Citrus Sinensis ID: 041025


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MIDCSTAVELQNGHEAKEEEKSGRGMQVQGCKVEGLSIASPSRSISLNFLFTSHAHMDHIFTLLVLHIWRYSKNKFQPLKEKQKENQKPQKRKWLKVSN
ccccccHHHHccccHHHHHHHccccEEEEEEEEEEEEEcccccEEEEEEEEEcccHHHHHHHHHHHHHHHHccccccccHHHHHHcccHHccccEEccc
cccccHHHHHcccccccHEcccccccEEEccEEEEEEEccccccEEHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccHcEEEEEcc
MIDCSTAVelqngheakeeeksgrgmqvqgckveglsiaspsrsisLNFLFTSHAHMDHIFTLLVLHIWRYSknkfqplkekqkenqkpqkrkwlkvsn
midcstavelqngheakeeeksgrgmqVQGCKVEGLSIASPSRSISLNFLFTSHAHMDHIFTLLVLHIWRYSKNKfqplkekqkenqkpqkrkwlkvsn
MIDCSTAVELQNGHEAKEEEKSGRGMQVQGCKVEGLSIASPSRSISLNFLFTSHAHMDHIFTLLVLHIWRYSKNKFqplkekqkenqkpqkrkWLKVSN
**********************************GLSIA***RSISLNFLFTSHAHMDHIFTLLVLHIWRYSK**************************
****STA************************KVEGLSIASPSRSISLNFLFTSHAHMDHIFTLLVLHIWRYSK********************WLK***
MIDCSTAVELQN*****************GCKVEGLSIASPSRSISLNFLFTSHAHMDHIFTLLVLHIWRYSKNKFQP*********************
*IDCSTAVELQ************RGMQVQGCKVEGLSIASPSRSISLNFLFTSHAHMDHIFTLLVLHIWRYSKNKFQPLKEKQKENQKPQKRKWLKV**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIDCSTAVELQNGHEAKEEEKSGRGMQVQGCKVEGLSIASPSRSISLNFLFTSHAHMDHIFTLLVLHIWRYSKNKFQPLKEKQKENQKPQKRKWLKVSN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query99 2.2.26 [Sep-21-2011]
Q8LGU7 280 Nuclear ribonuclease Z OS yes no 0.373 0.132 0.392 0.0002
>sp|Q8LGU7|RNZN_ARATH Nuclear ribonuclease Z OS=Arabidopsis thaliana GN=NUZ PE=2 SV=3 Back     alignment and function desciption
 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 19/56 (33%)

Query: 24 RGMQVQGCKVEGLSIAS-------------------PSRSISLNFLFTSHAHMDHI 60
          + MQ++G  +EGLSI                     P R+IS +FLF SH+HMDHI
Sbjct: 5  KAMQIEGYPIEGLSIGGHETCIIFPSLRIAFDIGRCPHRAISQDFLFISHSHMDHI 60




Zinc phosphodiesterase, which displays some tRNA 3'-processing endonuclease activity. Probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 2EC: 6EC: .EC: 1EC: 1

Close Homologs in the Non-Redundant Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query99
TAIR|locus:2019235 280 TRZ1 "tRNAse Z1" [Arabidopsis 0.202 0.071 0.7 1.6e-05
TAIR|locus:2058374 354 CPZ [Arabidopsis thaliana (tax 0.202 0.056 0.65 0.00027
TAIR|locus:2019235 TRZ1 "tRNAse Z1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 78 (32.5 bits), Expect = 1.6e-05, Sum P(2) = 1.6e-05
 Identities = 14/20 (70%), Positives = 17/20 (85%)

Query:    41 PSRSISLNFLFTSHAHMDHI 60
             P R+IS +FLF SH+HMDHI
Sbjct:    41 PHRAISQDFLFISHSHMDHI 60


GO:0005634 "nucleus" evidence=ISM;TAS
GO:0008033 "tRNA processing" evidence=TAS
GO:0042781 "3'-tRNA processing endoribonuclease activity" evidence=IDA
GO:0042780 "tRNA 3'-end processing" evidence=IDA
GO:0000398 "mRNA splicing, via spliceosome" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0030422 "production of siRNA involved in RNA interference" evidence=RCA
GO:0035196 "production of miRNAs involved in gene silencing by miRNA" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
TAIR|locus:2058374 CPZ [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

No confident hit detected by STRING


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 99
COG1234 292 ElaC Metal-dependent hydrolases of the beta-lactam 98.69
PRK00055 270 ribonuclease Z; Reviewed 98.57
TIGR02649 303 true_RNase_BN ribonuclease BN. Members of this pro 98.56
TIGR02651 299 RNase_Z ribonuclease Z. Processing of the 3-prime 98.46
COG1237 259 Metal-dependent hydrolases of the beta-lactamase s 98.4
PF00753194 Lactamase_B: Metallo-beta-lactamase superfamily; I 98.29
COG0595 555 mRNA degradation ribonucleases J1/J2 (metallo-beta 98.26
PF12706 194 Lactamase_B_2: Beta-lactamase superfamily domain; 98.26
TIGR02650 277 RNase_Z_T_toga ribonuclease Z, Thermotoga type. Me 98.23
PRK02113 252 putative hydrolase; Provisional 98.16
smart00849183 Lactamase_B Metallo-beta-lactamase superfamily. Ap 98.14
TIGR00649 422 MG423 conserved hypothetical protein. Contains an 98.13
PRK02126 334 ribonuclease Z; Provisional 98.11
PRK05184 302 pyrroloquinoline quinone biosynthesis protein PqqB 98.08
PRK11244 250 phnP carbon-phosphorus lyase complex accessory pro 98.06
TIGR03307 238 PhnP phosphonate metabolism protein PhnP. This fam 98.06
COG1235 269 PhnP Metal-dependent hydrolases of the beta-lactam 97.99
TIGR02108 302 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B. 97.98
TIGR03675 630 arCOG00543 arCOG00543 universal archaeal KH-domain 97.95
COG1236 427 YSH1 Predicted exonuclease of the beta-lactamase f 97.89
COG1782 637 Predicted metal-dependent RNase, consists of a met 97.85
COG0491 252 GloB Zn-dependent hydrolases, including glyoxylase 97.83
KOG1136 501 consensus Predicted cleavage and polyadenylation s 97.75
PRK10241 251 hydroxyacylglutathione hydrolase; Provisional 97.75
PRK00685 228 metal-dependent hydrolase; Provisional 97.75
TIGR03413 248 GSH_gloB hydroxyacylglutathione hydrolase. Members 97.71
PRK11921 394 metallo-beta-lactamase/flavodoxin domain-containin 97.66
PLN02469 258 hydroxyacylglutathione hydrolase 97.63
PRK04286 298 hypothetical protein; Provisional 97.45
PRK05452 479 anaerobic nitric oxide reductase flavorubredoxin; 97.41
PLN02398 329 hydroxyacylglutathione hydrolase 97.22
PLN02962 251 hydroxyacylglutathione hydrolase 97.18
COG5212 356 PDE1 Low-affinity cAMP phosphodiesterase [Signal t 97.16
PRK11539 755 ComEC family competence protein; Provisional 97.13
TIGR00361 662 ComEC_Rec2 DNA internalization-related competence 97.13
COG2333 293 ComEC Predicted hydrolase (metallo-beta-lactamase 97.0
PF02112 335 PDEase_II: cAMP phosphodiesterases class-II; Inter 96.94
PRK11709 355 putative L-ascorbate 6-phosphate lactonase; Provis 96.69
KOG0813 265 consensus Glyoxylase [General function prediction 96.59
PF13483163 Lactamase_B_3: Beta-lactamase superfamily domain; 96.36
COG2220 258 Predicted Zn-dependent hydrolases of the beta-lact 95.47
KOG1137 668 consensus mRNA cleavage and polyadenylation factor 94.75
KOG2121 746 consensus Predicted metal-dependent hydrolase (bet 94.16
COG2015 655 Alkyl sulfatase and related hydrolases [Secondary 92.31
KOG1135 764 consensus mRNA cleavage and polyadenylation factor 87.37
COG0426 388 FpaA Uncharacterized flavoproteins [Energy product 86.31
KOG1361 481 consensus Predicted hydrolase involved in interstr 80.24
>COG1234 ElaC Metal-dependent hydrolases of the beta-lactamase superfamily III [General function prediction only] Back     alignment and domain information
Probab=98.69  E-value=1.9e-08  Score=79.06  Aligned_cols=44  Identities=27%  Similarity=0.306  Sum_probs=36.7

Q ss_pred             CCCCCCCcCEEEeeccCchhhccHHHHHHHhcCCCcCCCcchhH
Q 041025           40 SPSRSISLNFLFTSHAHMDHIFTLLVLHIWRYSKNKFQPLKEKQ   83 (99)
Q Consensus        40 cp~~~~~id~IfITH~H~DHigGLp~l~~~r~~~~~~~Pl~~~~   83 (99)
                      ....+.+|++|||||.|.|||.|||.++..++..++..|+..-+
T Consensus        47 ~~~~~~~i~~IfITH~H~DHi~gL~~ll~~~~~~~~~~~l~iyg   90 (292)
T COG1234          47 AGLPPRKIDAIFITHLHGDHIAGLPGLLVSRSFRGRREPLKIYG   90 (292)
T ss_pred             hcCChhhccEEEeeccccchhcCcHHHHHHhhccCCCCceeEEC
Confidence            44455689999999999999999999999999988777665544



>PRK00055 ribonuclease Z; Reviewed Back     alignment and domain information
>TIGR02649 true_RNase_BN ribonuclease BN Back     alignment and domain information
>TIGR02651 RNase_Z ribonuclease Z Back     alignment and domain information
>COG1237 Metal-dependent hydrolases of the beta-lactamase superfamily II [General function prediction only] Back     alignment and domain information
>PF00753 Lactamase_B: Metallo-beta-lactamase superfamily; InterPro: IPR001279 Apart from the beta-lactamases and metallo-beta-lactamases, a number of other proteins contain this domain [] Back     alignment and domain information
>COG0595 mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair] Back     alignment and domain information
>PF12706 Lactamase_B_2: Beta-lactamase superfamily domain; PDB: 3BV6_F 1WW1_A 2E7Y_A 3RPC_D 3ZWF_A 3JXP_A 1XTO_A 2CBN_A 3G1P_B 3P2U_A Back     alignment and domain information
>TIGR02650 RNase_Z_T_toga ribonuclease Z, Thermotoga type Back     alignment and domain information
>PRK02113 putative hydrolase; Provisional Back     alignment and domain information
>smart00849 Lactamase_B Metallo-beta-lactamase superfamily Back     alignment and domain information
>TIGR00649 MG423 conserved hypothetical protein Back     alignment and domain information
>PRK02126 ribonuclease Z; Provisional Back     alignment and domain information
>PRK05184 pyrroloquinoline quinone biosynthesis protein PqqB; Provisional Back     alignment and domain information
>PRK11244 phnP carbon-phosphorus lyase complex accessory protein; Provisional Back     alignment and domain information
>TIGR03307 PhnP phosphonate metabolism protein PhnP Back     alignment and domain information
>COG1235 PhnP Metal-dependent hydrolases of the beta-lactamase superfamily I [General function prediction only] Back     alignment and domain information
>TIGR02108 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B Back     alignment and domain information
>TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>COG1236 YSH1 Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information
>COG0491 GloB Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>KOG1136 consensus Predicted cleavage and polyadenylation specificity factor (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>PRK10241 hydroxyacylglutathione hydrolase; Provisional Back     alignment and domain information
>PRK00685 metal-dependent hydrolase; Provisional Back     alignment and domain information
>TIGR03413 GSH_gloB hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information
>PLN02469 hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK04286 hypothetical protein; Provisional Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>PLN02398 hydroxyacylglutathione hydrolase Back     alignment and domain information
>PLN02962 hydroxyacylglutathione hydrolase Back     alignment and domain information
>COG5212 PDE1 Low-affinity cAMP phosphodiesterase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11539 ComEC family competence protein; Provisional Back     alignment and domain information
>TIGR00361 ComEC_Rec2 DNA internalization-related competence protein ComEC/Rec2 Back     alignment and domain information
>COG2333 ComEC Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>PF02112 PDEase_II: cAMP phosphodiesterases class-II; InterPro: IPR000396 Cyclic-AMP phosphodiesterase (3 Back     alignment and domain information
>PRK11709 putative L-ascorbate 6-phosphate lactonase; Provisional Back     alignment and domain information
>KOG0813 consensus Glyoxylase [General function prediction only] Back     alignment and domain information
>PF13483 Lactamase_B_3: Beta-lactamase superfamily domain; PDB: 1VJN_B 3KL7_A Back     alignment and domain information
>COG2220 Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only] Back     alignment and domain information
>KOG1137 consensus mRNA cleavage and polyadenylation factor II complex, BRR5 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>KOG2121 consensus Predicted metal-dependent hydrolase (beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>COG2015 Alkyl sulfatase and related hydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1135 consensus mRNA cleavage and polyadenylation factor II complex, subunit CFT2 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>KOG1361 consensus Predicted hydrolase involved in interstrand cross-link repair [Replication, recombination and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query99
2cbn_A 306 Ribonuclease Z; phosphodiesterase beta lactamase t 98.39
1y44_A 320 Ribonuclease Z; zinc-dependent metal hydrolase, hy 98.28
2e7y_A 280 TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, 98.28
3dha_A 254 N-acyl homoserine lactone hydrolase; zinc bimetall 98.25
3zwf_A 368 Zinc phosphodiesterase ELAC protein 1; beta-lactam 98.21
3iek_A 431 Ribonuclease TTHA0252; metallo beta lactamase fold 98.21
3adr_A 261 Putative uncharacterized protein ST1585; quorum se 98.11
1zkp_A 268 Hypothetical protein BA1088; zinc binding protein, 98.08
2r2d_A 276 AGR_PTI_140P, Zn-dependent hydrolases; lactonase, 98.06
3m8t_A 294 'BLR6230 protein; subclass B3 beta-lactamase, zinc 98.06
3md7_A 293 Beta-lactamase-like; ssgcid, hydrolase, structural 98.06
2i7t_A 459 Cleavage and polyadenylation specificity factor 73 98.06
1sml_A 269 Protein (penicillinase); metallo-beta-lactamase, a 98.05
3esh_A 280 Protein similar to metal-dependent hydrolase; stru 98.04
1k07_A 263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA 98.03
3l6n_A219 Metallo-beta-lactamase; zinc, hydolase, antibiotic 98.03
2ycb_A 636 Beta-CAsp RNAse, cleavage and polyadenylation spec 98.02
2zwr_A 207 Metallo-beta-lactamase superfamily protein; hydrol 98.02
2p4z_A 284 Metal-dependent hydrolases of the beta-lactamase s 98.01
3q6v_A 233 Beta-lactamase; metalloenzyme, alpha-beta, hydrola 98.0
3iog_A 227 Beta-lactamase; hydrolase, antibiotic resistance, 98.0
4ax1_B 303 Metallo-beta-lactamase AIM-1; hydrolase, antibioti 98.0
2az4_A 429 Hypothetical protein EF2904; structural genomics, 97.99
3aj3_A 274 MLR6805 protein, 4-pyridoxolactonase; Zn-protein, 97.97
1e5d_A 402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 97.97
1ycg_A 398 Nitric oxide reductase; DIIRON site, oxidoreductas 97.97
4hl2_A 243 Beta-lactamase NDM-1; structural genomics, PSI-bio 97.96
3bk2_A 562 RNAse J, metal dependent hydrolase; endoribonuclea 97.95
3zdk_A 336 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A 97.95
2xr1_A 640 Cleavage and polyadenylation specificity factor 1 97.94
3af5_A 651 Putative uncharacterized protein PH1404; archaeal 97.93
2xf4_A 210 Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A 97.93
2ohh_A 404 Type A flavoprotein FPRA; beta-lactamase like doma 97.93
1mqo_A227 Beta-lactamase II; alpha-beta/BETA-alpha fold, hyd 97.92
1m2x_A 223 Class B carbapenemase BLAB-1; alpha-beta/BETA-alph 97.91
2zo4_A 317 Metallo-beta-lactamase family protein; hydrolase; 97.9
4ad9_A 289 Lactb2, beta-lactamase-like protein 2; hydrolase, 97.9
2i7x_A 717 Protein CFT2; polyadenylation, metallo-B-lactamase 97.9
3g1p_A 258 Protein PHNP; C-P lyase, phosphodiesterase, phosph 97.89
3hnn_A 262 Putative diflavin flavoprotein A 5; PSI-2, protein 97.88
2bib_A 547 CBPE, teichoic acid phosphorylcholine esterase/ ch 97.87
2vw8_A 303 PA1000, PQSE; quinolone signal response protein, s 97.86
3zq4_A 555 Ribonuclease J 1, RNAse J1; hydrolase, RNA maturat 97.86
1a7t_A 232 Metallo-beta-lactamase; hydrolase (beta-lactamase) 97.85
1ztc_A221 Hypothetical protein TM0894; structural genomics, 97.85
2q9u_A 414 A-type flavoprotein; flavodoxin like, beta lactama 97.81
1xm8_A 254 Glyoxalase II; structural genomics, protein struct 97.79
2qed_A 258 Hydroxyacylglutathione hydrolase; metallo-B- super 97.78
1jjt_A 228 IMP-1 metallo beta-lactamase; metallo-beta-lactama 97.77
1qh5_A 260 Glyoxalase II, protein (hydroxyacylglutathione hyd 97.77
3jxp_A 321 Coenzyme PQQ synthesis protein B; alpha-beta prote 97.76
1p9e_A 331 Methyl parathion hydrolase; Zn containing; 2.40A { 97.74
2y8b_A 265 Metallo-B-lactamase; hydrolase, cephalosporins, an 97.73
2gcu_A 245 Putative hydroxyacylglutathione hydrolase 3; ethyl 97.72
4b87_A 367 DNA cross-LINK repair 1A protein; dclre1A, DCLRE, 97.72
4efz_A 298 Metallo-beta-lactamase family protein; structural 97.69
2p18_A 311 Glyoxalase II; metalloprotein, beta sandwich, alph 97.65
4eyb_A 270 Beta-lactamase NDM-1; metallo beta lactamase, anti 97.62
3rpc_A 264 Possible metal-dependent hydrolase; structural gen 97.61
2fhx_A 246 SPM-1; metallo-beta-lactamase, dinuclear zinc, ant 97.55
2wyl_A 360 L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 97.5
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 97.49
3bv6_A 379 Metal-dependent hydrolase; metallo protein, beta-l 97.47
1vjn_A 220 Zn-dependent hydrolase of metallo-beta-lactamase s 97.43
4dik_A 410 Flavoprotein; TM0755, electron transport, DI-iron 97.36
3r2u_A 466 Metallo-beta-lactamase family protein; structural 97.33
3kl7_A 235 Putative metal-dependent hydrolase; structural gen 97.32
3h3e_A 267 Uncharacterized protein TM1679; structural genomic 97.14
2cfu_A 658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1 96.99
2yhe_A 668 SEC-alkyl sulfatase; hydrolase, inversion, metallo 95.83
2p97_A201 Hypothetical protein; putative metal-dependent hyd 96.31
>2cbn_A Ribonuclease Z; phosphodiesterase beta lactamase tRNAse Z, hydrolase, metal- binding, endonuclease, tRNA processing, zinc; 2.9A {Escherichia coli} SCOP: d.157.1.7 Back     alignment and structure
Probab=98.39  E-value=1.3e-07  Score=69.25  Aligned_cols=29  Identities=38%  Similarity=0.417  Sum_probs=24.9

Q ss_pred             CCCCcCEEEeeccCchhhccHHHHHHHhc
Q 041025           43 RSISLNFLFTSHAHMDHIFTLLVLHIWRY   71 (99)
Q Consensus        43 ~~~~id~IfITH~H~DHigGLp~l~~~r~   71 (99)
                      ...+||+|||||.|.||++|++.++..+.
T Consensus        54 ~~~~i~~i~iTH~H~DH~~gl~~l~~~~~   82 (306)
T 2cbn_A           54 NPGKLDKIFISHLHGDHLFGLPGLLCSRS   82 (306)
T ss_dssp             CTTTEEEEECSCCCHHHHTTHHHHHHHHH
T ss_pred             CHHHcCEEEEecCCchhhCChHHHHHHHH
Confidence            34578999999999999999999987543



>1y44_A Ribonuclease Z; zinc-dependent metal hydrolase, hydrolase; HET: MES; 2.10A {Bacillus subtilis} SCOP: d.157.1.7 PDB: 2fk6_A* Back     alignment and structure
>2e7y_A TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.97A {Thermotoga maritima} SCOP: d.157.1.7 PDB: 1ww1_A Back     alignment and structure
>3dha_A N-acyl homoserine lactone hydrolase; zinc bimetallohydrolase, quorum quenching; HET: C6L GOL; 0.95A {Bacillus thuringiensis serovar kurstakorganism_taxid} PDB: 3dhb_A* 3dhc_A* 2a7m_A* 2br6_A 2btn_A Back     alignment and structure
>3zwf_A Zinc phosphodiesterase ELAC protein 1; beta-lactamase, hydrolase, metal-binding, tRNA processing, zinc-binding, catabolism; 1.70A {Homo sapiens} Back     alignment and structure
>3iek_A Ribonuclease TTHA0252; metallo beta lactamase fold, endonuclease, hydrolase, metal- nuclease, RNA-binding, rRNA processing; HET: FLC; 2.05A {Thermus thermophilus} SCOP: d.157.1.10 PDB: 2dkf_A* 3iel_A* 3iem_A* 2zdf_A* 3idz_A* 2zdd_A* 3ie0_A* 2zde_A* 3ie1_A* 2zdw_A* 3a4y_A* 2yvd_A* 3ie2_A* Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9 Back     alignment and structure
>2r2d_A AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acyl hompserine lactone, DI-nuclear zinc center quenching, AIIB, phosphate; HET: PO4; 1.75A {Agrobacterium tumefaciens} Back     alignment and structure
>3m8t_A 'BLR6230 protein; subclass B3 beta-lactamase, zinc enzyme, sulfonamide complex hydrolase-hydrolase inhibitor complex; HET: 4NZ; 1.33A {Bradyrhizobium japonicum} PDB: 3lvz_A* 2gmn_A Back     alignment and structure
>3md7_A Beta-lactamase-like; ssgcid, hydrolase, structural genomics, structural genomics center for infectious disease; HET: 5GP TLA; 1.27A {Brucella melitensis biovar abortus} PDB: 3qh8_A* 3py6_A* 3py5_A* Back     alignment and structure
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Back     alignment and structure
>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Back     alignment and structure
>3esh_A Protein similar to metal-dependent hydrolase; structural genomics, PSI-2, protein structure initiative; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER AS UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Back     alignment and structure
>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} SCOP: d.157.1.0 Back     alignment and structure
>2ycb_A Beta-CAsp RNAse, cleavage and polyadenylation specificity factor; hydrolase, KH, metallo-beta-lactamase; 3.10A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} PDB: 2zzi_A Back     alignment and structure
>2p4z_A Metal-dependent hydrolases of the beta-lactamase superfamily II; metal-dependent hydrolases of the beta-lactamase superfamily hydrolase; 2.10A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3q6v_A Beta-lactamase; metalloenzyme, alpha-beta, hydrolase; 1.37A {Serratia fonticola} PDB: 3sd9_A Back     alignment and structure
>3iog_A Beta-lactamase; hydrolase, antibiotic resistance, metal-binding; HET: SDF; 1.41A {Aeromonas hydrophila} SCOP: d.157.1.1 PDB: 1x8i_A 3fai_A* 3iof_A* 1x8h_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A 3t9m_A 3sw3_A Back     alignment and structure
>4ax1_B Metallo-beta-lactamase AIM-1; hydrolase, antibiotic resistance, acquired B3, drug binding; 1.40A {Pseudomonas aeruginosa} PDB: 4awy_B 4awz_A 4ax0_B Back     alignment and structure
>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein STR initiative, midwest center for structural genomics, MCSG, U function; 2.00A {Enterococcus faecalis} SCOP: d.157.1.10 Back     alignment and structure
>3aj3_A MLR6805 protein, 4-pyridoxolactonase; Zn-protein, metallo-beta-lactamase, hydrolase; 1.58A {Mesorhizobium loti} PDB: 3aj0_A Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Back     alignment and structure
>4hl2_A Beta-lactamase NDM-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ZZ7; 1.05A {Klebsiella pneumoniae} PDB: 4hl1_A* 4h0d_A* 4gyu_A* 4gyq_A 3q6x_A* 3spu_A 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus} PDB: 3bk1_A* 3t3o_A* 3t3n_A* Back     alignment and structure
>3zdk_A 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A {Homo sapiens} Back     alignment and structure
>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Back     alignment and structure
>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Back     alignment and structure
>1mqo_A Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolase; HET: CIT; 1.35A {Bacillus cereus} SCOP: d.157.1.1 PDB: 1bc2_A 1bvt_A* 3i0v_A 3i11_A 3i13_A 3i14_A 3i15_A 2uyx_A 2bc2_A 3bc2_A 2bfl_A 2bfk_A 2bfz_B 2bg2_A 2bg7_A 2bg8_A 1dxk_A 3kns_A 3knr_A 2bfz_A ... Back     alignment and structure
>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1 Back     alignment and structure
>2zo4_A Metallo-beta-lactamase family protein; hydrolase; 2.10A {Thermus thermophilus} Back     alignment and structure
>4ad9_A Lactb2, beta-lactamase-like protein 2; hydrolase, metallo-beta lactamase, mitochondria; 2.60A {Homo sapiens} Back     alignment and structure
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Back     alignment and structure
>3g1p_A Protein PHNP; C-P lyase, phosphodiesterase, phosphonate utilization, alkylphosphonate uptake; 1.40A {Escherichia coli} PDB: 3p2u_A Back     alignment and structure
>2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline protein; choline-binding protein, PCE, phosphorylcholine estera hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A* Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Back     alignment and structure
>3zq4_A Ribonuclease J 1, RNAse J1; hydrolase, RNA maturation; 3.00A {Bacillus subtilis} Back     alignment and structure
>1a7t_A Metallo-beta-lactamase; hydrolase (beta-lactamase), zinc; HET: MES; 1.85A {Bacteroides fragilis} SCOP: d.157.1.1 PDB: 1a8t_A* 2bmi_A 1kr3_A 1znb_A 2znb_A 3znb_A 4znb_A 1hlk_A* Back     alignment and structure
>1ztc_A Hypothetical protein TM0894; structural genomics, joint center for structural genomics, J protein structure initiative, PSI, hydrolase; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11 Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Back     alignment and structure
>1xm8_A Glyoxalase II; structural genomics, protein structure initiative, CESG, AT2G31350, metallo-hydrolase, zinc/iron binuclear center; 1.74A {Arabidopsis thaliana} SCOP: d.157.1.2 PDB: 2q42_A Back     alignment and structure
>2qed_A Hydroxyacylglutathione hydrolase; metallo-B- superfamily, salmonella typhimurium LT2; 1.45A {Salmonella typhimurium} SCOP: d.157.1.2 Back     alignment and structure
>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, I metallo-beta-lactamase, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Back     alignment and structure
>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GSH GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A* Back     alignment and structure
>3jxp_A Coenzyme PQQ synthesis protein B; alpha-beta protein, PQQ biosynthesis, transport, biosyntheti; 2.20A {Pseudomonas putida} SCOP: d.157.1.6 PDB: 1xto_A Back     alignment and structure
>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5 Back     alignment and structure
>2y8b_A Metallo-B-lactamase; hydrolase, cephalosporins, antibiotic recognition; 1.70A {Pseudomonas aeruginosa} PDB: 2y8a_A 2y87_A 2yz3_A* 2whg_A* 2wrs_A* 1ko3_A 1ko2_A Back     alignment and structure
>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana} Back     alignment and structure
>4b87_A DNA cross-LINK repair 1A protein; dclre1A, DCLRE, interstrand crosslink repair, hydrolase, NIT mustard, cancer, chemotherapy, PSO2 homolog,; HET: DNA; 2.16A {Homo sapiens} Back     alignment and structure
>4efz_A Metallo-beta-lactamase family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrola; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A* Back     alignment and structure
>4eyb_A Beta-lactamase NDM-1; metallo beta lactamase, antibiotic, hydrolase-antibiotic COM; HET: 0WO; 1.16A {Klebsiella pneumoniae} PDB: 4ey2_A* 4eyf_A* 4exy_A 4exs_B 4eyl_A* 3spu_A 3q6x_A* 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>3rpc_A Possible metal-dependent hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.49A {Veillonella parvula} Back     alignment and structure
>2fhx_A SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiotic resistanc hydrolase, metal binding protein; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2wyl_A L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59A {Escherichia coli} PDB: 2wym_A* Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3bv6_A Metal-dependent hydrolase; metallo protein, beta-lactamase like fold, MCSG, structural PSI-2, protein structure initiative; 1.80A {Vibrio cholerae o1 biovar eltor} Back     alignment and structure
>1vjn_A Zn-dependent hydrolase of metallo-beta-lactamase superfamily TM0207; metallo-hydrolase/oxidoreductase fold, structural genomics; 2.00A {Thermotoga maritima} SCOP: d.157.1.4 Back     alignment and structure
>4dik_A Flavoprotein; TM0755, electron transport, DI-iron protein; 1.75A {Thermotoga maritima} PDB: 4dil_A 1vme_A* Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>3kl7_A Putative metal-dependent hydrolase; structural genomics, JOI for structural genomics, JCSG; 2.30A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3h3e_A Uncharacterized protein TM1679; structural genomics, surface entropy reduction, ISFI, beta- lactamase superfamily, PSI-2; 2.75A {Thermotoga maritima} Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Back     alignment and structure
>2yhe_A SEC-alkyl sulfatase; hydrolase, inversion, metallo-beta-lactamase fold; 2.70A {Pseudomonas SP} Back     alignment and structure
>2p97_A Hypothetical protein; putative metal-dependent hydrolase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.157.1.12 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query99
d2e7ya1 280 Ribonuclease Z (RNase Z) {Thermotoga maritima [Tax 98.93
d2cbna1 305 Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 98.86
d1y44a1 307 Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId 98.79
d2i7ta1 451 Cleavage and polyadenylation specificity factor su 98.72
d2dkfa1 431 Putative RNA-degradation protein TTHA0252 {Thermus 98.51
d1xtoa_ 304 Coenzyme PQQ synthesis protein B, PqqB {Pseudomona 98.44
d1wraa1 305 Teichoic acid phosphorylcholine esterase Pce (LytD 98.38
d1zkpa1 244 Hypothetical protein BA1088 (BAS1016) {Bacillus an 98.37
d2i7xa1 514 Cleavage factor two protein 2, CFT2 {Baker's yeast 98.32
d2az4a1 183 Hypothetical protein EF2904 {Enterococcus faecalis 98.28
d1p9ea_ 294 Methyl parathion hydrolase {Pseudomonas sp. WBC-3 98.21
d1ztca1207 Hypothetical protein TM0894 {Thermotoga maritima [ 98.16
d2aioa1 266 Zn metallo-beta-lactamase {Xanthomonas maltophilia 97.97
d1vmea2 250 ROO-like flavoprotein TM0755, N-terminal domain {T 97.92
d2q0ia1 298 Quinolone signal response protein PqsE {Pseudomona 97.91
d2gmna1 264 Zn metallo-beta-lactamase {Bradyrhizobium japonicu 97.86
d1e5da2 249 Rubredoxin oxygen:oxidoreductase (ROO), N-terminal 97.82
d1ycga2 249 Nitric oxide reductase N-terminal domain {Moorella 97.82
d1x8ha_ 228 Zn metallo-beta-lactamase {Aeromonas hydrophila, C 97.77
d1k07a_ 262 Zn metallo-beta-lactamase {Fluoribacter gormanii, 97.74
d1m2xa_ 219 Zn metallo-beta-lactamase {Chryseobacterium mening 97.7
d1ko3a_ 230 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 97.65
d1znba_ 230 Zn metallo-beta-lactamase {Bacteroides fragilis [T 97.55
d1qh5a_ 260 Glyoxalase II (hydroxyacylglutathione hydrolase) { 97.46
d1mqoa_221 Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 97.44
d2qeda1 251 Glyoxalase II (hydroxyacylglutathione hydrolase) { 97.41
d1jjta_220 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 97.4
d1xm8a_ 254 Glyoxalase II (hydroxyacylglutathione hydrolase) { 97.18
d2cfua2 505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 96.43
d1vjna_ 209 Hypothetical protein TM0207 {Thermotoga maritima [ 96.36
d2p97a1200 Hypothetical protein Ava3068 {Anabaena variabilis 93.51
>d2e7ya1 d.157.1.7 (A:1-280) Ribonuclease Z (RNase Z) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: RNase Z-like
domain: Ribonuclease Z (RNase Z)
species: Thermotoga maritima [TaxId: 2336]
Probab=98.93  E-value=3.7e-11  Score=83.75  Aligned_cols=26  Identities=31%  Similarity=0.547  Sum_probs=23.1

Q ss_pred             CCcCEEEeeccCchhhccHHHHHHHh
Q 041025           45 ISLNFLFTSHAHMDHIFTLLVLHIWR   70 (99)
Q Consensus        45 ~~id~IfITH~H~DHigGLp~l~~~r   70 (99)
                      .+||+|||||+|+||++|||.++..+
T Consensus        39 ~~i~~I~ITH~H~DHi~GLp~l~~~~   64 (280)
T d2e7ya1          39 YAFKYVFLTHGHVDHIAGLWGVVNIR   64 (280)
T ss_dssp             GGCCEEECSCCCHHHHTTHHHHHHHH
T ss_pred             ccCCEEEEecCchhhhcCcHHHHHhh
Confidence            46899999999999999999998653



>d2cbna1 d.157.1.7 (A:1-305) Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y44a1 d.157.1.7 (A:1-307) Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dkfa1 d.157.1.10 (A:1-431) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xtoa_ d.157.1.6 (A:) Coenzyme PQQ synthesis protein B, PqqB {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1wraa1 d.157.1.8 (A:30-334) Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1zkpa1 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (BAS1016) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d2i7xa1 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two protein 2, CFT2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2az4a1 d.157.1.10 (A:56-238) Hypothetical protein EF2904 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1p9ea_ d.157.1.5 (A:) Methyl parathion hydrolase {Pseudomonas sp. WBC-3 [TaxId: 165468]} Back     information, alignment and structure
>d1ztca1 d.157.1.11 (A:1-207) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2aioa1 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]} Back     information, alignment and structure
>d1vmea2 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2q0ia1 d.157.1.14 (A:1-298) Quinolone signal response protein PqsE {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1e5da2 d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1ycga2 d.157.1.3 (A:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1x8ha_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]} Back     information, alignment and structure
>d1k07a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId: 464]} Back     information, alignment and structure
>d1m2xa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Chryseobacterium meningosepticum, carbapenemase BLAB-1 [TaxId: 238]} Back     information, alignment and structure
>d1ko3a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, VIM-2 [TaxId: 287]} Back     information, alignment and structure
>d1znba_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]} Back     information, alignment and structure
>d1qh5a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqoa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2qeda1 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglutathione hydrolase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jjta_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]} Back     information, alignment and structure
>d1xm8a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vjna_ d.157.1.4 (A:) Hypothetical protein TM0207 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p97a1 d.157.1.12 (A:1-200) Hypothetical protein Ava3068 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure