Citrus Sinensis ID: 041054


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
GYARFVNIRDGRGATPLHLAARQRRPECVHILLDSGALVCASTGGYGCPGSTPLHLAARGGSIDCIRELLAWGADRLHRDVSGRIPYAVALKHKHGACAALLNPASAEPLVWPSPLKFISELNQEAKALLENALMEANKEREKNILKGTAYSLPSPSHSDVGADDNISEASDTELCCICFEQVCTIEVQDCGHQMCAQCTLALCCHNKPNPTTACLTPPVCPFCRSTIAHLVVVKIENQEDADRDIGDISSPKLRKARKSRNFSEGSSSFKGLSTSFSKMGGRGSGRIAAENEWIDKR
ccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHccccccccccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHcccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHcccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccc
cccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHccHHHccccccccccccccccccccccccccccccEEEEccccEEEEcccccHHHHHHHHHHHccccccccccccccccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccHHHHHccccccccEEccccccccc
GYARFVnirdgrgatplhlaarqrRPECVHILLDSGAlvcastggygcpgstplhlaarggSIDCIRELLAWGAdrlhrdvsgrIPYAVALKHKHGACaallnpasaeplvwpsplKFISELNQEAKALLENALMEANKEREKNILkgtayslpspshsdvgaddniseasdtelccICFEQVCtievqdcghqmCAQCTlalcchnkpnpttacltppvcpfcrstIAHLVVVKIenqedadrdigdisspklrkarksrnfsegsssfkgLSTSFSkmggrgsgriaaenewidkr
gyarfvnirdgrgatplhlaarQRRPECVHILLDSGALVCASTGGYGCPGSTPLHLAARGGSIDCIRELLAWGADRLHRDVSGRIPYAVALKHKHGACAALLNPASAEPLVWPSPLKFISELNQEAKALLENALMEANKEREKNILKGTAYSLPSPSHSDVGADDNISEASDTELCCICFEQVCTIEVQDCGHQMCAQCTLALCCHNKPNPTTACLTPPVCPFCRSTIAHLVVVKienqedadrdigdisspklrkarksrnfsegsssfkglstsfskmggrgsgriaaenewidkr
GYARFVNIRDGRGATPLHLAARQRRPECVHILLDSGALVCASTGGYGCPGSTPLHLAARGGSIDCIRELLAWGADRLHRDVSGRIPYAVALKHKHGACAALLNPASAEPLVWPSPLKFISELNQEAKALLENALMEANKEREKNILKGTAYSLPSPSHSDVGADDNISEASDTELCCICFEQVCTIEVQDCGHQMCAQCTLALCCHNKPNPTTACLTPPVCPFCRSTIAHLVVVKIENQEDADRDIGDISSPKLRKARKSRNfsegsssfkglstsfskMGGRGSGRIAAENEWIDKR
****FVNIRDGRGATPLHLAARQRRPECVHILLDSGALVCASTGGYGCPGSTPLHLAARGGSIDCIRELLAWGADRLHRDVSGRIPYAVALKHKHGACAALLNPASAEPLVWPSPLKFISELNQ****L*******************************************TELCCICFEQVCTIEVQDCGHQMCAQCTLALCCHNKPNPTTACLTPPVCPFCRSTIAHLVVVKIE*************************************************************
GYARFVNIRDGRGATPLHLAARQRRPECVHILLDSGALVCASTGGYGCPGSTPLHLAARGGSIDCIRELLAWGADRLHRDVSGRIPYAVALKHKHGACAALLNPASAEPLVWPSPLKFISELNQEAKALLENALMEANKEREKNILKGTAYSLPSPSHSDVGADDNISEASDTELCCICFEQVCTIEVQDCGHQMCAQCTLALCC*************PVCPFCRSTIAHLVV*****************************************************************
GYARFVNIRDGRGATPLHLAARQRRPECVHILLDSGALVCASTGGYGCPGSTPLHLAARGGSIDCIRELLAWGADRLHRDVSGRIPYAVALKHKHGACAALLNPASAEPLVWPSPLKFISELNQEAKALLENALMEANKEREKNILKGTAYSLPSPSHSDVGADDNISEASDTELCCICFEQVCTIEVQDCGHQMCAQCTLALCCHNKPNPTTACLTPPVCPFCRSTIAHLVVVKIENQEDADRDIGDISSPK*****************KGLSTSFSKMGGRGSGRIAAENEWIDKR
*****VN***GRGATPLHLAARQRRPECVHILLDSGALVCASTGGYGCPGSTPLHLAARGGSIDCIRELLAWGADRLHRDVSGRIPYAVALKHKHGACAALLNPASAEPLVWPSPLKFISELNQEAKALLENALMEANKEREKNILKGTAYS*******************DTELCCICFEQVCTIEVQDCGHQMCAQCTLALCCHNKPNPTTACLTPPVCPFCRSTIAHLVVVKIE*************************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GYARFVNIRDGRGATPLHLAARQRRPECVHILLDSGALVCASTGGYGCPGSTPLHLAARGGSIDCIRELLAWGADRLHRDVSGRIPYAVALKHKHGACAALLNPASAEPLVWPSPxxxxxxxxxxxxxxxxxxxxxxxxxxxxNILKGTAYSLPSPSHSDVGADDNISEASDTELCCICFEQVCTIEVQDCGHQMCAQCTLALCCHNKPNPTTACLTPPVCPFCRSTIAHLVVVKIENQEDADRDIGDISSPKLRKARKSRNFSEGSSSFKGLSTSFSKMGGRGSGRIAAENEWIDKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query298 2.2.26 [Sep-21-2011]
Q94B55456 Putative E3 ubiquitin-pro no no 0.989 0.646 0.764 1e-135
Q65XV2450 E3 ubiquitin-protein liga yes no 0.979 0.648 0.680 1e-108
Q94CT7446 Probable E3 ubiquitin-pro no no 0.922 0.616 0.572 9e-87
Q337A0520 Probable E3 ubiquitin-pro no no 0.637 0.365 0.309 8e-18
Q7EZ44495 Probable E3 ubiquitin-pro no no 0.657 0.395 0.295 3e-17
Q4FE45513 E3 ubiquitin-protein liga no no 0.651 0.378 0.313 1e-16
Q4JHE0420 Probable E3 ubiquitin-pro no no 0.674 0.478 0.306 1e-16
Q6KAE5496 Probable E3 ubiquitin-pro no no 0.657 0.395 0.306 1e-13
Q54BA2 806 Ankyrin repeat, bromo and yes no 0.312 0.115 0.443 1e-10
Q6NLQ8508 E3 ubiquitin-protein liga no no 0.617 0.362 0.284 2e-09
>sp|Q94B55|XB31_ARATH Putative E3 ubiquitin-protein ligase XBAT31 OS=Arabidopsis thaliana GN=XBAT31 PE=2 SV=1 Back     alignment and function desciption
 Score =  482 bits (1240), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 237/310 (76%), Positives = 260/310 (83%), Gaps = 15/310 (4%)

Query: 1   GYARFVNIRDGRGATPLHLAARQRRPECVHILLDSGALVCASTGGYGCPGSTPLHLAARG 60
           GYARFVNIRD +GATPLHLAARQRRPECV++LLDSG+LVCAST  YG PGSTPLHLAAR 
Sbjct: 146 GYARFVNIRDDKGATPLHLAARQRRPECVNVLLDSGSLVCASTSVYGSPGSTPLHLAARS 205

Query: 61  GSIDCIRELLAWGADRLHRDVSGRIPYAVALKHKHGACAALLNPASAEPLVWPSPLKFIS 120
           GSIDC+R+LLAWGADRL RD SGRIPY VA+KHKHGAC ALLNP+SAEPLVWPSPLKFIS
Sbjct: 206 GSIDCVRKLLAWGADRLQRDASGRIPYVVAMKHKHGACGALLNPSSAEPLVWPSPLKFIS 265

Query: 121 ELNQEAKALLENALMEANKEREKNILKGTAYSLPSPSHSDVGADDNISEASDTELCCICF 180
           ELN EAK LLE ALMEAN+EREK ILKGTAYSLPSPS SD   DDN+SE SDTELCCICF
Sbjct: 266 ELNDEAKLLLEQALMEANREREKTILKGTAYSLPSPSFSDT--DDNMSEVSDTELCCICF 323

Query: 181 EQVCTIEVQDCGHQMCAQCTLALCCHNKPNPTTACLTPPVCPFCRSTIAHLVVVK----- 235
           EQVCTIEV+DCGHQMCAQCTLALCCHNKPNPTT+ +TPPVCPFCRSTIA LVV +     
Sbjct: 324 EQVCTIEVKDCGHQMCAQCTLALCCHNKPNPTTSTVTPPVCPFCRSTIACLVVAQNNNNN 383

Query: 236 ------IENQEDADRDIGDISSPKLRKARKSRNFSEGSSSFKGLST--SFSKMGGRGSGR 287
                 +++    DR+ GD+SS K RK R+S N  E SSSF GLST  SF ++ GRGSGR
Sbjct: 384 NEKSKSLDDVVVVDREAGDVSSSKFRKHRRSINLGEESSSFMGLSTIGSFGRITGRGSGR 443

Query: 288 IAAENEWIDK 297
           IAAENE +DK
Sbjct: 444 IAAENELMDK 453




No E3 ubiquitin-protein ligase activity observed when associated with the E2 enzyme UBC8 in vitro.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q65XV2|XB3_ORYSJ E3 ubiquitin-protein ligase XB3 OS=Oryza sativa subsp. japonica GN=XB3 PE=1 SV=1 Back     alignment and function description
>sp|Q94CT7|XB31_ORYSJ Probable E3 ubiquitin-protein ligase XBOS31 OS=Oryza sativa subsp. japonica GN=XBOS31 PE=2 SV=1 Back     alignment and function description
>sp|Q337A0|XB33_ORYSJ Probable E3 ubiquitin-protein ligase XBOS33 OS=Oryza sativa subsp. japonica GN=XBOS33 PE=2 SV=1 Back     alignment and function description
>sp|Q7EZ44|XB35_ORYSJ Probable E3 ubiquitin-protein ligase XBOS35 OS=Oryza sativa subsp. japonica GN=XBOS35 PE=2 SV=1 Back     alignment and function description
>sp|Q4FE45|XB33_ARATH E3 ubiquitin-protein ligase XBAT33 OS=Arabidopsis thaliana GN=XBAT33 PE=2 SV=1 Back     alignment and function description
>sp|Q4JHE0|XB36_ORYSJ Probable E3 ubiquitin-protein ligase XBOS36 OS=Oryza sativa subsp. japonica GN=XBOS36 PE=2 SV=1 Back     alignment and function description
>sp|Q6KAE5|XB32_ORYSJ Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 Back     alignment and function description
>sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=4 SV=1 Back     alignment and function description
>sp|Q6NLQ8|XB32_ARATH E3 ubiquitin-protein ligase XBAT32 OS=Arabidopsis thaliana GN=XBAT32 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query298
224059502 442 predicted protein [Populus trichocarpa] 0.976 0.658 0.872 1e-154
225434974 445 PREDICTED: putative E3 ubiquitin-protein 0.996 0.667 0.876 1e-154
224106497 447 predicted protein [Populus trichocarpa] 0.996 0.664 0.838 1e-149
225434976 438 PREDICTED: putative E3 ubiquitin-protein 0.973 0.662 0.856 1e-148
365222866 446 Hop-interacting protein THI012 [Solanum 0.986 0.659 0.802 1e-139
356558143 444 PREDICTED: putative E3 ubiquitin-protein 0.989 0.664 0.807 1e-138
356550271 444 PREDICTED: putative E3 ubiquitin-protein 0.989 0.664 0.811 1e-137
62869545 445 ring zinc finger protein [Artemisia dese 0.983 0.658 0.777 1e-134
356541240 447 PREDICTED: putative E3 ubiquitin-protein 0.996 0.664 0.803 1e-134
186503895 442 putative E3 ubiquitin-protein ligase XBA 0.989 0.667 0.764 1e-134
>gi|224059502|ref|XP_002299878.1| predicted protein [Populus trichocarpa] gi|222847136|gb|EEE84683.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  551 bits (1419), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 259/297 (87%), Positives = 279/297 (93%)

Query: 1   GYARFVNIRDGRGATPLHLAARQRRPECVHILLDSGALVCASTGGYGCPGSTPLHLAARG 60
           GY RFVNIRDGRGATPLHLAARQRRPECVHILLD+GALVC+STGGYG PG+TPLHLAARG
Sbjct: 145 GYTRFVNIRDGRGATPLHLAARQRRPECVHILLDNGALVCSSTGGYGSPGTTPLHLAARG 204

Query: 61  GSIDCIRELLAWGADRLHRDVSGRIPYAVALKHKHGACAALLNPASAEPLVWPSPLKFIS 120
           GS+DCIRELLAWGADR+ RD SGRIPY VALK+++G CAALLNP+SAEPLVWPSPLKFIS
Sbjct: 205 GSLDCIRELLAWGADRMQRDASGRIPYVVALKYRNGTCAALLNPSSAEPLVWPSPLKFIS 264

Query: 121 ELNQEAKALLENALMEANKEREKNILKGTAYSLPSPSHSDVGADDNISEASDTELCCICF 180
           ELNQEAKALLE ALMEAN+EREKNILKGT YSLPSPSHSD G DDNISEASDTELCCICF
Sbjct: 265 ELNQEAKALLECALMEANREREKNILKGTGYSLPSPSHSDDGTDDNISEASDTELCCICF 324

Query: 181 EQVCTIEVQDCGHQMCAQCTLALCCHNKPNPTTACLTPPVCPFCRSTIAHLVVVKIENQE 240
           EQVCTIEV+DCGHQMCAQCTLALCCHNKPNPTTACLTPPVCPFCRSTIA LVV K+++  
Sbjct: 325 EQVCTIEVEDCGHQMCAQCTLALCCHNKPNPTTACLTPPVCPFCRSTIARLVVAKMKDCN 384

Query: 241 DADRDIGDISSPKLRKARKSRNFSEGSSSFKGLSTSFSKMGGRGSGRIAAENEWIDK 297
           DAD+DIGD+ SPKLRK+R+S NFSEGSSSFKGLS +F KMGGRGSGRIAAENEW+DK
Sbjct: 385 DADQDIGDVGSPKLRKSRRSLNFSEGSSSFKGLSATFGKMGGRGSGRIAAENEWVDK 441




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225434974|ref|XP_002283965.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT31 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224106497|ref|XP_002314186.1| predicted protein [Populus trichocarpa] gi|222850594|gb|EEE88141.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225434976|ref|XP_002283974.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT31 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|365222866|gb|AEW69785.1| Hop-interacting protein THI012 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|356558143|ref|XP_003547367.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT31-like [Glycine max] Back     alignment and taxonomy information
>gi|356550271|ref|XP_003543511.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT31-like [Glycine max] Back     alignment and taxonomy information
>gi|62869545|gb|AAY17949.1| ring zinc finger protein [Artemisia desertorum] Back     alignment and taxonomy information
>gi|356541240|ref|XP_003539087.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT31-like [Glycine max] Back     alignment and taxonomy information
>gi|186503895|ref|NP_001118406.1| putative E3 ubiquitin-protein ligase XBAT31 [Arabidopsis thaliana] gi|330253086|gb|AEC08180.1| putative E3 ubiquitin-protein ligase XBAT31 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query298
TAIR|locus:2053205456 XBAT31 "XB3 ortholog 1 in Arab 0.989 0.646 0.732 1.6e-118
UNIPROTKB|Q65XV2450 XB3 "E3 ubiquitin-protein liga 0.976 0.646 0.645 3.1e-99
TAIR|locus:2172600508 XBAT32 "AT5G57740" [Arabidopsi 0.365 0.214 0.364 1.9e-12
TAIR|locus:2142783175 PIA1 "AT5G07840" [Arabidopsis 0.338 0.577 0.403 1.8e-08
TAIR|locus:2182860513 XBAT33 "XB3 ortholog 3 in Arab 0.345 0.200 0.405 2.3e-08
DICTYBASE|DDB_G0293800 806 DDB_G0293800 "BRD family prote 0.332 0.122 0.432 2.7e-08
DICTYBASE|DDB_G0287459 986 secG "Arf guanyl-nucleotide ex 0.325 0.098 0.356 7.7e-08
ZFIN|ZDB-GENE-061013-49356 ankrd10b "ankyrin repeat domai 0.305 0.255 0.45 1.3e-07
UNIPROTKB|Q86SG2305 ANKRD23 "Ankyrin repeat domain 0.308 0.301 0.375 7.6e-07
ZFIN|ZDB-GENE-030131-5411289 asb8 "ankyrin repeat and SOCS 0.285 0.294 0.408 8.6e-07
TAIR|locus:2053205 XBAT31 "XB3 ortholog 1 in Arabidopsis thaliana" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1167 (415.9 bits), Expect = 1.6e-118, P = 1.6e-118
 Identities = 227/310 (73%), Positives = 247/310 (79%)

Query:     1 GYARFVNIRDGRGATPLHLAARQRRPECVHILLDSGALVCASTGGYGCPGSTPLHLAARG 60
             GYARFVNIRD +GATPLHLAARQRRPECV++LLDSG+LVCAST  YG PGSTPLHLAAR 
Sbjct:   146 GYARFVNIRDDKGATPLHLAARQRRPECVNVLLDSGSLVCASTSVYGSPGSTPLHLAARS 205

Query:    61 GSIDCIRELLAWGADRLHRDVSGRIPYAVALKHKHGACAALLNPASAEPLVWPSPLKFIS 120
             GSIDC+R+LLAWGADRL RD SGRIPY VA+KHKHGAC ALLNP+SAEPLVWPSPLKFIS
Sbjct:   206 GSIDCVRKLLAWGADRLQRDASGRIPYVVAMKHKHGACGALLNPSSAEPLVWPSPLKFIS 265

Query:   121 ELNQEAKALLENALMEANKEREKNILKGTAYSLPSPSHSDVGADDNISEASDTELCCICF 180
             ELN EAK LLE ALMEAN+EREK ILKGTAYSLPSPS SD   DDN+SE SDTELCCICF
Sbjct:   266 ELNDEAKLLLEQALMEANREREKTILKGTAYSLPSPSFSDT--DDNMSEVSDTELCCICF 323

Query:   181 EQVCTIEVQDCGHQMCAQCTLALCCHNKPNPTTACLTPPVCPFCRSTIAHLVVVKIENQE 240
             EQVCTIEV+DCGHQMCAQCTLALCCHNKPNPTT+ +TPPVCPFCRSTIA LVV +  N  
Sbjct:   324 EQVCTIEVKDCGHQMCAQCTLALCCHNKPNPTTSTVTPPVCPFCRSTIACLVVAQNNNNN 383

Query:   241 D-----------ADRDIGDISSPKLRKARKSRNXXXXXXXXXXXXXXXXX--MGGRGSGR 287
             +            DR+ GD+SS K RK R+S N                   + GRGSGR
Sbjct:   384 NEKSKSLDDVVVVDREAGDVSSSKFRKHRRSINLGEESSSFMGLSTIGSFGRITGRGSGR 443

Query:   288 IAAENEWIDK 297
             IAAENE +DK
Sbjct:   444 IAAENELMDK 453




GO:0005737 "cytoplasm" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0051049 "regulation of transport" evidence=RCA
UNIPROTKB|Q65XV2 XB3 "E3 ubiquitin-protein ligase XB3" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2172600 XBAT32 "AT5G57740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142783 PIA1 "AT5G07840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182860 XBAT33 "XB3 ortholog 3 in Arabidopsis thaliana" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0293800 DDB_G0293800 "BRD family protein kinase DDB_G0293800" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0287459 secG "Arf guanyl-nucleotide exchange factor" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061013-49 ankrd10b "ankyrin repeat domain 10b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q86SG2 ANKRD23 "Ankyrin repeat domain-containing protein 23" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5411 asb8 "ankyrin repeat and SOCS box-containing 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q65XV2XB3_ORYSJ6, ., 3, ., 2, ., -0.68090.97980.6488yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pg.C_LG_I1758
SubName- Full=Putative uncharacterized protein; (442 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query298
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-20
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-18
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-14
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-14
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-13
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-10
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-08
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 4e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-06
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 3e-06
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 6e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 7e-06
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-05
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 2e-05
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-05
COG5236 493 COG5236, COG5236, Uncharacterized conserved protei 5e-05
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-04
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 4e-04
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-04
smart0024830 smart00248, ANK, ankyrin repeats 5e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 7e-04
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 7e-04
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 8e-04
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.001
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
smart0024830 smart00248, ANK, ankyrin repeats 0.002
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.002
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.004
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 85.1 bits (211), Expect = 1e-20
 Identities = 45/97 (46%), Positives = 56/97 (57%), Gaps = 4/97 (4%)

Query: 6   VNIRDGRGATPLHLAARQRRPECVHILLDSGALVCASTGGYGCPGSTPLHLAARGGSIDC 65
           VN +D  G TPLHLAA+    E V +LL+ GA V A        G+TPLHLAAR G++D 
Sbjct: 33  VNAKDNDGRTPLHLAAKNGHLEIVKLLLEKGADVNARD----KDGNTPLHLAARNGNLDV 88

Query: 66  IRELLAWGADRLHRDVSGRIPYAVALKHKHGACAALL 102
           ++ LL  GAD   RD  GR P  +A K+ H     LL
Sbjct: 89  VKLLLKHGADVNARDKDGRTPLHLAAKNGHLEVVKLL 125


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|227561 COG5236, COG5236, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 298
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.94
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.94
PHA02791284 ankyrin-like protein; Provisional 99.91
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.91
PHA02791284 ankyrin-like protein; Provisional 99.89
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.89
PHA02874434 ankyrin repeat protein; Provisional 99.89
PHA02743166 Viral ankyrin protein; Provisional 99.88
PHA02741169 hypothetical protein; Provisional 99.88
PHA02878477 ankyrin repeat protein; Provisional 99.87
PHA02875413 ankyrin repeat protein; Provisional 99.87
PHA03095 471 ankyrin-like protein; Provisional 99.87
PHA02859209 ankyrin repeat protein; Provisional 99.87
PHA02878477 ankyrin repeat protein; Provisional 99.87
PHA03100 480 ankyrin repeat protein; Provisional 99.86
PHA03100 480 ankyrin repeat protein; Provisional 99.86
PHA02874 434 ankyrin repeat protein; Provisional 99.86
PHA02875413 ankyrin repeat protein; Provisional 99.85
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.85
KOG0510 929 consensus Ankyrin repeat protein [General function 99.85
PHA03095471 ankyrin-like protein; Provisional 99.85
PHA02859209 ankyrin repeat protein; Provisional 99.85
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.85
PHA02946446 ankyin-like protein; Provisional 99.85
PHA02798 489 ankyrin-like protein; Provisional 99.84
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.84
KOG0514452 consensus Ankyrin repeat protein [General function 99.84
KOG0508 615 consensus Ankyrin repeat protein [General function 99.84
PHA02798489 ankyrin-like protein; Provisional 99.84
PHA02884300 ankyrin repeat protein; Provisional 99.84
PHA02989 494 ankyrin repeat protein; Provisional 99.84
PHA02736154 Viral ankyrin protein; Provisional 99.83
KOG0510 929 consensus Ankyrin repeat protein [General function 99.83
PHA02876 682 ankyrin repeat protein; Provisional 99.83
PHA02743166 Viral ankyrin protein; Provisional 99.82
PHA02946446 ankyin-like protein; Provisional 99.82
PHA02989494 ankyrin repeat protein; Provisional 99.82
PHA02876 682 ankyrin repeat protein; Provisional 99.82
PHA02795437 ankyrin-like protein; Provisional 99.82
PLN03192823 Voltage-dependent potassium channel; Provisional 99.82
KOG0508 615 consensus Ankyrin repeat protein [General function 99.82
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.81
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.81
PHA02917 661 ankyrin-like protein; Provisional 99.8
PHA02741169 hypothetical protein; Provisional 99.79
PHA02730 672 ankyrin-like protein; Provisional 99.79
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.79
PHA02730672 ankyrin-like protein; Provisional 99.78
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.78
PHA02795437 ankyrin-like protein; Provisional 99.78
PHA02884300 ankyrin repeat protein; Provisional 99.78
PHA02917 661 ankyrin-like protein; Provisional 99.78
PHA02736154 Viral ankyrin protein; Provisional 99.77
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.75
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.74
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.74
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.73
PLN03192823 Voltage-dependent potassium channel; Provisional 99.73
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.72
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.7
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.7
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.69
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.67
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.67
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.66
PHA02792 631 ankyrin-like protein; Provisional 99.64
KOG0514452 consensus Ankyrin repeat protein [General function 99.64
PHA02792631 ankyrin-like protein; Provisional 99.62
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.62
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.61
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.58
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.58
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.56
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.54
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.53
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.53
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.53
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.53
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.49
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.48
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.47
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.42
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.42
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.38
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.37
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.36
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.33
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.32
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 99.24
KOG0783 1267 consensus Uncharacterized conserved protein, conta 99.19
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 99.0
PF1360630 Ank_3: Ankyrin repeat 98.94
PF1360630 Ank_3: Ankyrin repeat 98.94
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.92
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.91
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.89
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.82
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.82
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.8
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.8
KOG0522 560 consensus Ankyrin repeat protein [General function 98.74
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.72
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.68
KOG2384223 consensus Major histocompatibility complex protein 98.61
KOG0522 560 consensus Ankyrin repeat protein [General function 98.58
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.57
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.52
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.51
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.48
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.39
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 98.37
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 98.34
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 98.32
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.32
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.29
KOG0511 516 consensus Ankyrin repeat protein [General function 98.26
KOG2384223 consensus Major histocompatibility complex protein 98.25
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.19
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.18
PHA02929238 N1R/p28-like protein; Provisional 98.07
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.07
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.06
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.02
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 98.0
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.99
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 97.96
KOG0511 516 consensus Ankyrin repeat protein [General function 97.93
KOG2505591 consensus Ankyrin repeat protein [General function 97.87
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 97.85
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 97.85
PF1463444 zf-RING_5: zinc-RING finger domain 97.85
PHA02926242 zinc finger-like protein; Provisional 97.84
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.76
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 97.75
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.6
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.53
KOG0520975 consensus Uncharacterized conserved protein, conta 97.53
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 97.47
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.44
COG5236 493 Uncharacterized conserved protein, contains RING Z 97.36
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.35
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.34
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.31
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.31
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.21
smart0050463 Ubox Modified RING finger domain. Modified RING fi 97.16
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.07
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.92
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 96.6
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 96.52
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 96.49
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 96.27
KOG2505591 consensus Ankyrin repeat protein [General function 96.26
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.13
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 96.06
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 96.05
COG5152259 Uncharacterized conserved protein, contains RING a 95.67
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 95.64
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 95.54
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 95.34
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 95.0
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 94.96
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 94.87
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 94.79
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 94.51
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 94.32
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.3
KOG1002 791 consensus Nucleotide excision repair protein RAD16 93.87
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 93.02
KOG4739 233 consensus Uncharacterized protein involved in syna 92.55
KOG0297 391 consensus TNF receptor-associated factor [Signal t 92.24
KOG0825 1134 consensus PHD Zn-finger protein [General function 92.19
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 91.73
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 91.06
KOG3002 299 consensus Zn finger protein [General function pred 90.66
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 90.54
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 90.51
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 89.66
COG52191525 Uncharacterized conserved protein, contains RING Z 89.08
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 88.97
COG5222427 Uncharacterized conserved protein, contains RING Z 88.84
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 87.63
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 87.47
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 87.09
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 86.97
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 86.0
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 84.08
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 83.93
COG5175 480 MOT2 Transcriptional repressor [Transcription] 83.51
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 82.91
PF04641260 Rtf2: Rtf2 RING-finger 82.76
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 82.75
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 81.83
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 81.31
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.94  E-value=1.7e-27  Score=187.60  Aligned_cols=127  Identities=30%  Similarity=0.303  Sum_probs=76.6

Q ss_pred             CcccCCCCCCcHHHHHHHcCChHHHHHHHhC-CCCccccCCCCCCCCChHHHHHHHcCCHHHHHHHHHcCCCCcccccCC
Q 041054            5 FVNIRDGRGATPLHLAARQRRPECVHILLDS-GALVCASTGGYGCPGSTPLHLAARGGSIDCIRELLAWGADRLHRDVSG   83 (298)
Q Consensus         5 ~vn~~d~~G~TpLh~Aa~~g~~~~v~~Ll~~-ga~~~~~~~~~~~~g~TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~~g   83 (298)
                      .+|-+|..||||||.|+..|+.++|+.|+.+ |+++|..++    .|.|+||||+..|..+++++|+++|+.++.+|..|
T Consensus        64 ~~ddkDdaGWtPlhia~s~g~~evVk~Ll~r~~advna~tn----~G~T~LHyAagK~r~eIaqlLle~ga~i~~kD~~~  139 (226)
T KOG4412|consen   64 KPDDKDDAGWTPLHIAASNGNDEVVKELLNRSGADVNATTN----GGQTCLHYAAGKGRLEIAQLLLEKGALIRIKDKQG  139 (226)
T ss_pred             CCCCccccCCchhhhhhhcCcHHHHHHHhcCCCCCcceecC----CCcceehhhhcCChhhHHHHHHhcCCCCccccccc
Confidence            3455555666666666666666666666655 666666555    56666666666666666666666666666666666


Q ss_pred             CcHHHHHHhcCcHHHHHHhccCCCCCCCCCCChhhhhHhhHHHHHHHHHHHHhhhHHHHHHH
Q 041054           84 RIPYAVALKHKHGACAALLNPASAEPLVWPSPLKFISELNQEAKALLENALMEANKEREKNI  145 (298)
Q Consensus        84 ~tpL~~A~~~~~~~~~~~Ll~~ga~~~~~~~~~~~~~~~~~~~~t~L~~A~~~~~~~~~~~l  145 (298)
                      .||||-|+.-|..+++++|+.+|+.          ++..|..|.||||.|+..+..+...+|
T Consensus       140 qtplHRAAavGklkvie~Li~~~a~----------~n~qDk~G~TpL~~al~e~~~d~a~lL  191 (226)
T KOG4412|consen  140 QTPLHRAAAVGKLKVIEYLISQGAP----------LNTQDKYGFTPLHHALAEGHPDVAVLL  191 (226)
T ss_pred             CchhHHHHhccchhhHHHHHhcCCC----------CCcccccCccHHHHHHhccCchHHHHH
Confidence            6666666666666666666666654          455566666666666555555544433



>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query298
2xeh_A157 Structural Determinants For Improved Thermal Stabil 9e-14
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 4e-13
2xee_A157 Structural Determinants For Improved Thermal Stabil 8e-13
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-12
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 4e-12
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-11
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 4e-11
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 4e-11
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 5e-11
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 9e-11
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 9e-11
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 9e-11
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 1e-10
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 2e-10
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 2e-10
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 3e-10
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 4e-10
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 4e-10
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 6e-10
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 1e-09
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 1e-09
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 1e-09
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-09
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-09
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-09
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 4e-09
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 5e-09
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 1e-08
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 1e-08
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 2e-08
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 2e-08
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 3e-08
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 5e-08
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 3e-07
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 6e-07
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 2e-06
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-06
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 8e-06
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 9e-06
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 1e-05
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 1e-05
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 1e-05
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 2e-05
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 2e-05
3uxg_A172 Crystal Structure Of Rfxank Length = 172 5e-05
2xen_A91 Structural Determinants For Improved Thermal Stabil 1e-04
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 1e-04
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 1e-04
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 2e-04
1oy3_D282 Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer 2e-04
1k3z_D282 X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi 2e-04
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 3e-04
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 4e-04
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 4e-04
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 5e-04
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 6e-04
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 6e-04
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 8e-04
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 8e-04
3so8_A162 Crystal Structure Of Ankra Length = 162 9e-04
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure

Iteration: 1

Score = 73.9 bits (180), Expect = 9e-14, Method: Compositional matrix adjust. Identities = 43/101 (42%), Positives = 58/101 (57%), Gaps = 4/101 (3%) Query: 6 VNIRDGRGATPLHLAARQRRPECVHILLDSGALVCASTGGYGCPGSTPLHLAARGGSIDC 65 VN +D G TPLHLAAR+ E V +LL +GA V A G TPLHLAAR G ++ Sbjct: 61 VNAKDKDGYTPLHLAAREGHLEIVEVLLKAGADVNAKD----KDGYTPLHLAAREGHLEI 116 Query: 66 IRELLAWGADRLHRDVSGRIPYAVALKHKHGACAALLNPAS 106 + LL GAD +D G+ P+ +A++ H A +L A+ Sbjct: 117 VEVLLKAGADVNAQDKFGKTPFDLAIREGHEDIAEVLQKAA 157
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query298
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-17
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-17
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-14
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-09
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-17
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-16
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-14
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-14
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-17
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-17
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-17
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-14
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-12
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-09
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-17
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-16
3v30_A172 DNA-binding protein rfxank; structural genomics co 7e-15
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-13
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-17
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-15
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-13
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-13
3deo_A183 Signal recognition particle 43 kDa protein; chloro 8e-17
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-13
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-13
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-16
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-12
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-16
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-16
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-15
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-14
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-14
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-05
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-15
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-12
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-11
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-15
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-14
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-11
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-08
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-15
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-05
2pnn_A273 Transient receptor potential cation channel subfa 5e-15
2pnn_A273 Transient receptor potential cation channel subfa 1e-10
2pnn_A273 Transient receptor potential cation channel subfa 1e-08
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-15
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-15
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-15
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-11
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-15
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-12
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-09
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 9e-15
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-13
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-14
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-14
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-04
2etb_A256 Transient receptor potential cation channel subfam 1e-14
2etb_A256 Transient receptor potential cation channel subfam 4e-12
2etb_A256 Transient receptor potential cation channel subfam 1e-10
2etb_A256 Transient receptor potential cation channel subfam 2e-09
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-14
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-13
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-05
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-04
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-14
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-13
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-09
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-09
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-14
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-08
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-14
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 7e-05
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-14
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-13
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-10
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-14
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-11
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-14
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-10
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-09
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 8e-14
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-11
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-13
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-12
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-12
2rfa_A232 Transient receptor potential cation channel subfa 1e-13
2rfa_A232 Transient receptor potential cation channel subfa 9e-12
2rfa_A232 Transient receptor potential cation channel subfa 2e-09
2rfa_A232 Transient receptor potential cation channel subfa 1e-08
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-13
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-11
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 9e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-13
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 8e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-13
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-11
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-11
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-07
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-13
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-11
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-11
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-13
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 9e-12
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 7e-11
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-06
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-13
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-12
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-11
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-12
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-11
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-04
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-12
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-12
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-11
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-09
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-12
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-12
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-12
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-10
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-12
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-12
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-08
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-05
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-12
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-09
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-06
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-04
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-12
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 7e-07
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-12
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-11
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-10
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 8e-09
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-04
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-12
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-11
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-09
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 9e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-08
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-04
1awc_B153 Protein (GA binding protein beta 1); complex (tran 9e-12
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-11
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-10
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-11
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 8e-10
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-08
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-08
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-07
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 8e-11
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-10
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-10
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 9e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-10
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-10
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-10
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-06
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 5e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-09
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 6e-07
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 7e-05
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-09
1sw6_A327 Regulatory protein SWI6; transcription regulation, 8e-07
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-04
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 2e-06
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 5e-06
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 4e-05
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 6e-05
2ea5_A68 Cell growth regulator with ring finger domain prot 3e-04
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 5e-04
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
 Score = 79.8 bits (198), Expect = 1e-17
 Identities = 29/97 (29%), Positives = 46/97 (47%), Gaps = 5/97 (5%)

Query: 6   VNIRDGRGATPLHLAARQRRPECVHILLDSGALVCASTGGYGCPGSTPLHLAARGGSIDC 65
           VN       TPL  A      +CV++LL  GA V   +        +P+H AAR G ++C
Sbjct: 118 VNGVTADWHTPLFNACVSGSWDCVNLLLQHGASVQPESDLA-----SPIHEAARRGHVEC 172

Query: 66  IRELLAWGADRLHRDVSGRIPYAVALKHKHGACAALL 102
           +  L+A+G +  H+      P  +A +++  AC   L
Sbjct: 173 VNSLIAYGGNIDHKISHLGTPLYLACENQQRACVKKL 209


>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query298
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.93
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.93
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.93
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.93
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.93
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.93
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.93
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.93
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.93
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.92
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.92
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.92
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.92
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.92
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.92
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.92
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.92
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.92
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.92
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.92
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.92
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.92
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.92
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.92
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.91
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.91
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.91
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.91
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.91
2rfa_A232 Transient receptor potential cation channel subfa 99.91
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.91
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.91
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.91
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.91
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.91
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.91
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.91
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.91
2etb_A256 Transient receptor potential cation channel subfam 99.91
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.91
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.91
3hra_A201 Ankyrin repeat family protein; structural protein; 99.91
2rfa_A232 Transient receptor potential cation channel subfa 99.91
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.91
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.9
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.9
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.9
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.9
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.9
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.9
3hra_A201 Ankyrin repeat family protein; structural protein; 99.9
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.9
2etb_A256 Transient receptor potential cation channel subfam 99.9
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.9
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.9
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.9
2pnn_A273 Transient receptor potential cation channel subfa 99.9
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.89
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.89
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.89
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.89
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.89
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.89
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.89
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.89
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.89
2pnn_A273 Transient receptor potential cation channel subfa 99.89
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.89
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.89
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.89
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.89
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.88
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.88
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.88
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.88
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.88
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.88
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.88
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.88
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.88
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.88
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.87
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.87
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.87
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.87
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.87
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.86
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.86
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.86
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.86
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.85
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.85
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.84
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.84
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.84
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.84
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.83
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.83
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.83
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.83
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.82
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.82
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.82
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.82
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.81
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.8
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.79
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.75
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.7
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.69
2ea5_A68 Cell growth regulator with ring finger domain prot 98.76
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.76
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.74
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.59
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.59
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.58
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.57
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.55
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.44
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.4
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.4
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.4
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.38
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.38
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.37
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.34
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.32
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.32
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.31
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.31
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.31
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.3
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.29
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.28
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.28
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.28
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.28
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.27
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.27
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.26
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.26
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.25
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.24
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.23
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.18
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.17
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.16
2ect_A78 Ring finger protein 126; metal binding protein, st 98.14
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.13
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.11
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.11
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.09
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.08
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.06
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.04
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.03
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.03
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.02
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 97.95
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.94
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 97.92
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 97.92
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.9
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 97.87
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 97.85
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 97.66
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.66
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.65
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.58
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.53
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.46
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 97.36
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.35
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.33
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.16
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 96.54
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 96.43
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 95.19
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 94.42
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 94.16
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 93.74
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 83.01
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 81.65
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.96  E-value=5.3e-30  Score=208.50  Aligned_cols=134  Identities=33%  Similarity=0.426  Sum_probs=126.8

Q ss_pred             CCCCcccCCCCCCcHHHHHHHcCChHHHHHHHhCCCCccccCCCCCCCCChHHHHHHHcCCHHHHHHHHHcCCCCccccc
Q 041054            2 YARFVNIRDGRGATPLHLAARQRRPECVHILLDSGALVCASTGGYGCPGSTPLHLAARGGSIDCIRELLAWGADRLHRDV   81 (298)
Q Consensus         2 ~~~~vn~~d~~G~TpLh~Aa~~g~~~~v~~Ll~~ga~~~~~~~~~~~~g~TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~   81 (298)
                      .|+++|.+|..|+||||+|+..++.+++++|+++|++++.++.    .|+||||+|+..|+.++|++|+++|++++.+|.
T Consensus        26 ~Gadvn~~d~~g~t~l~~a~~~~~~~~~~~ll~~gad~~~~d~----~g~TpLh~A~~~g~~~~v~~Ll~~gadvn~~d~  101 (169)
T 4gpm_A           26 NGADVNASDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKDS----DGRTPLHHAAENGHKEVVKLLISKGADVNAKDS  101 (169)
T ss_dssp             TTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCT----TSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCT
T ss_pred             CCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHhcccchhhhcc----CCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCCC
Confidence            4789999999999999999999999999999999999999887    899999999999999999999999999999999


Q ss_pred             CCCcHHHHHHhcCcHHHHHHhccCCCCCCCCCCChhhhhHhhHHHHHHHHHHHHhhhHHHHHHHhcCC
Q 041054           82 SGRIPYAVALKHKHGACAALLNPASAEPLVWPSPLKFISELNQEAKALLENALMEANKEREKNILKGT  149 (298)
Q Consensus        82 ~g~tpL~~A~~~~~~~~~~~Ll~~ga~~~~~~~~~~~~~~~~~~~~t~L~~A~~~~~~~~~~~ll~~~  149 (298)
                      .|+||||+|+..|+.+++++|+++|++          ++..|.+|+|||++|+..++.+++++|++.+
T Consensus       102 ~G~TpLh~A~~~g~~~~v~~Ll~~gad----------~~~~d~~G~TpL~~A~~~g~~~iv~~Ll~~G  159 (169)
T 4gpm_A          102 DGRTPLHHAAENGHKEVVKLLISKGAD----------VNTSDSDGRTPLDLAREHGNEEVVKLLEKQG  159 (169)
T ss_dssp             TSCCHHHHHHHTTCHHHHHHHHHTTCC----------TTCCCTTSCCHHHHHHHTTCHHHHHHHHTC-
T ss_pred             CCCCHHHHHHHcCCHHHHHHHHHcCCC----------ccccCCCCCCHHHHHHHcCCHHHHHHHHHCC
Confidence            999999999999999999999999999          4567888999999999999999999887754



>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 298
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-15
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-13
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-13
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-12
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.002
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.004
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-10
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 8e-10
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-09
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-06
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-08
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 8e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-08
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.001
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-06
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-04
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 5e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.001
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 2e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 3e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.001
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.002
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.003
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 0.003
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.004
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 73.5 bits (179), Expect = 2e-15
 Identities = 29/100 (29%), Positives = 40/100 (40%), Gaps = 4/100 (4%)

Query: 15  TPLHLAARQRRPECVHILLDSGALVCASTGGYGCPGSTPLHLAARGGSIDCIRELLAWGA 74
           TPLH+A+       V  LL  GA    S         TPLH+AAR G  +  + LL   A
Sbjct: 2   TPLHVASFMGHLPIVKNLLQRGASPNVSNVK----VETPLHMAARAGHTEVAKYLLQNKA 57

Query: 75  DRLHRDVSGRIPYAVALKHKHGACAALLNPASAEPLVWPS 114
               +    + P   A +  H     LL   +A P +  +
Sbjct: 58  KVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATT 97


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query298
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.93
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.91
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.91
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.91
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.9
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.89
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.89
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.89
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.89
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.87
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.87
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.87
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.87
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.86
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.86
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.85
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.85
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.84
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.84
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.84
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.83
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.83
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.82
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.82
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.8
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.8
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.79
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.77
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.76
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.74
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.72
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.53
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.62
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.49
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.47
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.41
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.3
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.18
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.16
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.14
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.06
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.05
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.04
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.01
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.73
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.67
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.41
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.25
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 96.0
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 81.42
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.93  E-value=1.6e-26  Score=196.59  Aligned_cols=209  Identities=18%  Similarity=0.092  Sum_probs=159.0

Q ss_pred             ccCCCCCCcHHHHHHHcCChHHHHHHHhCCCCccccCCCCCCCCChHHHHHHHcCCHHHHHHHHHcCCCCcccccCCCcH
Q 041054            7 NIRDGRGATPLHLAARQRRPECVHILLDSGALVCASTGGYGCPGSTPLHLAARGGSIDCIRELLAWGADRLHRDVSGRIP   86 (298)
Q Consensus         7 n~~d~~G~TpLh~Aa~~g~~~~v~~Ll~~ga~~~~~~~~~~~~g~TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~~g~tp   86 (298)
                      +..|++|+||||+||+.|+.++|++||++|+++...+. .|..|.||||+|+..|+.+++++|+++|++++.+|..|.||
T Consensus         3 ~~i~~~G~t~Lh~A~~~~~~~~v~~Ll~~~a~~~~i~~-~~~~g~TpL~~A~~~g~~~iv~~Ll~~ga~i~~~d~~g~tp   81 (255)
T d1oy3d_           3 GYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGHEYLDL-QNDLGQTALHLAAILGEASTVEKLYAAGAGVLVAERGGHTA   81 (255)
T ss_dssp             CCCCTTCCCHHHHHHHTTCHHHHHHHHHHHTTSGGGGC-CCTTSCCHHHHHHHHTCHHHHHHHHHTTCCSSCCCTTSCCH
T ss_pred             ccCCcCCCCHHHHHHHcCCHHHHHHHHHcCCCcccccC-cCCCCCCccchHHhhcccccccccccccccccccccccchh
Confidence            56789999999999999999999999999988543321 22389999999999999999999999999999999999999


Q ss_pred             HHHHHhcCcHHHHHHhccCCCCCCCCC-------------------------------------CChhhhhHhhHHHHHH
Q 041054           87 YAVALKHKHGACAALLNPASAEPLVWP-------------------------------------SPLKFISELNQEAKAL  129 (298)
Q Consensus        87 L~~A~~~~~~~~~~~Ll~~ga~~~~~~-------------------------------------~~~~~~~~~~~~~~t~  129 (298)
                      ||+|+..++.+++++|++.+.......                                     .....++.++.+|.||
T Consensus        82 L~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~in~~d~~g~Tp  161 (255)
T d1oy3d_          82 LHLACRVRAHTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTP  161 (255)
T ss_dssp             HHHHTTTTCHHHHHHHSSSCCSSCCCC-----------------------------------CCCGGGGTTCCCTTSCCH
T ss_pred             hhhhhccCchHHHHHHHhhccchhcccchhhhhHHhhhcccchHHHHHHHhhcchhHHHHHHhhhcCcccccccccCccc
Confidence            999999999999999988765422110                                     1112334457788999


Q ss_pred             HHHHHHhhhHHHHHHHhcCCCCCCCCCCCCCCCCcccccccCCCcccccccccccceEEeCCCchhHHHHHHHHhhcCCC
Q 041054          130 LENALMEANKEREKNILKGTAYSLPSPSHSDVGADDNISEASDTELCCICFEQVCTIEVQDCGHQMCAQCTLALCCHNKP  209 (298)
Q Consensus       130 L~~A~~~~~~~~~~~ll~~~~~~~~~p~~~~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~CGH~~C~~C~~~l~~~~~~  209 (298)
                      ||+|+..++.+++++|++....... +....           +.....++..         .|+..+...++..+++.+.
T Consensus       162 Lh~A~~~~~~~~v~~Ll~~~~~~~~-~~~~~-----------g~TpL~~A~~---------~~~~~~v~~Ll~~gadin~  220 (255)
T d1oy3d_         162 LHVAVIHKDAEMVRLLRDAGADLNK-PEPTC-----------GRTPLHLAVE---------AQAASVLELLLKAGADPTA  220 (255)
T ss_dssp             HHHHHHTTCHHHHHHHHHHTCCTTC-CCTTT-----------CCCHHHHHHH---------TTCHHHHHHHHHTTCCTTC
T ss_pred             ccccccccccccccchhcccccccc-ccccc-----------cccccccccc---------ccHHHHHHHHHHCCCCCCC
Confidence            9999999999999988765332110 00010           0111111111         2677788888888777776


Q ss_pred             CCCCC-CCCCCCCcccccccceeEEEEee
Q 041054          210 NPTTA-CLTPPVCPFCRSTIAHLVVVKIE  237 (298)
Q Consensus       210 ~~~~~-~~~~~~Cp~cr~~I~~~~~~~~~  237 (298)
                      .+..+ ||++.+|...+..|+++++...+
T Consensus       221 ~d~~g~t~L~~A~~~~~~~i~~~Ll~~Ga  249 (255)
T d1oy3d_         221 RMYGGRTPLGSALLRPNPILARLLRAHGA  249 (255)
T ss_dssp             CCTTSCCHHHHHHTSSCHHHHHHHHHTTC
T ss_pred             CCCCCCCHHHHHHHCCCHHHHHHHHHcCC
Confidence            66655 99999999999999999987654



>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure