Citrus Sinensis ID: 041019

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
MIFGERAIEETHYDILSVRVDASYEEIRTGYRSAILNYHPDKLQNTSELSDHDHESGDRFLKVQKAWEILSNSRSRAVYDSELRALRQGMIAAEDVSLEDMMIEDNGEVLDLFYKCRCGDCFSIDSMELDDMGYTLLKNGNKISLQSPDTSPASVILPCGSCSLHVRLLVNADIEVTADGHL
ccccccccccccEEEEcccccccHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccEEEEEEEccccccccccc
cccccccccccHHHHccccccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccccHHHccccccccEEEEEEEcccccEEEEcHHHHHHccEEEEEcccEEEEEcccccccEEEEEccccEEEEEEEEEccEEEEEcccc
MIFGERAIEETHYDILSVRVDASYEEIRTGYRSAIlnyhpdklqntselsdhdhesGDRFLKVQKAWEILSNSRSRAVYDSELRALRQGMIAaedvsledmmieDNGEVLDLFYkcrcgdcfsidsmelDDMGYTLlkngnkislqspdtspasvilpcgscslHVRLLVNADIEVTADGHL
mifgeraieethydilsvrVDASYEEIRTGYRSAILNYHPDKLQNTSELSDHDHESGDRFLKVQKAWEIlsnsrsravydsELRALRQGMIAaedvsledMMIEDNGEVLDLFYKCRCGDCFSIDSMELDDMGYTLLKNGNKISLQSPDTSPASVILPCGSCSLHVRLLVNADIEVTADGHL
MIFGERAIEETHYDILSVRVDASYEEIRTGYRSAILNYHPDKLQNTSELSDHDHESGDRFLKVQKAWEILSNSRSRAVYDSELRALRQGMIAAEDVSLEDMMIEDNGEVLDLFYKCRCGDCFSIDSMELDDMGYTLLKNGNKISLQSPDTSPASVILPCGSCSLHVRLLVNADIEVTADGHL
******AIEETHYDILSVRVDASYEEIRTGYRSAILNYH********************FLKVQKAWEILSNSRSRAVYDSELRALRQGMIAAEDVSLEDMMIEDNGEVLDLFYKCRCGDCFSIDSMELDDMGYTLLKNGNKI*********ASVILPCGSCSLHVRLLVNADIEV******
**********THYDILSVRVDASYEEIRTGYRSAILNYHPDKL***************RFLKVQKAWEILSNSRSRAVYDS****************LEDMMIEDNGEVLDLFYKCRCGDCF**********GYTLLKNGNKISLQ***TSPASVILPCGSCSLHVRLLVNADIEVT*****
MIFGERAIEETHYDILSVRVDASYEEIRTGYRSAILNYHPDKLQNT***********DRFLKVQKAWEILSNSRSRAVYDSELRALRQGMIAAEDVSLEDMMIEDNGEVLDLFYKCRCGDCFSIDSMELDDMGYTLLKNGNKISLQSPDTSPASVILPCGSCSLHVRLLVNADIEVTADGHL
****ERAIEETHYDILSVRVDASYEEIRTGYRSAILNYHPDKLQ*****SDHDHESGDRFLKVQKAWEILSNSRSRAVYDSELRALRQGMIAAEDVSLEDMMIEDNGEVLDLFYKCRCGDCFSIDSMELDDMGYTLLKNGNKISLQSPDTSPASVILPCGSCSLHVRLLVNADIEVTAD***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIFGERAIEETHYDILSVRVDASYEEIRTGYRSAILNYHPDKLQNTSELSDHDHESGDRFLKVQKAWEILSNSRSRAVYDSELRALRQGMIAAEDVSLEDMMIEDNGEVLDLFYKCRCGDCFSIDSMELDDMGYTLLKNGNKISLQSPDTSPASVILPCGSCSLHVRLLVNADIEVTADGHL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query182 2.2.26 [Sep-21-2011]
P47138172 Diphthamide biosynthesis yes no 0.791 0.837 0.328 4e-11
Q54CI5170 DPH4 homolog OS=Dictyoste yes no 0.747 0.8 0.293 5e-11
Q5NVI9 396 DnaJ homolog subfamily A yes no 0.346 0.159 0.369 2e-09
Q95JF4 397 DnaJ homolog subfamily A N/A no 0.346 0.158 0.369 2e-09
P63036 397 DnaJ homolog subfamily A yes no 0.346 0.158 0.369 2e-09
P63037 397 DnaJ homolog subfamily A no no 0.346 0.158 0.369 2e-09
P31689 397 DnaJ homolog subfamily A yes no 0.346 0.158 0.369 2e-09
Q5E954 397 DnaJ homolog subfamily A yes no 0.346 0.158 0.369 2e-09
Q91ZF0196 DnaJ homolog subfamily C no no 0.752 0.698 0.276 3e-09
Q0II91 533 DnaJ homolog subfamily C no no 0.417 0.142 0.392 5e-09
>sp|P47138|DPH4_YEAST Diphthamide biosynthesis protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JJJ3 PE=1 SV=1 Back     alignment and function desciption
 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 63/192 (32%), Positives = 87/192 (45%), Gaps = 48/192 (25%)

Query: 11  THYDILSVRVDASYEEIRTGYRSAILNYHPDKLQNTSELSDHDHESGDRFLKVQKAWEIL 70
           THY+IL +  DA+ +EI+  YR+ +LN HPDKL      S HD  S     K+Q A++IL
Sbjct: 8   THYEILRIPSDATQDEIKKAYRNRLLNTHPDKLSK----SIHDTVSNVTINKIQDAYKIL 63

Query: 71  SNSRSRAVYDSEL--RALRQGMIAAED----VSLEDMMIEDNGEVLDLFYKC-RC----G 119
           SN ++R  YD  +     RQG     D     SL+D   +++   L+    C RC    G
Sbjct: 64  SNIKTRREYDRLILENYKRQGFHNCGDGLDEFSLDDFSFDEDK--LEFMMNCPRCQFVGG 121

Query: 120 DCFS----------IDSMELDDMGYTLLKNGNKISLQSPDTSPASVILPCGSCSLHVRLL 169
             FS          +D+ME    GY LL                     C +CSL ++  
Sbjct: 122 FHFSESLLDECIDNVDAMERSHSGYQLLTQ-------------------CSACSLWLK-- 160

Query: 170 VNADIEVTADGH 181
           VN DIE   +G 
Sbjct: 161 VNFDIEEEQEGQ 172
Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L-methionine to a histidine residue. Diphthamide is a post-translational modification of histidine which occurs in elongation factor 2.
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)
>sp|Q54CI5|DPH4_DICDI DPH4 homolog OS=Dictyostelium discoideum GN=dph4 PE=3 SV=1 Back     alignment and function description
>sp|Q5NVI9|DNJA1_PONAB DnaJ homolog subfamily A member 1 OS=Pongo abelii GN=DNAJA1 PE=2 SV=1 Back     alignment and function description
>sp|Q95JF4|DNAJ1_CHLAE DnaJ homolog subfamily A member 1 OS=Chlorocebus aethiops GN=DNAJA1 PE=2 SV=1 Back     alignment and function description
>sp|P63036|DNJA1_RAT DnaJ homolog subfamily A member 1 OS=Rattus norvegicus GN=Dnaja1 PE=2 SV=1 Back     alignment and function description
>sp|P63037|DNJA1_MOUSE DnaJ homolog subfamily A member 1 OS=Mus musculus GN=Dnaja1 PE=1 SV=1 Back     alignment and function description
>sp|P31689|DNJA1_HUMAN DnaJ homolog subfamily A member 1 OS=Homo sapiens GN=DNAJA1 PE=1 SV=2 Back     alignment and function description
>sp|Q5E954|DNJA1_BOVIN DnaJ homolog subfamily A member 1 OS=Bos taurus GN=DNAJA1 PE=2 SV=2 Back     alignment and function description
>sp|Q91ZF0|DJC24_MOUSE DnaJ homolog subfamily C member 24 OS=Mus musculus GN=Dnajc24 PE=1 SV=3 Back     alignment and function description
>sp|Q0II91|DJC21_BOVIN DnaJ homolog subfamily C member 21 OS=Bos taurus GN=DNAJC21 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
225432792182 PREDICTED: DPH4 homolog isoform 3 [Vitis 1.0 1.0 0.664 1e-65
224137450182 predicted protein [Populus trichocarpa] 1.0 1.0 0.659 2e-65
255538362182 zinc finger protein, putative [Ricinus c 0.967 0.967 0.664 2e-64
356540996178 PREDICTED: diphthamide biosynthesis prot 0.956 0.977 0.610 1e-58
449470051173 PREDICTED: diphthamide biosynthesis prot 0.917 0.965 0.598 6e-54
356545207192 PREDICTED: LOW QUALITY PROTEIN: diphtham 0.945 0.895 0.539 3e-51
297813455180 hypothetical protein ARALYDRAFT_327188 [ 0.956 0.966 0.519 3e-48
15234951174 DNAJ heat shock N-terminal domain-contai 0.945 0.988 0.528 4e-48
357473855133 Chaperone protein dnaJ [Medicago truncat 0.708 0.969 0.578 3e-37
226504220177 uncharacterized protein LOC100274479 [Ze 0.912 0.937 0.464 1e-36
>gi|225432792|ref|XP_002283454.1| PREDICTED: DPH4 homolog isoform 3 [Vitis vinifera] gi|225432794|ref|XP_002283447.1| PREDICTED: DPH4 homolog isoform 2 [Vitis vinifera] gi|225432796|ref|XP_002283441.1| PREDICTED: DPH4 homolog isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 147/182 (80%)

Query: 1   MIFGERAIEETHYDILSVRVDASYEEIRTGYRSAILNYHPDKLQNTSELSDHDHESGDRF 60
           M+  + + E+T+YDILSV+ DASYEEIR  YRSAILN HPDKLQ T+E S+ D ESGDRF
Sbjct: 1   MLLYKNSFEQTYYDILSVKEDASYEEIRGCYRSAILNSHPDKLQKTTETSNTDPESGDRF 60

Query: 61  LKVQKAWEILSNSRSRAVYDSELRALRQGMIAAEDVSLEDMMIEDNGEVLDLFYKCRCGD 120
           LK+QKAWE LS+ RSRAVYDS L+A RQ    AED+SLEDM IED+G+VL+LFY+CRCGD
Sbjct: 61  LKIQKAWETLSDPRSRAVYDSGLQASRQDTATAEDLSLEDMTIEDDGKVLELFYQCRCGD 120

Query: 121 CFSIDSMELDDMGYTLLKNGNKISLQSPDTSPASVILPCGSCSLHVRLLVNADIEVTADG 180
            FS+DS EL +MGY + ++G+KISLQ+PD+ PAS ILPCGSCSL VRLL+NAD  V    
Sbjct: 121 YFSVDSSELGEMGYAVFRDGSKISLQTPDSLPASFILPCGSCSLKVRLLINADTAVVVSD 180

Query: 181 HL 182
           +L
Sbjct: 181 NL 182

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224137450|ref|XP_002327129.1| predicted protein [Populus trichocarpa] gi|222835444|gb|EEE73879.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255538362|ref|XP_002510246.1| zinc finger protein, putative [Ricinus communis] gi|223550947|gb|EEF52433.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356540996|ref|XP_003538970.1| PREDICTED: diphthamide biosynthesis protein 4-like [Glycine max] Back     alignment and taxonomy information
>gi|449470051|ref|XP_004152732.1| PREDICTED: diphthamide biosynthesis protein 4-like [Cucumis sativus] gi|449496015|ref|XP_004160012.1| PREDICTED: diphthamide biosynthesis protein 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356545207|ref|XP_003541036.1| PREDICTED: LOW QUALITY PROTEIN: diphthamide biosynthesis protein 4-like [Glycine max] Back     alignment and taxonomy information
>gi|297813455|ref|XP_002874611.1| hypothetical protein ARALYDRAFT_327188 [Arabidopsis lyrata subsp. lyrata] gi|297320448|gb|EFH50870.1| hypothetical protein ARALYDRAFT_327188 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15234951|ref|NP_192751.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gi|3695404|gb|AAC62804.1| contains similarity to DnaJ domains (Pfam: PF00226, E=5.8e-13) [Arabidopsis thaliana] gi|4538977|emb|CAB39765.1| putative protein [Arabidopsis thaliana] gi|7267709|emb|CAB78136.1| putative protein [Arabidopsis thaliana] gi|17529216|gb|AAL38835.1| unknown protein [Arabidopsis thaliana] gi|20466053|gb|AAM20361.1| unknown protein [Arabidopsis thaliana] gi|332657446|gb|AEE82846.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357473855|ref|XP_003607212.1| Chaperone protein dnaJ [Medicago truncatula] gi|355508267|gb|AES89409.1| Chaperone protein dnaJ [Medicago truncatula] Back     alignment and taxonomy information
>gi|226504220|ref|NP_001142310.1| uncharacterized protein LOC100274479 [Zea mays] gi|194708154|gb|ACF88161.1| unknown [Zea mays] gi|414885776|tpg|DAA61790.1| TPA: hypothetical protein ZEAMMB73_952708 [Zea mays] gi|414885777|tpg|DAA61791.1| TPA: hypothetical protein ZEAMMB73_952708 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
TAIR|locus:2124685174 AT4G10130 [Arabidopsis thalian 0.945 0.988 0.528 9.8e-48
SGD|S000003858172 JJJ3 "Protein of unknown funct 0.879 0.930 0.316 4.9e-14
DICTYBASE|DDB_G0292980170 dph4 "diphthamide biosynthesis 0.741 0.794 0.307 7.1e-13
TIGR_CMR|CJE_1396 373 CJE_1396 "co-chaperone protein 0.538 0.262 0.333 8.6e-12
UNIPROTKB|F1NLH8 402 DNAJA4 "Uncharacterized protei 0.439 0.199 0.391 1.5e-11
RGD|1310035 555 Dnaja4 "DnaJ (Hsp40) homolog, 0.417 0.136 0.386 5.5e-11
MGI|MGI:1919522196 Dnajc24 "DnaJ (Hsp40) homolog, 0.675 0.627 0.292 5.8e-11
ZFIN|ZDB-GENE-040426-1153149 dnajc24 "DnaJ (Hsp40) homolog, 0.747 0.912 0.279 7.4e-11
UNIPROTKB|Q0VBY7148 DNAJC24 "DnaJ homolog subfamil 0.697 0.858 0.296 1.2e-10
UNIPROTKB|Q6P3W2148 DNAJC24 "DnaJ homolog subfamil 0.681 0.837 0.290 1.5e-10
TAIR|locus:2124685 AT4G10130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 499 (180.7 bits), Expect = 9.8e-48, P = 9.8e-48
 Identities = 93/176 (52%), Positives = 131/176 (74%)

Query:     1 MIFGERAIEETHYDILSVRVDASYEEIRTGYRSAILNYHPDKLQNTSELSDHDHESGDRF 60
             M+ GE  + ET+Y+ILSV+ DASYEEIR  YRSAIL+ HPDKL NTS  S  D    ++F
Sbjct:     1 MLVGENCVHETYYEILSVKEDASYEEIRNSYRSAILHSHPDKLNNTSRSSSDD----EKF 56

Query:    61 LKVQKAWEILSNSRSRAVYDSELRALRQGMIAAEDVSLEDMMIEDNGEVLDLFYKCRCGD 120
             LK+QKAWE+LS++  R VYD++LR+ R   I A+++S+EDM +E  G+V+DLFY+CRCGD
Sbjct:    57 LKIQKAWEVLSDAELRVVYDNDLRSSRHDGITADEISIEDMSVEITGDVIDLFYQCRCGD 116

Query:   121 CFSIDSMELDDMGYTLLKNGNKISLQSPDTSPASVILPCGSCSLHVRLLVNADIEV 176
              F +DS EL  MG+ LL++G+ + ++      ASV+LPCGSCSL  R+ V++D+++
Sbjct:   117 YFCVDSSELGTMGFALLRDGDFVYVKRLGAFVASVVLPCGSCSLKTRVWVDSDMKI 172
GO:0005737 "cytoplasm" evidence=ISM
GO:0006457 "protein folding" evidence=ISS
GO:0031072 "heat shock protein binding" evidence=IEA
SGD|S000003858 JJJ3 "Protein of unknown function, contains a CSL Zn finger and a DnaJ-doma" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0292980 dph4 "diphthamide biosynthesis protein 4" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_1396 CJE_1396 "co-chaperone protein DnaJ" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms
UNIPROTKB|F1NLH8 DNAJA4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1310035 Dnaja4 "DnaJ (Hsp40) homolog, subfamily A, member 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1919522 Dnajc24 "DnaJ (Hsp40) homolog, subfamily C, member 24" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1153 dnajc24 "DnaJ (Hsp40) homolog, subfamily C, member 24" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q0VBY7 DNAJC24 "DnaJ homolog subfamily C member 24" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P3W2 DNAJC24 "DnaJ homolog subfamily C member 24" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6FWM1DPH4_CANGANo assigned EC number0.30480.82960.8628yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_scaffold_40000264
hypothetical protein (182 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
pfam0022663 pfam00226, DnaJ, DnaJ domain 4e-17
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 1e-14
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 2e-13
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 2e-13
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 1e-12
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 3e-11
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 1e-10
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 1e-10
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 2e-10
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 3e-10
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 6e-10
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 9e-10
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 9e-10
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 2e-09
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 2e-09
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 3e-09
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 7e-09
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 2e-08
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 2e-08
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 3e-08
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 5e-08
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 5e-08
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein Cbp 6e-08
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 7e-08
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 1e-07
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 2e-07
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 5e-07
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 7e-07
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 1e-06
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 3e-06
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 4e-06
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 5e-06
PRK14299 291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 1e-05
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 3e-05
COG5269 379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 5e-05
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 5e-05
pfam0520755 pfam05207, zf-CSL, CSL zinc finger 2e-04
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 4e-04
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 7e-04
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information 
 Score = 71.4 bits (176), Expect = 4e-17
 Identities = 28/70 (40%), Positives = 41/70 (58%), Gaps = 7/70 (10%)

Query: 11 THYDILSVRVDASYEEIRTGYRSAILNYHPDKLQNTSELSDHDHESGDRFLKVQKAWEIL 70
           +Y+IL V  DAS EEI+  YR   L YHPDK          D  + ++F ++ +A+E+L
Sbjct: 1  DYYEILGVPRDASDEEIKKAYRKLALKYHPDKNP-------GDPAAEEKFKEINEAYEVL 53

Query: 71 SNSRSRAVYD 80
          S+   RA+YD
Sbjct: 54 SDPEKRAIYD 63

DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|191232 pfam05207, zf-CSL, CSL zinc finger Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 182
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.91
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.9
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 99.85
PRK14288 369 chaperone protein DnaJ; Provisional 99.84
PRK14296 372 chaperone protein DnaJ; Provisional 99.83
PRK14279 392 chaperone protein DnaJ; Provisional 99.82
PRK14286 372 chaperone protein DnaJ; Provisional 99.81
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.81
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.81
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.8
PRK14287 371 chaperone protein DnaJ; Provisional 99.8
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.8
PRK14283 378 chaperone protein DnaJ; Provisional 99.79
PRK14299 291 chaperone protein DnaJ; Provisional 99.79
PRK14276 380 chaperone protein DnaJ; Provisional 99.79
PRK14282 369 chaperone protein DnaJ; Provisional 99.79
PRK14285 365 chaperone protein DnaJ; Provisional 99.79
PRK14291 382 chaperone protein DnaJ; Provisional 99.79
PRK14298 377 chaperone protein DnaJ; Provisional 99.78
PRK14294 366 chaperone protein DnaJ; Provisional 99.78
PRK14295 389 chaperone protein DnaJ; Provisional 99.78
PRK14280 376 chaperone protein DnaJ; Provisional 99.78
PRK14277 386 chaperone protein DnaJ; Provisional 99.78
PRK14278 378 chaperone protein DnaJ; Provisional 99.78
PRK14301 373 chaperone protein DnaJ; Provisional 99.78
PRK14297 380 chaperone protein DnaJ; Provisional 99.77
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.77
PRK14284 391 chaperone protein DnaJ; Provisional 99.77
PRK10767 371 chaperone protein DnaJ; Provisional 99.77
KOG0691 296 consensus Molecular chaperone (DnaJ superfamily) [ 99.77
PRK14281 397 chaperone protein DnaJ; Provisional 99.76
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.75
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.74
PRK14300 372 chaperone protein DnaJ; Provisional 99.74
PRK14289 386 chaperone protein DnaJ; Provisional 99.74
PRK14293 374 chaperone protein DnaJ; Provisional 99.73
PRK14290 365 chaperone protein DnaJ; Provisional 99.73
PRK14292 371 chaperone protein DnaJ; Provisional 99.73
PF0520755 zf-CSL: CSL zinc finger; InterPro: IPR007872 Zinc 99.73
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.73
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.72
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.72
KOG292367 consensus Uncharacterized conserved protein [Funct 99.69
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.69
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.69
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.63
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.62
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.62
PRK05014171 hscB co-chaperone HscB; Provisional 99.61
PHA03102153 Small T antigen; Reviewed 99.61
PRK01356166 hscB co-chaperone HscB; Provisional 99.6
PRK00294173 hscB co-chaperone HscB; Provisional 99.58
PRK03578176 hscB co-chaperone HscB; Provisional 99.57
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.56
COG521667 Uncharacterized conserved protein [Function unknow 99.53
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.53
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.47
KOG0722 329 consensus Molecular chaperone (DnaJ superfamily) [ 99.46
PTZ00100116 DnaJ chaperone protein; Provisional 99.45
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.39
KOG0714 306 consensus Molecular chaperone (DnaJ superfamily) [ 99.36
PRK01773173 hscB co-chaperone HscB; Provisional 99.31
PHA02624 647 large T antigen; Provisional 99.31
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.22
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 99.22
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 99.17
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.99
KOG0568 342 consensus Molecular chaperone (DnaJ superfamily) [ 98.58
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.39
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 98.3
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.96
KOG0431453 consensus Auxilin-like protein and related protein 97.63
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 97.46
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.84
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 95.95
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 93.99
PF1371736 zinc_ribbon_4: zinc-ribbon domain 90.49
KOG0724 335 consensus Zuotin and related molecular chaperones 89.28
COG199649 RPC10 DNA-directed RNA polymerase, subunit RPC10 ( 89.27
PF1371937 zinc_ribbon_5: zinc-ribbon domain 88.11
PF11833194 DUF3353: Protein of unknown function (DUF3353); In 87.39
TIGR0120654 lysW lysine biosynthesis protein LysW. This very s 86.28
PF0518066 zf-DNL: DNL zinc finger; InterPro: IPR007853 Zinc 85.77
PF14687112 DUF4460: Domain of unknown function (DUF4460) 85.13
PF1344662 RPT: A repeated domain in UCH-protein 82.81
KOG3277165 consensus Uncharacterized conserved protein [Funct 81.08
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.91  E-value=5.5e-25  Score=189.36  Aligned_cols=74  Identities=38%  Similarity=0.596  Sum_probs=68.8

Q ss_pred             CccCccccccCCCCCCHHHHHHHHHHHHHhhCCCCCCCCCCCCCCCchHHHHHHHHHHHHHHhcCchhHHHHHHHHHHHh
Q 041019            8 IEETHYDILSVRVDASYEEIRTGYRSAILNYHPDKLQNTSELSDHDHESGDRFLKVQKAWEILSNSRSRAVYDSELRALR   87 (182)
Q Consensus         8 ~~~d~Y~iLgv~~~as~~eIk~aYrkl~~~~HPDk~~~~~~~~~~~~~a~~~f~~I~~Ay~vL~dp~~R~~YD~~l~~~~   87 (182)
                      ...|||+||||+++||.+|||+|||+||++||||+++.       ++.|.++|++|++||+||+||++|+.||+++....
T Consensus         2 ~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g-------~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~   74 (371)
T COG0484           2 AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPG-------DKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGF   74 (371)
T ss_pred             CccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCC-------CHHHHHHHHHHHHHHHHhCCHHHHHHhhccCcccc
Confidence            57899999999999999999999999999999999995       27899999999999999999999999999987754


Q ss_pred             c
Q 041019           88 Q   88 (182)
Q Consensus        88 ~   88 (182)
                      .
T Consensus        75 ~   75 (371)
T COG0484          75 K   75 (371)
T ss_pred             c
Confidence            3

>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF05207 zf-CSL: CSL zinc finger; InterPro: IPR007872 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>KOG2923 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5216 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised Back     alignment and domain information
>TIGR01206 lysW lysine biosynthesis protein LysW Back     alignment and domain information
>PF05180 zf-DNL: DNL zinc finger; InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14687 DUF4460: Domain of unknown function (DUF4460) Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>KOG3277 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 2e-10
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 1e-08
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 3e-08
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 7e-08
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 1e-07
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 1e-07
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 1e-07
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-07
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 3e-07
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 6e-07
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 6e-06
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 6e-06
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 3e-05
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 6e-05
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 1e-04
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 1e-04
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 2e-04
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 2e-04
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 3e-04
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 3e-04
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 3e-04
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 5e-04
3lz8_A 329 Structure Of A Putative Chaperone Dnaj From Klebsie 5e-04
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure 
Iteration: 1

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 45/73 (61%), Gaps = 10/73 (13%)
Query: 9  EETHYDILSVRVDASYEEIRTGYRSAILNYHPDKLQNTSELSDHDHESGDRFLKVQKAWE 68
          E T+YD+L V+ +A+ EE++  YR   L YHPDK  N           G++F ++ +A+E
Sbjct: 5  ETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPN----------EGEKFKQISQAYE 54
Query: 69 ILSNSRSRAVYDS 81
          +LS+++ R +YD 
Sbjct: 55 VLSDAKKRELYDK 67
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 4e-37
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 2e-13
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 4e-13
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 1e-12
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 1e-12
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 1e-12
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 2e-12
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 2e-12
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 2e-12
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 2e-12
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 3e-12
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 3e-12
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 4e-12
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 5e-12
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 6e-12
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 7e-12
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 7e-12
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 2e-11
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 3e-11
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 2e-10
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 3e-10
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 8e-10
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 9e-10
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 2e-09
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-09
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 7e-09
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 6e-08
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 3e-07
1wge_A83 Hypothetical protein 2610018L09RIK; diphthamide,CS 4e-07
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 7e-07
2jr7_A89 DPH3 homolog; DESR1, CSL zinc finger, metal bindin 2e-06
1yop_A83 KTI11P; zinc finger, metal binding protein; NMR {S 2e-06
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 2e-06
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 3e-06
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 4e-06
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 5e-05
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 6e-04
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
 Score =  124 bits (314), Expect = 4e-37
 Identities = 41/175 (23%), Positives = 71/175 (40%), Gaps = 27/175 (15%)

Query: 1   MIFGERAIEETHYDILSVRVDASYEEIRTGYRSAILNYHPDKLQNTSELSDHDHESGDRF 60
           M+  E+  ++  Y IL     A+  +++  Y+  IL YHPDK          + E   +F
Sbjct: 1   MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVE-ECVQKF 59

Query: 61  LKVQKAWEILSNSRSRAVYDSELR--ALRQGMIAAEDVSLEDMMIEDNGEVLDLFYKCRC 118
           +++ +AW+IL N  ++  YD +     LR        V LE+M   +       +  CRC
Sbjct: 60  IEIDQAWKILGNEETKREYDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSF--YLSCRC 117

Query: 119 GDCFSIDSMELDDMGYTLLKNGNKISLQSPDTSPASVILPCGSCSLHVRLLVNAD 173
           G  +S+   E +++                        + C +CSL + LL    
Sbjct: 118 GGKYSVSKDEAEEVSL----------------------ISCDTCSLIIELLHYNH 150
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>1wge_A Hypothetical protein 2610018L09RIK; diphthamide,CSL zinc finger, ADP-ribosylating toxin, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.17.1 Length = 83 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>2jr7_A DPH3 homolog; DESR1, CSL zinc finger, metal binding protein; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1yop_A KTI11P; zinc finger, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: g.41.17.1 PDB: 1yws_A Length = 83 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 100.0
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.87
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.87
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.87
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.87
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.87
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.86
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.86
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.86
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.86
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.85
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.84
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.84
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.84
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.84
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.82
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.82
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.79
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.78
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.78
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.76
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.74
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.74
2jr7_A89 DPH3 homolog; DESR1, CSL zinc finger, metal bindin 99.73
1yop_A83 KTI11P; zinc finger, metal binding protein; NMR {S 99.73
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.72
1wge_A83 Hypothetical protein 2610018L09RIK; diphthamide,CS 99.72
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.72
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.71
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.71
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.7
2guz_A71 Mitochondrial import inner membrane translocase su 99.7
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.69
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.69
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.67
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.6
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.15
2guz_B65 Mitochondrial import inner membrane translocase su 99.04
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 90.63
2e2z_A100 TIM15; protein import, zinc finger, protein transp 87.18
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.7e-37  Score=238.86  Aligned_cols=147  Identities=27%  Similarity=0.517  Sum_probs=122.4

Q ss_pred             CCCCCCCCccCccccccCCCCCCHHHHHHHHHHHHHhhCCCCCCCCCCCCCCCchHHHHHHHHHHHHHHhcCchhHHHHH
Q 041019            1 MIFGERAIEETHYDILSVRVDASYEEIRTGYRSAILNYHPDKLQNTSELSDHDHESGDRFLKVQKAWEILSNSRSRAVYD   80 (182)
Q Consensus         1 m~~~~~~~~~d~Y~iLgv~~~as~~eIk~aYrkl~~~~HPDk~~~~~~~~~~~~~a~~~f~~I~~Ay~vL~dp~~R~~YD   80 (182)
                      ||..+....+|||+||||+++++.++||+|||+|++++||||++.... ......+.+.|++|++||++|+||.+|+.||
T Consensus         1 mm~~~~~~~~~~y~iLgv~~~a~~~eIk~aYr~l~~~~HPDk~~~~~~-~~~~~~a~~~f~~i~~Ay~~L~dp~~R~~Yd   79 (155)
T 2l6l_A            1 MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVP-AGTVEECVQKFIEIDQAWKILGNEETKREYD   79 (155)
T ss_dssp             CCCCCCCCCSHHHHHHTCCTTCCHHHHHHHHHHHHHHHSCCCCCCCCT-THHHHHHHHHHHHHHHHHHHSSSHHHHCHHH
T ss_pred             CCCcccCCCCChhHhcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCCCc-hhHHHHHHHHHHHHHHHHHHcCCHHHHHHHH
Confidence            555666788999999999999999999999999999999999887321 1112346789999999999999999999999


Q ss_pred             HHHHHHh--cccccccccCcccccccCCCceeeEEEecccCCceeeccccccccccccccCCCccccCCCCCCCceEEEe
Q 041019           81 SELRALR--QGMIAAEDVSLEDMMIEDNGEVLDLFYKCRCGDCFSIDSMELDDMGYTLLKNGNKISLQSPDTSPASVILP  158 (182)
Q Consensus        81 ~~l~~~~--~~~~~~~~~~l~d~~~~~~~~~~~~~~~CrCg~~f~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~v~  158 (182)
                      ..+....  ..+.....+.+++|.+.+...  .|+++||||+.|.|++++++. |                     ++|+
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~m~~~e~~~--~f~~~CrCG~~f~i~~~~l~~-~---------------------~~v~  135 (155)
T 2l6l_A           80 LQRCEDDLRNVGPVDAQVYLEEMSWNEGDH--SFYLSCRCGGKYSVSKDEAEE-V---------------------SLIS  135 (155)
T ss_dssp             HHHHHHHHHTTCSSSEEEETTTSEEETTTT--EEEEECSSSCEEEEETTHHHH-C---------------------CEEE
T ss_pred             HHcchhhccccccccceeeHHHhccccCCc--EEEEcCCCCCeEEecHHHhCC-C---------------------CEEE
Confidence            9887543  235556677888998876654  699999999999999999975 1                     3799


Q ss_pred             CCCccceEEEEEec
Q 041019          159 CGSCSLHVRLLVNA  172 (182)
Q Consensus       159 C~~CSl~i~V~~~~  172 (182)
                      |++|||||+|+|..
T Consensus       136 C~sCSl~~~v~~~~  149 (155)
T 2l6l_A          136 CDTCSLIIELLHYN  149 (155)
T ss_dssp             CSSSSCEEEEECCC
T ss_pred             CCCCceEEEEEEcc
Confidence            99999999999964
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2jr7_A DPH3 homolog; DESR1, CSL zinc finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1yop_A KTI11P; zinc finger, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: g.41.17.1 PDB: 1yws_A Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1wge_A Hypothetical protein 2610018L09RIK; diphthamide,CSL zinc finger, ADP-ribosylating toxin, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.17.1 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2e2z_A TIM15; protein import, zinc finger, protein transport, chaperone regulator; NMR {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 182
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 2e-13
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 4e-10
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 1e-09
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 2e-09
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 6e-08
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 2e-06
d1wgea170 g.41.17.1 (A:8-77) DelGEF-interacting protein 1, D 3e-06
d1ywsa182 g.41.17.1 (A:1-82) Diphthamide biosynthesis protei 4e-06
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 4e-06
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 60.8 bits (147), Expect = 2e-13
 Identities = 23/85 (27%), Positives = 42/85 (49%), Gaps = 1/85 (1%)

Query: 5  ERAIEETHYDILSVRVDASYEEIRTGYRSAILNYHPDKLQNTSELSDHDHESGDRFLKVQ 64
          E+ +++  Y IL     A+  +++  Y+  IL YHPDK       +    E   +F+++ 
Sbjct: 11 EQTLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSA-DVPAGTMEECMQKFIEID 69

Query: 65 KAWEILSNSRSRAVYDSELRALRQG 89
          +AW+IL N  ++  YD +      G
Sbjct: 70 QAWKILGNEETKKKYDLQRSGPSSG 94
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wgea1 g.41.17.1 (A:8-77) DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 Back     information, alignment and structure
>d1ywsa1 g.41.17.1 (A:1-82) Diphthamide biosynthesis protein 3, DPH3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 82 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.91
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.86
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.8
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.78
d1ywsa182 Diphthamide biosynthesis protein 3, DPH3 {Baker's 99.78
d1wgea170 DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus 99.77
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.75
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.7
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.67
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.91  E-value=1.6e-24  Score=145.97  Aligned_cols=69  Identities=35%  Similarity=0.638  Sum_probs=63.9

Q ss_pred             ccCccccccCCCCCCHHHHHHHHHHHHHhhCCCCCCCCCCCCCCCchHHHHHHHHHHHHHHhcCchhHHHHHHHHH
Q 041019            9 EETHYDILSVRVDASYEEIRTGYRSAILNYHPDKLQNTSELSDHDHESGDRFLKVQKAWEILSNSRSRAVYDSELR   84 (182)
Q Consensus         9 ~~d~Y~iLgv~~~as~~eIk~aYrkl~~~~HPDk~~~~~~~~~~~~~a~~~f~~I~~Ay~vL~dp~~R~~YD~~l~   84 (182)
                      .+|||+||||+++||.++||+|||++++++|||+++..       +.+...|..|++||+||+||.+|+.||+++.
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~-------~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~   70 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGD-------KEAEAKFKEIKEAYEVLTDSQKRAAYDQYGH   70 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTT-------CHHHHHHHHHHHHHHHTTSSHHHHHHHHHTT
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCC-------hHHHHHHHHHHHHHHhcCCHHHHHHHHHhCc
Confidence            57999999999999999999999999999999998762       4677889999999999999999999999864
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ywsa1 g.41.17.1 (A:1-82) Diphthamide biosynthesis protein 3, DPH3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wgea1 g.41.17.1 (A:8-77) DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure