGHV+PL+ FS+ LAK G ++TF+NT++ H R++ SL     ++Y+ 
Sbjct: 9   MGRPHVVVIPYPAQGHVLPLISFSRYLAKQGIQITFINTEFNHNRIISSLPNSPHEDYVG 68

Query: 58  EQIRLVSIPDGMEPW-EDRNDFGKLIENFLQVMPGKLEKLIEEINSRED--EKIDCFIAD 114
           +QI LVSIPDG+E   E+RN  GKL E+ L+ MP K+E+LIE + +       I C +AD
Sbjct: 69  DQINLVSIPDGLEDSPEERNIPGKLSESVLRFMPKKVEELIERMMAETSGGTIISCVVAD 128

Query: 115 GNMGWSLEVAKKM 127
            ++GW++EVA K 
Sbjct: 129 QSLGWAIEVAAKF 141

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: -
>sp|Q9M9E7|U85A4_ARATH UDP-glycosyltransferase 85A4 OS=Arabidopsis thaliana GN=UGT85A4 PE=2 SV=1 Back     alignment and function description
>sp|Q9LMF0|U85A5_ARATH UDP-glycosyltransferase 85A5 OS=Arabidopsis thaliana GN=UGT85A5 PE=2 SV=1 Back     alignment and function description
>sp|Q9SJL0|U86A1_ARATH UDP-glycosyltransferase 86A1 OS=Arabidopsis thaliana GN=UGT86A1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LMF1|U85A3_ARATH UDP-glycosyltransferase 85A3 OS=Arabidopsis thaliana GN=UGT85A3 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZWJ3|U85A2_ARATH UDP-glycosyltransferase 85A2 OS=Arabidopsis thaliana GN=UGT85A2 PE=2 SV=1 Back     alignment and function description
>sp|Q9SK82|U85A1_ARATH UDP-glycosyltransferase 85A1 OS=Arabidopsis thaliana GN=UGT85A1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LME8|U85A7_ARATH UDP-glycosyltransferase 85A7 OS=Arabidopsis thaliana GN=UGT85A7 PE=2 SV=1 Back     alignment and function description
>sp|Q9SBL1|HMNGT_SORBI Cyanohydrin beta-glucosyltransferase OS=Sorghum bicolor GN=UGT85B1 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZUV0|U86A2_ARATH UDP-glycosyltransferase 86A2 OS=Arabidopsis thaliana GN=UGT86A2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
359488535 451 PREDICTED: LOW QUALITY PROTEIN: UDP-glyc 0.992 0.281 0.669 4e-44
255570294 452 UDP-glucuronosyltransferase, putative [R 0.992 0.280 0.656 7e-43
224141477 454 predicted protein [Populus trichocarpa] 1.0 0.281 0.617 4e-42
225451707 454 PREDICTED: UDP-glycosyltransferase 83A1 0.960 0.270 0.669 2e-41
296082221 494 unnamed protein product [Vitis vinifera] 0.992 0.257 0.629 6e-41
147767625 568 hypothetical protein VITISV_004920 [Viti 0.992 0.223 0.629 8e-41
225451709 454 PREDICTED: UDP-glycosyltransferase 83A1 0.992 0.279 0.629 8e-41
225451705 454 PREDICTED: UDP-glycosyltransferase 83A1 0.992 0.279 0.629 9e-41
224080163 454 predicted protein [Populus trichocarpa] 0.992 0.279 0.590 2e-38
449523666 259 PREDICTED: LOW QUALITY PROTEIN: UDP-glyc 0.992 0.490 0.601 7e-37
>gi|359488535|ref|XP_003633773.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 83A1-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 85/127 (66%), Positives = 103/127 (81%)

Query: 1   MSSPHVLVMPGPAQGHVIPLLEFSQCLAKHGFRVTFVNTDYYHKRVVESLQGKNYLEEQI 60
           M S HVLVMP PAQGHVIP +E SQ L KHGF+VTFVNTD+  +R+V+S  GK+ + +QI
Sbjct: 1   MGSLHVLVMPFPAQGHVIPFMELSQNLVKHGFKVTFVNTDFSQERIVKSFTGKDNVGDQI 60

Query: 61  RLVSIPDGMEPWEDRNDFGKLIENFLQVMPGKLEKLIEEINSREDEKIDCFIADGNMGWS 120
           RLVSIPDG+E WEDRND GK  E  ++VMP KLE+L++EIN R+D KI C IADGNMGW+
Sbjct: 61  RLVSIPDGLEAWEDRNDMGKSCEGIVRVMPKKLEELMQEINGRDDNKITCVIADGNMGWA 120

Query: 121 LEVAKKM 127
           LEVA+KM
Sbjct: 121 LEVAEKM 127

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255570294|ref|XP_002526107.1| UDP-glucuronosyltransferase, putative [Ricinus communis] gi|223534604|gb|EEF36301.1| UDP-glucuronosyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224141477|ref|XP_002324098.1| predicted protein [Populus trichocarpa] gi|222867100|gb|EEF04231.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225451707|ref|XP_002279299.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296082221|emb|CBI21226.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147767625|emb|CAN60198.1| hypothetical protein VITISV_004920 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225451709|ref|XP_002276804.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225451705|ref|XP_002279246.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224080163|ref|XP_002306038.1| predicted protein [Populus trichocarpa] gi|222849002|gb|EEE86549.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449523666|ref|XP_004168844.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 83A1-like, partial [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
TAIR|locus:2078608 464 AT3G02100 [Arabidopsis thalian 0.984 0.271 0.484 1.5e-28
TAIR|locus:2032105 489 UGT85A4 "AT1G78270" [Arabidops 0.953 0.249 0.369 2.7e-18
TAIR|locus:2196496 479 UGT85A5 "UDP-glucosyl transfer 0.953 0.254 0.369 1.9e-17
TAIR|locus:2196490 488 UGT85A3 "AT1G22380" [Arabidops 0.960 0.252 0.379 1.9e-16
TAIR|locus:2196501 481 UGT85A2 "UDP-glucosyl transfer 0.945 0.251 0.348 8.5e-16
TAIR|locus:2009557 489 UGT85A1 [Arabidopsis thaliana 0.953 0.249 0.353 6.5e-15
TAIR|locus:2196516 487 UGT85A7 "UDP-glucosyl transfer 0.960 0.252 0.341 8.3e-15
TAIR|locus:2057976 490 AT2G36970 [Arabidopsis thalian 0.976 0.255 0.325 2.3e-14
TAIR|locus:2091628 461 AT3G22250 [Arabidopsis thalian 0.882 0.245 0.288 1.4e-08
TAIR|locus:2046193 482 AT2G28080 "AT2G28080" [Arabido 0.945 0.251 0.310 1.5e-08
TAIR|locus:2078608 AT3G02100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 318 (117.0 bits), Expect = 1.5e-28, P = 1.5e-28
 Identities = 64/132 (48%), Positives = 93/132 (70%)

Query:     1 MSSPHVLVMPGPAQGHVIPLLEFSQCLAKHGFRVTFVNTDYYHKRVVESLQG---KNYLE 57
             M  PHV+V+P PAQGHV+PL+ FS+ LAK G ++TF+NT++ H R++ SL     ++Y+ 
Sbjct:     9 MGRPHVVVIPYPAQGHVLPLISFSRYLAKQGIQITFINTEFNHNRIISSLPNSPHEDYVG 68

Query:    58 EQIRLVSIPDGMEPW-EDRNDFGKLIENFLQVMPGKLEKLIEEINSREDEK--IDCFIAD 114
             +QI LVSIPDG+E   E+RN  GKL E+ L+ MP K+E+LIE + +       I C +AD
Sbjct:    69 DQINLVSIPDGLEDSPEERNIPGKLSESVLRFMPKKVEELIERMMAETSGGTIISCVVAD 128

Query:   115 GNMGWSLEVAKK 126
              ++GW++EVA K
Sbjct:   129 QSLGWAIEVAAK 140
GO:0005634 "nucleus" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA
GO:0008194 "UDP-glycosyltransferase activity" evidence=ISS
GO:0016757 "transferase activity, transferring glycosyl groups" evidence=ISS
GO:0016758 "transferase activity, transferring hexosyl groups" evidence=IEA
TAIR|locus:2032105 UGT85A4 "AT1G78270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196496 UGT85A5 "UDP-glucosyl transferase 85A5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196490 UGT85A3 "AT1G22380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196501 UGT85A2 "UDP-glucosyl transferase 85A2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009557 UGT85A1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196516 UGT85A7 "UDP-glucosyl transferase 85A7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057976 AT2G36970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091628 AT3G22250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046193 AT2G28080 "AT2G28080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00038014001
SubName- Full=Chromosome chr14 scaffold_9, whole genome shotgun sequence; (291 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
PLN02562 448 PLN02562, PLN02562, UDP-glycosyltransferase 1e-15
PLN02448 459 PLN02448, PLN02448, UDP-glycosyltransferase family 1e-09
PLN02173 449 PLN02173, PLN02173, UDP-glucosyl transferase famil 8e-09
PLN02555 480 PLN02555, PLN02555, limonoid glucosyltransferase 3e-08
PLN03007 482 PLN03007, PLN03007, UDP-glucosyltransferase family 3e-08
PLN02534 491 PLN02534, PLN02534, UDP-glycosyltransferase 6e-08
PLN02863 477 PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl 2e-07
PLN02152 455 PLN02152, PLN02152, indole-3-acetate beta-glucosyl 1e-05
PLN02670 472 PLN02670, PLN02670, transferase, transferring glyc 5e-05
COG1819 406 COG1819, COG1819, Glycosyl transferases, related t 1e-04
PLN02410 451 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl 2e-04
PLN02210 456 PLN02210, PLN02210, UDP-glucosyl transferase 3e-04
PLN02992 481 PLN02992, PLN02992, coniferyl-alcohol glucosyltran 7e-04
cd03784 401 cd03784, GT1_Gtf_like, This family includes the Gt 0.001
>gnl|CDD|215305 PLN02562, PLN02562, UDP-glycosyltransferase Back     alignment and domain information 
 Score = 71.1 bits (174), Expect = 1e-15
 Identities = 38/127 (29%), Positives = 68/127 (53%), Gaps = 9/127 (7%)

Query: 1   MSSPHVLVMPGPAQGHVIPLLEFSQCLAKHGFRVTFVNTDYYHKRVVESLQGKNYLEEQI 60
              P ++++P PAQGHV P+L+ +      GF    +  ++ H+R+  +L  K      I
Sbjct: 4   TQRPKIILVPYPAQGHVTPMLKLASAFLSRGFEPVVITPEFIHRRISATLDPK----LGI 59

Query: 61  RLVSIPDGMEPWEDRNDFGKLIENFLQ-VMPGKLEKLIEEINSREDEKIDCFIADGNMGW 119
             +SI DG +    R+ F   IEN ++  MP +LE+L+ +++  ED ++ C + D    W
Sbjct: 60  TFMSISDGQDDDPPRDFFS--IENSMENTMPPQLERLLHKLD--EDGEVACMVVDLLASW 115

Query: 120 SLEVAKK 126
           ++ VA +
Sbjct: 116 AIGVADR 122

Length = 448
>gnl|CDD|215247 PLN02448, PLN02448, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|177830 PLN02173, PLN02173, UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|178170 PLN02555, PLN02555, limonoid glucosyltransferase Back     alignment and domain information
>gnl|CDD|178584 PLN03007, PLN03007, UDP-glucosyltransferase family protein Back     alignment and domain information
>gnl|CDD|215293 PLN02534, PLN02534, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|215465 PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|177813 PLN02152, PLN02152, indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>gnl|CDD|178275 PLN02670, PLN02670, transferase, transferring glycosyl groups Back     alignment and domain information
>gnl|CDD|224732 COG1819, COG1819, Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|178032 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|215127 PLN02210, PLN02210, UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|178572 PLN02992, PLN02992, coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>gnl|CDD|99960 cd03784, GT1_Gtf_like, This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 128
PLN02173 449 UDP-glucosyl transferase family protein 99.95
PLN02152 455 indole-3-acetate beta-glucosyltransferase 99.94
PLN02410 451 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.94
PLN02562 448 UDP-glycosyltransferase 99.94
PLN02555 480 limonoid glucosyltransferase 99.94
PLN02534 491 UDP-glycosyltransferase 99.93
PLN00164 480 glucosyltransferase; Provisional 99.93
PLN02670 472 transferase, transferring glycosyl groups 99.93
PLN02863 477 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.93
PLN02210 456 UDP-glucosyl transferase 99.92
PLN02207 468 UDP-glycosyltransferase 99.92
PLN02992 481 coniferyl-alcohol glucosyltransferase 99.92
PLN03004 451 UDP-glycosyltransferase 99.92
PLN02448 459 UDP-glycosyltransferase family protein 99.92
PLN03015 470 UDP-glucosyl transferase 99.92
PLN02554 481 UDP-glycosyltransferase family protein 99.91
PLN00414 446 glycosyltransferase family protein 99.91
PLN02764 453 glycosyltransferase family protein 99.9
PLN03007 482 UDP-glucosyltransferase family protein 99.9
PLN02167 475 UDP-glycosyltransferase family protein 99.9
PLN02208 442 glycosyltransferase family protein 99.9
cd03784 401 GT1_Gtf_like This family includes the Gtfs, a grou 99.75
TIGR01426 392 MGT glycosyltransferase, MGT family. This model de 99.7
PF03033139 Glyco_transf_28: Glycosyltransferase family 28 N-t 99.41
KOG1192 496 consensus UDP-glucuronosyl and UDP-glucosyl transf 99.38
COG1819 406 Glycosyl transferases, related to UDP-glucuronosyl 98.92
PF00201 500 UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera 98.87
PHA03392 507 egt ecdysteroid UDP-glucosyltransferase; Provision 98.68
PF13528 318 Glyco_trans_1_3: Glycosyl transferase family 1 98.65
TIGR00661 321 MJ1255 conserved hypothetical protein. This model 98.55
PRK12446 352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 98.2
TIGR01133 348 murG undecaprenyldiphospho-muramoylpentapeptide be 97.7
PRK00726 357 murG undecaprenyldiphospho-muramoylpentapeptide be 97.68
COG0707 357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami 97.64
cd03785 350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 97.55
TIGR03590 279 PseG pseudaminic acid biosynthesis-associated prot 97.28
TIGR00215 385 lpxB lipid-A-disaccharide synthase. Lipid-A precur 97.27
COG4671 400 Predicted glycosyl transferase [General function p 97.15
cd03818 396 GT1_ExpC_like This family is most closely related 97.13
PRK00025 380 lpxB lipid-A-disaccharide synthase; Reviewed 96.43
cd03816 415 GT1_ALG1_like This family is most closely related 96.38
PRK02261137 methylaspartate mutase subunit S; Provisional 95.35
cd03800 398 GT1_Sucrose_synthase This family is most closely r 94.98
PRK13609 380 diacylglycerol glucosyltransferase; Provisional 94.44
cd03823 359 GT1_ExpE7_like This family is most closely related 94.36
COG3980 318 spsG Spore coat polysaccharide biosynthesis protei 93.97
PF13579160 Glyco_trans_4_4: Glycosyl transferase 4-like domai 93.8
PF12000171 Glyco_trans_4_3: Gkycosyl transferase family 4 gro 93.72
cd04962 371 GT1_like_5 This family is most closely related to 93.17
cd03814 364 GT1_like_2 This family is most closely related to 93.04
cd02067119 B12-binding B12 binding domain (B12-BD). This doma 93.03
cd03808 359 GT1_cap1E_like This family is most closely related 92.59
PF13439177 Glyco_transf_4: Glycosyltransferase Family 4; PDB: 92.57
PF13477139 Glyco_trans_4_2: Glycosyl transferase 4-like 92.08
cd03817 374 GT1_UGDG_like This family is most closely related 91.85
PLN02871 465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 91.76
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 91.43
cd04951 360 GT1_WbdM_like This family is most closely related 91.18
PRK01175 261 phosphoribosylformylglycinamidine synthase I; Prov 90.57
cd03794 394 GT1_wbuB_like This family is most closely related 90.5
PRK10307 412 putative glycosyl transferase; Provisional 90.44
cd03825 365 GT1_wcfI_like This family is most closely related 89.26
cd03805 392 GT1_ALG2_like This family is most closely related 89.21
cd03821 375 GT1_Bme6_like This family is most closely related 89.01
PLN02846 462 digalactosyldiacylglycerol synthase 88.82
cd02070201 corrinoid_protein_B12-BD B12 binding domain of cor 88.63
cd03802 335 GT1_AviGT4_like This family is most closely relate 87.95
TIGR02370197 pyl_corrinoid methyltransferase cognate corrinoid 87.73
COG1484254 DnaC DNA replication protein [DNA replication, rec 87.54
cd03811 353 GT1_WabH_like This family is most closely related 87.53
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 87.22
PF02310121 B12-binding: B12 binding domain; InterPro: IPR0061 86.62
cd04955 363 GT1_like_6 This family is most closely related to 86.16
PF02441129 Flavoprotein: Flavoprotein; InterPro: IPR003382 Th 86.07
cd03795 357 GT1_like_4 This family is most closely related to 85.4
COG2185143 Sbm Methylmalonyl-CoA mutase, C-terminal domain/su 85.04
cd01635 229 Glycosyltransferase_GTB_type Glycosyltransferases 84.44
PRK08305196 spoVFB dipicolinate synthase subunit B; Reviewed 84.35
PLN00142 815 sucrose synthase 84.25
cd02069213 methionine_synthase_B12_BD B12 binding domain of m 84.23
cd02071122 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin 83.61
cd03820 348 GT1_amsD_like This family is most closely related 83.57
cd03801 374 GT1_YqgM_like This family is most closely related 83.55
PRK00654 466 glgA glycogen synthase; Provisional 82.86
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 81.97
PF04244224 DPRP: Deoxyribodipyrimidine photo-lyase-related pr 81.84
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 81.32
TIGR03449 405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 81.12
COG4081148 Uncharacterized protein conserved in archaea [Func 80.9
PF08660170 Alg14: Oligosaccharide biosynthesis protein Alg14 80.89
TIGR02470 784 sucr_synth sucrose synthase. This model represents 80.76
>PLN02173 UDP-glucosyl transferase family protein Back     alignment and domain information 
Probab=99.95  E-value=4.8e-27  Score=176.14  Aligned_cols=119  Identities=25%  Similarity=0.510  Sum_probs=95.7

Q ss_pred             CCeEEEEcCCCcCChHHHHHHHHHHHHCCCeEEEEeCcchhhhhhhhhccCCCCCCCceEEecCCCCCCCC--CCCCHHH
Q 040997            3 SPHVLVMPGPAQGHVIPLLEFSQCLAKHGFRVTFVNTDYYHKRVVESLQGKNYLEEQIRLVSIPDGMEPWE--DRNDFGK   80 (128)
Q Consensus         3 ~~hvl~~p~p~~GH~~P~l~la~~L~~rG~~Vt~~~t~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~--~~~~~~~   80 (128)
                      ++||+++|||+|||++||++|||+|+++|++|||++|+.+.+++....      .++|+|..+|+++|++.  ...+...
T Consensus         5 ~~hvv~~P~paqGHi~P~l~lAk~La~~G~~vT~v~t~~~~~~~~~~~------~~~i~~~~ipdglp~~~~~~~~~~~~   78 (449)
T PLN02173          5 RGHVLAVPFPSQGHITPIRQFCKRLHSKGFKTTHTLTTFIFNTIHLDP------SSPISIATISDGYDQGGFSSAGSVPE   78 (449)
T ss_pred             CcEEEEecCcccccHHHHHHHHHHHHcCCCEEEEEECCchhhhcccCC------CCCEEEEEcCCCCCCcccccccCHHH
Confidence            359999999999999999999999999999999999998876553321      13599999999888632  2234556


Q ss_pred             HHHHHHHHchHHHHHHHHHHhcCCCCCccEEEeCCCcccHHHHHHhcC
Q 040997           81 LIENFLQVMPGKLEKLIEEINSREDEKIDCFIADGNMGWSLEVAKKMN  128 (128)
Q Consensus        81 ~~~~~~~~~~~~~~~ll~~l~~~~~~~~d~vI~D~~~~~~~~vA~~lg  128 (128)
                      ++..+.+.+.++++++++++..++ .+++|||+|+|++|+.+||+++|
T Consensus        79 ~~~~~~~~~~~~~~~~l~~~~~~~-~Pv~cvV~D~f~~Wa~dVA~elg  125 (449)
T PLN02173         79 YLQNFKTFGSKTVADIIRKHQSTD-NPITCIVYDSFMPWALDLAREFG  125 (449)
T ss_pred             HHHHHHHhhhHHHHHHHHHhhccC-CCceEEEECCcchhHHHHHHHhC
Confidence            777776678889999998875322 34599999999999999999987

>PLN02152 indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02562 UDP-glycosyltransferase Back     alignment and domain information
>PLN02555 limonoid glucosyltransferase Back     alignment and domain information
>PLN02534 UDP-glycosyltransferase Back     alignment and domain information
>PLN00164 glucosyltransferase; Provisional Back     alignment and domain information
>PLN02670 transferase, transferring glycosyl groups Back     alignment and domain information
>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02210 UDP-glucosyl transferase Back     alignment and domain information
>PLN02207 UDP-glycosyltransferase Back     alignment and domain information
>PLN02992 coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>PLN03004 UDP-glycosyltransferase Back     alignment and domain information
>PLN02448 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN03015 UDP-glucosyl transferase Back     alignment and domain information
>PLN02554 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN00414 glycosyltransferase family protein Back     alignment and domain information
>PLN02764 glycosyltransferase family protein Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>PLN02167 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>PF03033 Glyco_transf_28: Glycosyltransferase family 28 N-terminal domain; InterPro: IPR004276 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>KOG1192 consensus UDP-glucuronosyl and UDP-glucosyl transferase [Carbohydrate transport and metabolism; Energy production and conversion] Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule Back     alignment and domain information
>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase Back     alignment and domain information
>COG4671 Predicted glycosyl transferase [General function prediction only] Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK02261 methylaspartate mutase subunit S; Provisional Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13579 Glyco_trans_4_4: Glycosyl transferase 4-like domain; PDB: 3C4Q_B 3C4V_A 3C48_B 1Z2T_A Back     alignment and domain information
>PF12000 Glyco_trans_4_3: Gkycosyl transferase family 4 group; InterPro: IPR022623 This presumed domain is functionally uncharacterised and found in bacteria Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF13439 Glyco_transf_4: Glycosyltransferase Family 4; PDB: 2JJM_E 3MBO_C 2GEJ_A 2GEK_A Back     alignment and domain information
>PF13477 Glyco_trans_4_2: Glycosyl transferase 4-like Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02846 digalactosyldiacylglycerol synthase Back     alignment and domain information
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02370 pyl_corrinoid methyltransferase cognate corrinoid proteins, Methanosarcina family Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF02441 Flavoprotein: Flavoprotein; InterPro: IPR003382 This entry contains a diverse range of flavoprotein enzymes, including epidermin biosynthesis protein, EpiD, which has been shown to be a flavoprotein that binds FMN [] Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PRK08305 spoVFB dipicolinate synthase subunit B; Reviewed Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase Back     alignment and domain information
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04244 DPRP: Deoxyribodipyrimidine photo-lyase-related protein; InterPro: IPR007357 This family appears to be related to DNA photolyases Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>COG4081 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PF08660 Alg14: Oligosaccharide biosynthesis protein Alg14 like; InterPro: IPR013969 Alg14 is involved dolichol-linked oligosaccharide biosynthesis and anchors the catalytic subunit Alg13 to the ER membrane [] Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
2pq6_A 482 Crystal Structure Of Medicago Truncatula Ugt85h2- I 1e-14
2vce_A 480 Characterization And Engineering Of The Bifunctiona 2e-05
>pdb|2PQ6|A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase Length = 482 Back     alignment and structure 
Iteration: 1

 Score = 74.7 bits (182), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 69/130 (53%), Gaps = 6/130 (4%)
Query: 4   PHVLVMPGPAQGHVIPLLEFSQCLAKHGFRVTFVNTDYYHKRVVESLQGKNYLE-EQIRL 62
           PHV+++P P QGH+ PL + ++ L   GF +TFVNT+Y HKR+++S   K +        
Sbjct: 9   PHVVMIPYPVQGHINPLFKLAKLLHLRGFHITFVNTEYNHKRLLKSRGPKAFDGFTDFNF 68
Query: 63  VSIPDGMEPWEDRNDFGKLIENFLQVMPGKLEKLIEEINSREDEK-----IDCFIADGNM 117
            SIPDG+ P E   D  + +    Q +     K   E+ +R +       + C ++D  M
Sbjct: 69  ESIPDGLTPMEGDGDVSQDVPTLCQSVRKNFLKPYCELLTRLNHSTNVPPVTCLVSDCCM 128
Query: 118 GWSLEVAKKM 127
            ++++ A++ 
Sbjct: 129 SFTIQAAEEF 138
>pdb|2VCE|A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants Length = 480 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
2pq6_A 482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 6e-43
2c1x_A 456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 1e-38
3hbf_A 454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 2e-38
2acv_A 463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 2e-32
2vch_A 480 Hydroquinone glucosyltransferase; glycosyltransfer 8e-28
2iyf_A 430 OLED, oleandomycin glycosyltransferase; antibiotic 5e-12
2iya_A 424 OLEI, oleandomycin glycosyltransferase; carbohydra 4e-10
3ia7_A 402 CALG4; glycosysltransferase, calicheamicin, enediy 2e-09
3rsc_A 415 CALG2; TDP, enediyne, structural genomics, PSI-2, 1e-08
2p6p_A 384 Glycosyl transferase; X-RAY-diffraction,urdamycina 1e-04
3oti_A 398 CALG3; calicheamicin, TDP, structural genomics, PS 1e-04
3otg_A 412 CALG1; calicheamicin, TDP, structural genomics, PS 3e-04
2yjn_A 441 ERYCIII, glycosyltransferase; transferase, cytochr 4e-04
4fzr_A 398 SSFS6; structural genomics, PSI-biology, protein s 5e-04
3tsa_A 391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 7e-04
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Length = 482 Back     alignment and structure
 Score =  145 bits (369), Expect = 6e-43
 Identities = 40/139 (28%), Positives = 69/139 (49%), Gaps = 11/139 (7%)

Query: 1   MSS-----PHVLVMPGPAQGHVIPLLEFSQCLAKHGFRVTFVNTDYYHKRVVESLQ-GKN 54
           M +     PHV+++P P QGH+ PL + ++ L   GF +TFVNT+Y HKR+++S      
Sbjct: 1   MGNFANRKPHVVMIPYPVQGHINPLFKLAKLLHLRGFHITFVNTEYNHKRLLKSRGPKAF 60

Query: 55  YLEEQIRLVSIPDGMEPWEDR----NDFGKLIENFLQVMPGKLEKLIEEIN-SREDEKID 109
                    SIPDG+ P E       D   L ++  +       +L+  +N S     + 
Sbjct: 61  DGFTDFNFESIPDGLTPMEGDGDVSQDVPTLCQSVRKNFLKPYCELLTRLNHSTNVPPVT 120

Query: 110 CFIADGNMGWSLEVAKKMN 128
           C ++D  M ++++ A++  
Sbjct: 121 CLVSDCCMSFTIQAAEEFE 139
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Length = 456 Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} PDB: 3hbj_A* Length = 454 Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Length = 463 Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Length = 480 Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Length = 430 Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Length = 424 Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Length = 402 Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Length = 415 Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Length = 384 Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Length = 398 Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Length = 412 Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 441 Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Length = 398 Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Length = 391 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
3hbf_A 454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 99.94
2pq6_A 482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 99.92
2acv_A 463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 99.87
2c1x_A 456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 99.87
2vch_A 480 Hydroquinone glucosyltransferase; glycosyltransfer 99.85
2iya_A 424 OLEI, oleandomycin glycosyltransferase; carbohydra 99.83
4amg_A 400 Snogd; transferase, polyketide biosynthesis, GT1 f 99.76
3ia7_A 402 CALG4; glycosysltransferase, calicheamicin, enediy 99.7
2iyf_A 430 OLED, oleandomycin glycosyltransferase; antibiotic 99.66
1iir_A 415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 99.65
3rsc_A 415 CALG2; TDP, enediyne, structural genomics, PSI-2, 99.63
1rrv_A 416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 99.57
2yjn_A 441 ERYCIII, glycosyltransferase; transferase, cytochr 99.52
2p6p_A 384 Glycosyl transferase; X-RAY-diffraction,urdamycina 99.51
3oti_A 398 CALG3; calicheamicin, TDP, structural genomics, PS 99.43
3h4t_A 404 Glycosyltransferase GTFA, glycosyltransferase; van 99.38
4fzr_A 398 SSFS6; structural genomics, PSI-biology, protein s 99.37
3tsa_A 391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 99.36
3otg_A 412 CALG1; calicheamicin, TDP, structural genomics, PS 99.21
3s2u_A 365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 98.97
1f0k_A 364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 98.28
2iuy_A 342 Avigt4, glycosyltransferase; antibiotics, family G 95.52
3okp_A 394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 95.24
2x6q_A 416 Trehalose-synthase TRET; biosynthetic protein; 2.2 94.75
3c48_A 438 Predicted glycosyltransferases; retaining glycosyl 94.71
3fro_A 439 GLGA glycogen synthase; glycosyltransferase family 94.64
1ccw_A137 Protein (glutamate mutase); coenzyme B12, radical 94.33
2r60_A 499 Glycosyl transferase, group 1; rossmann-fold; 1.80 93.91
2iw1_A 374 Lipopolysaccharide core biosynthesis protein RFAG; 92.87
2x0d_A 413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge 92.48
2gek_A 406 Phosphatidylinositol mannosyltransferase (PIMA); G 90.77
1id1_A153 Putative potassium channel protein; RCK domain, E. 90.72
1y80_A210 Predicted cobalamin binding protein; corrinoid, fa 89.43
2jjm_A 394 Glycosyl transferase, group 1 family protein; anth 89.3
1rzu_A 485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 89.19
2i2x_B258 MTAC, methyltransferase 1; TIM barrel and helix bu 88.86
2qzs_A 485 Glycogen synthase; glycosyl-transferase, GT-B fold 88.78
3zqu_A209 Probable aromatic acid decarboxylase; lyase; HET: 87.97
3lrx_A158 Putative hydrogenase; alpha-beta protein, structur 87.34
2yxb_A161 Coenzyme B12-dependent mutase; alpha/beta, structu 86.95
3hbm_A 282 UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je 86.47
3ezx_A215 MMCP 1, monomethylamine corrinoid protein 1; N ter 85.83
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 85.78
3vue_A 536 GBSS-I, granule-bound starch synthase 1, chloropla 85.46
1pno_A180 NAD(P) transhydrogenase subunit beta; nucleotide b 84.95
3qjg_A175 Epidermin biosynthesis protein EPID; structural ge 84.89
1mvl_A209 PPC decarboxylase athal3A; flavoprotein, active si 84.09
1v4v_A 376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t 83.92
1d4o_A184 NADP(H) transhydrogenase; nucleotide-binding fold, 83.09
2bru_C186 NAD(P) transhydrogenase subunit beta; paramagnetic 82.31
2fsv_C203 NAD(P) transhydrogenase subunit beta; NAD(P) trans 82.27
1djl_A207 Transhydrogenase DIII; rossmann fold dinucleotide 82.13
2ejb_A189 Probable aromatic acid decarboxylase; phenylacryli 81.54
2hy7_A 406 Glucuronosyltransferase GUMK; glycosyltransferases 80.99
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* Back     alignment and structure
Probab=99.94  E-value=1.5e-26  Score=173.08  Aligned_cols=123  Identities=20%  Similarity=0.314  Sum_probs=90.2

Q ss_pred             CCeEEEEcCCCcCChHHHHHHHHHHHHCC--CeEEEEeCcchhhhhhhhhccCCCCCCCceEEecCCCCCCCCC-CCCHH
Q 040997            3 SPHVLVMPGPAQGHVIPLLEFSQCLAKHG--FRVTFVNTDYYHKRVVESLQGKNYLEEQIRLVSIPDGMEPWED-RNDFG   79 (128)
Q Consensus         3 ~~hvl~~p~p~~GH~~P~l~la~~L~~rG--~~Vt~~~t~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~-~~~~~   79 (128)
                      ++||+++|+|++||++||++|||+|++||  ++|||++|+.+..++.+...   ...++|+|+.+|+++|++.. ..+..
T Consensus        13 ~~hvv~~P~p~~GHi~P~l~Lak~L~~~g~~~~vT~~~t~~~~~~~~~~~~---~~~~~i~~~~ipdglp~~~~~~~~~~   89 (454)
T 3hbf_A           13 LLHVAVLAFPFGTHAAPLLSLVKKIATEAPKVTFSFFCTTTTNDTLFSRSN---EFLPNIKYYNVHDGLPKGYVSSGNPR   89 (454)
T ss_dssp             CCEEEEECCCSSSSHHHHHHHHHHHHHHCTTSEEEEEECHHHHHHSCSSSS---CCCTTEEEEECCCCCCTTCCCCSCTT
T ss_pred             CCEEEEEcCCcccHHHHHHHHHHHHHhCCCCEEEEEEeCHHHHHhhhcccc---cCCCCceEEecCCCCCCCccccCChH
Confidence            57999999999999999999999999999  99999999887766544321   01247999999999887632 22222


Q ss_pred             HHHHHHHHHchHHHHHHHHHHhcCCCCCccEEEeCCCcccHHHHHHhcC
Q 040997           80 KLIENFLQVMPGKLEKLIEEINSREDEKIDCFIADGNMGWSLEVAKKMN  128 (128)
Q Consensus        80 ~~~~~~~~~~~~~~~~ll~~l~~~~~~~~d~vI~D~~~~~~~~vA~~lg  128 (128)
                      ..+..+.+.+...++++++++.++.+.+++|||+|++++|+.+||++||
T Consensus        90 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~iI~D~~~~w~~~vA~~lg  138 (454)
T 3hbf_A           90 EPIFLFIKAMQENFKHVIDEAVAETGKNITCLVTDAFFWFGADLAEEMH  138 (454)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEETTCTTHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhcCCCCcEEEECCcchHHHHHHHHhC
Confidence            2233333333444556665543221258999999999999999999997
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Back     alignment and structure
>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A* Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1y80_A Predicted cobalamin binding protein; corrinoid, factor IIIM, methyl transferase, structural genomics, PSI, protein structure initiative; HET: B1M; 1.70A {Moorella thermoacetica} Back     alignment and structure
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>2i2x_B MTAC, methyltransferase 1; TIM barrel and helix bundle (MTAB), rossman fold and helix B (MTAC); HET: B13; 2.50A {Methanosarcina barkeri} Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>3zqu_A Probable aromatic acid decarboxylase; lyase; HET: FNR; 1.50A {Pseudomonas aeruginosa} SCOP: c.34.1.0 Back     alignment and structure
>3lrx_A Putative hydrogenase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.60A {Pyrococcus furiosus} Back     alignment and structure
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A* Back     alignment and structure
>3ezx_A MMCP 1, monomethylamine corrinoid protein 1; N terminal all helical bundle C terminal rossmann fold, cobalt, metal-binding; HET: HCB; 2.56A {Methanosarcina barkeri} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* Back     alignment and structure
>1pno_A NAD(P) transhydrogenase subunit beta; nucleotide binding fold, oxidoreductase; HET: NAP; 2.10A {Rhodospirillum rubrum} SCOP: c.31.1.4 PDB: 1pnq_A* 1xlt_C* 2oor_C* 1ptj_C* 2oo5_C* Back     alignment and structure
>3qjg_A Epidermin biosynthesis protein EPID; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: FMN; 2.04A {Staphylococcus aureus} SCOP: c.34.1.0 Back     alignment and structure
>1mvl_A PPC decarboxylase athal3A; flavoprotein, active site mutant C175S; HET: FMN; 2.00A {Arabidopsis thaliana} SCOP: c.34.1.1 PDB: 1mvn_A* 1e20_A* Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>1d4o_A NADP(H) transhydrogenase; nucleotide-binding fold, protein-NADP(H) complex, inverted binding of NADP(H), oxidoreductase; HET: NAP; 1.21A {Bos taurus} SCOP: c.31.1.4 Back     alignment and structure
>2fsv_C NAD(P) transhydrogenase subunit beta; NAD(P) transhydrogenase subunits, oxidoreductas; HET: NAD NAP; 2.30A {Rhodospirillum rubrum} SCOP: c.31.1.4 PDB: 1e3t_A* 1hzz_C* 1nm5_C* 1u28_C* 1u2d_C* 1u2g_C* 2fr8_C* 2frd_C* Back     alignment and structure
>1djl_A Transhydrogenase DIII; rossmann fold dinucleotide binding fold reverse binding of N oxidoreductase; HET: NAP; 2.00A {Homo sapiens} SCOP: c.31.1.4 PDB: 1pt9_A* 1u31_A* Back     alignment and structure
>2ejb_A Probable aromatic acid decarboxylase; phenylacrylic acid decarboxylase, X-RAY diffraction, structural genomics, NPPSFA; 2.15A {Aquifex aeolicus} Back     alignment and structure
>2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 128
d2c1xa1 450 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-gluc 1e-25
d2pq6a1 473 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransfe 5e-25
d2acva1 461 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transf 1e-21
d2vcha1 471 c.87.1.10 (A:6-476) Hydroquinone glucosyltransfera 4e-19
d1rrva_ 401 c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Am 2e-13
d1pn3a_ 391 c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA 5e-13
d1iira_ 401 c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycol 6e-12
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Length = 450 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: UDPGT-like
domain: UDP glucose:flavonoid 3-o-glucosyltransferase
species: Grape (Vitis vinifera) [TaxId: 29760]

 Score = 97.5 bits (241), Expect = 1e-25
 Identities = 26/127 (20%), Positives = 48/127 (37%), Gaps = 1/127 (0%)

Query: 3   SPHVLVMPGPAQGHVIPLLEFSQCLAKHGFRVTFVNTDYYHKRVVESLQGKNYLEEQIRL 62
           +PHV V+  P   H  PLL   + LA       F                 + ++  I+ 
Sbjct: 1   NPHVAVLAFPFSTHAAPLLAVVRRLAAAAPHAVFSFFSTSQSNASIFHDSMHTMQCNIKS 60

Query: 63  VSIPDGM-EPWEDRNDFGKLIENFLQVMPGKLEKLIEEINSREDEKIDCFIADGNMGWSL 121
             I DG+ E +       + IE F +  P    + +    +     + C +AD  + ++ 
Sbjct: 61  YDISDGVPEGYVFAGRPQEDIELFTRAAPESFRQGMVMAVAETGRPVSCLVADAFIWFAA 120

Query: 122 EVAKKMN 128
           ++A +M 
Sbjct: 121 DMAAEMG 127
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Length = 473 Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Length = 461 Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 471 Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Length = 391 Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
d2c1xa1 450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 99.84
d2acva1 461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 99.81
d2pq6a1 473 (Iso)flavonoid glycosyltransferase {Medicago trunc 99.81
d2vcha1 471 Hydroquinone glucosyltransferase {Thale cress (Ara 99.78
d1pn3a_ 391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 99.6
d1rrva_ 401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 99.56
d1iira_ 401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 99.52
d1f0ka_ 351 Peptidoglycan biosynthesis glycosyltransferase Mur 98.1
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 95.8
d1rzua_ 477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 94.48
d2iw1a1 370 Lipopolysaccharide core biosynthesis protein RfaG 94.18
d2bisa1 437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 94.17
d1ep3b2160 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 93.07
d1j8yf2211 GTPase domain of the signal sequence recognition p 89.95
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 88.14
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 87.07
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 86.6
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 86.03
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 85.25
d1pnoa_180 Transhydrogenase domain III (dIII) {Rhodospirillum 85.17
d3bula2156 Methionine synthase, C-terminal domain {Escherichi 84.16
d1d4oa_177 Transhydrogenase domain III (dIII) {Cow (Bos tauru 83.15
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 82.63
d1vmaa2213 GTPase domain of the signal recognition particle r 82.22
d1kjna_152 Hypothetical protein MTH777 (MT0777) {Archaeon Met 81.65
d1okkd2207 GTPase domain of the signal recognition particle r 81.14
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: UDPGT-like
domain: UDP glucose:flavonoid 3-o-glucosyltransferase
species: Grape (Vitis vinifera) [TaxId: 29760]

Probab=99.84  E-value=9e-21  Score=137.69  Aligned_cols=122  Identities=18%  Similarity=0.214  Sum_probs=78.2

Q ss_pred             CCeEEEEcCCCcCChHHHHHHHHHHHHCCCeEEEEeCcchhhhhhhhhccCCCCCCCceEEecCCCCCCCC-CCCCH---
Q 040997            3 SPHVLVMPGPAQGHVIPLLEFSQCLAKHGFRVTFVNTDYYHKRVVESLQGKNYLEEQIRLVSIPDGMEPWE-DRNDF---   78 (128)
Q Consensus         3 ~~hvl~~p~p~~GH~~P~l~la~~L~~rG~~Vt~~~t~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~-~~~~~---   78 (128)
                      ++||+|+|+|++||++|++.||++|++|||+|||++.....................+++..++++++.+. ...+.   
T Consensus         1 ~~hvl~~p~P~~gH~~p~l~la~~L~~rGH~Vt~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (450)
T d2c1xa1           1 NPHVAVLAFPFSTHAAPLLAVVRRLAAAAPHAVFSFFSTSQSNASIFHDSMHTMQCNIKSYDISDGVPEGYVFAGRPQED   80 (450)
T ss_dssp             CCEEEEECCCSSSSHHHHHHHHHHHHHHCTTSEEEEEECHHHHHHHC-------CTTEEEEECCCCCCTTCCCCCCTTHH
T ss_pred             CCEEEEECchhHhHHHHHHHHHHHHHHCCCcEEEEEccCccchhhhhcccccccCCCceeeecCCCCCcchhhccchHHH
Confidence            58999999999999999999999999999999998754432211111000001224588888888776543 12221   


Q ss_pred             -HHHHHHHHHHchHHHHHHHHHHhcCCCCCccEEEeCCCcccHHHHHHhcC
Q 040997           79 -GKLIENFLQVMPGKLEKLIEEINSREDEKIDCFIADGNMGWSLEVAKKMN  128 (128)
Q Consensus        79 -~~~~~~~~~~~~~~~~~ll~~l~~~~~~~~d~vI~D~~~~~~~~vA~~lg  128 (128)
                       ..+.......+...+.+++...    ..++|+||+|.+..|+..+|+++|
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~----~~~~Dlvi~D~~~~~~~~~a~~~~  127 (450)
T d2c1xa1          81 IELFTRAAPESFRQGMVMAVAET----GRPVSCLVADAFIWFAADMAAEMG  127 (450)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHH----TCCCCEEEEETTSTTHHHHHHHHT
T ss_pred             HHHHHHHHHHHhHHHHHHHHHhC----CCCCeEEEECCccHHHHHHHHHhC
Confidence             2222222222222233333322    168999999999999999999875
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pnoa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d3bula2 c.23.6.1 (A:741-896) Methionine synthase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d4oa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kjna_ c.115.1.1 (A:) Hypothetical protein MTH777 (MT0777) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure