Citrus Sinensis ID: 041061
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 283 | ||||||
| 224118134 | 696 | predicted protein [Populus trichocarpa] | 0.950 | 0.386 | 0.522 | 1e-73 | |
| 224136568 | 409 | predicted protein [Populus trichocarpa] | 0.915 | 0.633 | 0.488 | 7e-69 | |
| 224136572 | 650 | predicted protein [Populus trichocarpa] | 0.915 | 0.398 | 0.488 | 8e-69 | |
| 224116010 | 710 | predicted protein [Populus trichocarpa] | 0.918 | 0.366 | 0.486 | 1e-63 | |
| 224105645 | 702 | predicted protein [Populus trichocarpa] | 0.918 | 0.370 | 0.471 | 2e-63 | |
| 224115936 | 802 | predicted protein [Populus trichocarpa] | 0.901 | 0.317 | 0.477 | 6e-62 | |
| 224115956 | 700 | predicted protein [Populus trichocarpa] | 0.911 | 0.368 | 0.468 | 6e-61 | |
| 224115972 | 353 | predicted protein [Populus trichocarpa] | 0.897 | 0.719 | 0.479 | 2e-60 | |
| 224115980 | 595 | predicted protein [Populus trichocarpa] | 0.897 | 0.426 | 0.471 | 2e-59 | |
| 224115968 | 276 | predicted protein [Populus trichocarpa] | 0.858 | 0.880 | 0.483 | 5e-59 |
| >gi|224118134|ref|XP_002331567.1| predicted protein [Populus trichocarpa] gi|222873791|gb|EEF10922.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 282 bits (721), Expect = 1e-73, Method: Compositional matrix adjust.
Identities = 142/272 (52%), Positives = 186/272 (68%), Gaps = 3/272 (1%)
Query: 5 VNQKGQTILHVAVRRRRHDIFQFIVEKMPLYVPKWAARIDENGYTILHHVADMKHYEYGI 64
V++KGQ I+HVA++ R+ +IF +V+KM + + + RID+NGYT+LHHVA M +Y G
Sbjct: 403 VSRKGQNIMHVAIKNRQKEIFN-MVKKMEIPMTRLVRRIDKNGYTLLHHVAVMHYYSGGT 461
Query: 65 RPGPVYQFQEELQWFECVKDIAPSHYTMHRDTRKNMTAGDLFNRTHEDQLKKAQDWIKET 124
PGP Q QEEL WF+ V+ I P HY MHR K+ TA + F +TH LK+AQ+W+K T
Sbjct: 462 LPGPALQLQEELHWFDRVRKIIPPHYEMHRSRYKDKTAQEFFKKTHTKLLKEAQEWLKRT 521
Query: 125 SESCSILSILIATFVFAAAYTVPGGNN-DKGFPNFLDSPMFYLFTITDVASLSLSLSSAV 183
SESCS +++LIAT FAAAYTVPGG+N D G P L P+F +FT+ DV SL+ SL+S V
Sbjct: 522 SESCSTVAVLIATVAFAAAYTVPGGSNQDTGLPVLLHDPIFLVFTVMDVLSLASSLTSVV 581
Query: 184 MFLSILTSPRESSDFLDHLPRKLKIGFMLLFLSVLASMITFSASILLVARLGERWTVAL- 242
MFLSILTSP + DF LP+KL +GF LF SV M+TF+A+ILL+ L +RWT L
Sbjct: 582 MFLSILTSPFQLQDFRHSLPQKLILGFSFLFFSVAVMMLTFTATILLIVHLKKRWTTLLI 641
Query: 243 YAAAILPVILLALIALPLYGNFEKGLNHYLGL 274
Y A LPV + AL+ +PLY F L + L
Sbjct: 642 YTVAFLPVSIFALLQVPLYLTFMNTLKSSVNL 673
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224136568|ref|XP_002322362.1| predicted protein [Populus trichocarpa] gi|222869358|gb|EEF06489.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224136572|ref|XP_002322363.1| predicted protein [Populus trichocarpa] gi|222869359|gb|EEF06490.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224116010|ref|XP_002317184.1| predicted protein [Populus trichocarpa] gi|222860249|gb|EEE97796.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224105645|ref|XP_002333787.1| predicted protein [Populus trichocarpa] gi|222838519|gb|EEE76884.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224115936|ref|XP_002317165.1| predicted protein [Populus trichocarpa] gi|222860230|gb|EEE97777.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224115956|ref|XP_002317170.1| predicted protein [Populus trichocarpa] gi|222860235|gb|EEE97782.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224115972|ref|XP_002317174.1| predicted protein [Populus trichocarpa] gi|222860239|gb|EEE97786.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224115980|ref|XP_002317176.1| predicted protein [Populus trichocarpa] gi|222860241|gb|EEE97788.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224115968|ref|XP_002317173.1| predicted protein [Populus trichocarpa] gi|222860238|gb|EEE97785.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 283 | ||||||
| TAIR|locus:2165174 | 347 | AT5G35810 "AT5G35810" [Arabido | 0.840 | 0.685 | 0.329 | 8.5e-33 | |
| TAIR|locus:2080240 | 574 | AT3G54070 "AT3G54070" [Arabido | 0.805 | 0.397 | 0.352 | 2.9e-32 | |
| TAIR|locus:2175413 | 669 | AT5G04700 "AT5G04700" [Arabido | 0.819 | 0.346 | 0.311 | 6.9e-25 | |
| TAIR|locus:2180228 | 625 | AT5G04690 "AT5G04690" [Arabido | 0.763 | 0.345 | 0.299 | 1.6e-24 | |
| TAIR|locus:2175448 | 603 | AT5G04730 "AT5G04730" [Arabido | 0.770 | 0.361 | 0.297 | 2.7e-22 | |
| TAIR|locus:2075009 | 607 | AT3G09550 [Arabidopsis thalian | 0.749 | 0.349 | 0.241 | 1.1e-06 | |
| TAIR|locus:2092522 | 590 | ITN1 "INCREASED TOLERANCE TO N | 0.759 | 0.364 | 0.214 | 0.00022 |
| TAIR|locus:2165174 AT5G35810 "AT5G35810" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 358 (131.1 bits), Expect = 8.5e-33, P = 8.5e-33
Identities = 81/246 (32%), Positives = 133/246 (54%)
Query: 1 MLSTVNQKGQTILHVAVRRRRHDIFQFIVEKMPLYVPKWAARIDENGYTILHHVADMKH- 59
++ TV+ K Q++ H+A R IF I E + + E+ +LH VA +
Sbjct: 57 LIWTVDHKNQSLFHIAAINRHEKIFNRIYELGAIKDLIAMYKEKESNDNLLHLVARLPPP 116
Query: 60 YEYGIRPGPVYQFQEELQWFECVKDIAPSHYTMHRDTRKNMTAGDLFNRTHEDQLKKAQD 119
+ G Q Q E+ W++ VK+I P Y ++ +K A DLF + H++ K+ +
Sbjct: 117 NRLQVVSGAALQMQREILWYKAVKEIVPRVYIKTKN-KKEEVAHDLFTKEHDNLRKEGEK 175
Query: 120 WIKETSESCSILSILIATFVFAAAYTVPGGNNDKG------FPNFLDSPMFYLFTITDVA 173
W+KET+ +C ++S LIAT VFAAA+T+PGGN+ G FP F F +F I+D
Sbjct: 176 WMKETATACILVSTLIATVVFAAAFTLPGGNDTSGDIKTLGFPTFRKEFWFEVFIISDSV 235
Query: 174 XXXXXXXXAVMFLSILTSPRESSDFLDHLPRKLKIGFMLLFLSVLASMITFSASILLVAR 233
++FLSILTS + F LP KL +G + LF+S+++ ++ F+A+++L+
Sbjct: 236 ALLSSVTSIMIFLSILTSRYAEASFQTTLPTKLMLGLLALFVSIISMVLAFTATLILIRD 295
Query: 234 LGERWT 239
+W+
Sbjct: 296 QEPKWS 301
|
|
| TAIR|locus:2080240 AT3G54070 "AT3G54070" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175413 AT5G04700 "AT5G04700" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2180228 AT5G04690 "AT5G04690" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175448 AT5G04730 "AT5G04730" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075009 AT3G09550 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2092522 ITN1 "INCREASED TOLERANCE TO NACL" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.01660047 | hypothetical protein (696 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 283 | |||
| pfam13962 | 114 | pfam13962, PGG, Domain of unknown function | 4e-22 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 3e-04 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 4e-04 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 8e-04 |
| >gnl|CDD|222475 pfam13962, PGG, Domain of unknown function | Back alignment and domain information |
|---|
Score = 88.3 bits (220), Expect = 4e-22
Identities = 34/121 (28%), Positives = 56/121 (46%), Gaps = 14/121 (11%)
Query: 118 QDWIKETSESCSILSILIATFVFAAAYTVPGGNND------KGFPNFLDSP-MFYLFTIT 170
+W+++T S +++ LIAT FAA +T PGG G P P F F ++
Sbjct: 1 SEWLEKTRNSLLVVATLIATVTFAAGFTPPGGYWQDDGGHHAGTPILAGKPRRFKAFFVS 60
Query: 171 DVASLSLSLSSAVMFLSILTSPRESSDFLDHLPRKLKIGFMLLFLSVLASMITFSASILL 230
+ + SL + ++ L I+ S +L LL+LS+L+ M+ F+A
Sbjct: 61 NTIAFVASLVAVILLLYIVPSFSRRL-------PRLLALLTLLWLSLLSLMVAFAAGSYR 113
Query: 231 V 231
V
Sbjct: 114 V 114
|
The PGG domain is named for the highly conserved sequence motif found at the startt of the domain. The function is not known. Length = 114 |
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 283 | |||
| PF13962 | 113 | PGG: Domain of unknown function | 99.95 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.41 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.34 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.3 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.29 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.23 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.13 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.08 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.08 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.06 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.04 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.02 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 98.96 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 98.94 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 98.92 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 98.91 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 98.9 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 98.9 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 98.89 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 98.89 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 98.88 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 98.87 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 98.86 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 98.84 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 98.83 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 98.82 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 98.81 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 98.8 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 98.8 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 98.78 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 98.78 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 98.76 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 98.76 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 98.75 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 98.73 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 98.72 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 98.72 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 98.72 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 98.71 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 98.7 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 98.7 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 98.69 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 98.69 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 98.67 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 98.67 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 98.61 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 98.58 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 98.57 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 98.55 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.55 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 98.55 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 98.55 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 98.54 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 98.53 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 98.53 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 98.51 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 98.49 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 98.49 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.46 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 98.41 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 98.4 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 98.4 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 98.39 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 98.38 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 98.35 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 98.34 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 98.34 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 98.32 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 98.3 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 98.29 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 98.26 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 98.25 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 98.23 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 98.23 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 98.17 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 98.13 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.12 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 98.09 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 97.95 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 97.95 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 97.93 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 97.93 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 97.92 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 97.89 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 97.81 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 97.75 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 97.74 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 97.74 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 97.64 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 97.61 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 97.41 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 97.38 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 97.1 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 97.08 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 96.76 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 96.71 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 96.54 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 96.53 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 96.42 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 96.33 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 95.89 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 95.73 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 95.34 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 95.11 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 95.03 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 94.86 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 94.85 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 94.81 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 94.78 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 93.88 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 93.51 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 93.06 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 91.35 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 91.06 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 90.37 | |
| KOG4591 | 280 | consensus Uncharacterized conserved protein, conta | 89.58 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 86.27 |
| >PF13962 PGG: Domain of unknown function | Back alignment and domain information |
|---|
Probab=99.95 E-value=1.4e-27 Score=185.55 Aligned_cols=108 Identities=34% Similarity=0.606 Sum_probs=95.1
Q ss_pred HhHHhhhccchhHHHHHHHHHHhhhhccCCCCCCCC----CccccCCCc-chhhHHHHHHHHHHHHHHHHHHHHHHhcCC
Q 041061 118 QDWIKETSESCSILSILIATFVFAAAYTVPGGNNDK----GFPNFLDSP-MFYLFTITDVASLSLSLSSAVMFLSILTSP 192 (283)
Q Consensus 118 ~~~lk~t~~~~~vva~LIATvtFaA~~t~PGG~~~~----G~~~l~~~~-~f~~F~~~nt~a~~~S~~~~~~~~~~~~~~ 192 (283)
+||+++++|++++||+|||||||||++|||||++|| |+|++.+++ .|++|+++|++||++|+++++++++.+
T Consensus 1 ~~~~~~~~~~llVvAtLIATvtF~A~~tpPGG~~~~~~~~G~~il~~~~~~f~~F~~~nt~af~~S~~~i~~l~~~~--- 77 (113)
T PF13962_consen 1 KKWLEDTRNSLLVVATLIATVTFQAAFTPPGGYWQDDDDAGTPILAKKPSAFKAFLISNTIAFFSSLAAIFLLISGL--- 77 (113)
T ss_pred ChHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCccccccCCCCchhccccchhhhHHHHHHHHHHHHHHHHHHHHHHh---
Confidence 478999999999999999999999999999999774 999999888 999999999999999999998876322
Q ss_pred CccchhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 041061 193 RESSDFLDHLPRKLKIGFMLLFLSVLASMITFSASILLV 231 (283)
Q Consensus 193 ~~~~~~~~~l~~~l~~~~~~l~~s~~~m~~af~~~~~~~ 231 (283)
+++.+..++.+.++..++++++.+|++||++|+++|
T Consensus 78 ---~~~~~~~~~~~~~~~~~~~~a~~~~~~Af~~g~~~v 113 (113)
T PF13962_consen 78 ---DDFRRFLRRYLLIASVLMWIALISMMVAFAAGIYLV 113 (113)
T ss_pred ---hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccC
Confidence 334444556788899999999999999999999875
|
|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4591 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 283 | |||
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 4e-04 |
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
Score = 39.7 bits (94), Expect = 4e-04
Identities = 11/64 (17%), Positives = 20/64 (31%), Gaps = 7/64 (10%)
Query: 1 MLSTVNQKGQTILHVAVRRRRHDIFQFIVEKMPLYVPKWAARI---DENGYTILHHVADM 57
M + ++ G T LH+AV + +V + + + T LH
Sbjct: 1 MATRADEDGDTPLHIAVVQGNLPAVHRLVN----LFQQGGRELDIYNNLRQTPLHLAVIT 56
Query: 58 KHYE 61
Sbjct: 57 TLPS 60
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 283 | |||
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.43 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.38 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.38 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.35 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.34 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.33 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.33 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.32 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.28 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.27 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.25 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.25 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.25 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.24 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.24 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.23 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.23 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.23 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.23 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.23 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.22 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.22 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.21 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.2 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.19 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.19 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.19 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.19 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.18 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.18 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.17 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.17 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.17 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.15 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.15 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.15 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.14 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.14 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.14 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.13 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.13 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.13 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.13 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.13 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.12 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.12 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.12 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.1 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.09 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.09 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.09 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.08 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.07 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 99.06 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.06 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.06 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.05 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.05 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.04 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.04 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.04 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.04 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.04 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.04 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.03 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.03 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.03 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.03 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.03 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.03 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.03 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.03 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.02 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.02 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.02 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.02 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.02 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.02 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.02 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.01 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.0 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 98.99 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 98.99 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 98.99 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 98.98 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 98.98 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 98.98 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 98.98 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 98.97 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 98.97 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 98.97 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 98.96 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 98.95 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 98.95 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 98.95 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 98.95 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 98.94 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 98.94 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 98.94 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 98.93 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 98.92 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 98.92 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 98.89 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 98.89 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 98.86 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 98.85 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 98.85 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 98.85 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 98.8 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 98.77 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 98.76 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 98.74 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 98.37 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 98.14 |
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
Probab=99.43 E-value=1.2e-13 Score=113.33 Aligned_cols=102 Identities=23% Similarity=0.214 Sum_probs=60.4
Q ss_pred cccccCCCChHHHHHHHhCCHHHHHHHHHhCCCCcccccccccCCCCcHHHHHHhcCCcccccC--------------CC
Q 041061 2 LSTVNQKGQTILHVAVRRRRHDIFQFIVEKMPLYVPKWAARIDENGYTILHHVADMKHYEYGIR--------------PG 67 (283)
Q Consensus 2 ie~~D~~G~t~LH~Av~~g~~~iv~~Ll~~~~~~~~~~vn~~D~~GnTpLHlAa~~~~~~~~~~--------------~g 67 (283)
++.+|.+|+||||+|+..++.+++++|++++ ..+|.+|.+|+||||+|+..|+.+.+.. ..
T Consensus 30 vn~~d~~g~t~l~~a~~~~~~~~~~~ll~~g-----ad~~~~d~~g~TpLh~A~~~g~~~~v~~Ll~~gadvn~~d~~G~ 104 (169)
T 4gpm_A 30 VNASDSDGRTPLHHAAENGHKEVVKLLISKG-----ADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKDSDGR 104 (169)
T ss_dssp TTCCCTTSCCHHHHHHHTTCHHHHHHHHHTT-----CCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSC
T ss_pred CCCcCCCCCCHHHHHHHcCCHHHHHHHHhcc-----cchhhhccCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCCCCCC
Confidence 3456666666666666666666666666542 3466666666666666666665443210 12
Q ss_pred ChhhhHHHhhhhhhhhccccc-ccccccccccCCcccccccch
Q 041061 68 PVYQFQEELQWFECVKDIAPS-HYTMHRDTRKNMTAGDLFNRT 109 (283)
Q Consensus 68 ~al~l~~~l~~~~~v~~~~~~-~~~~~~n~~~G~T~~dl~~~~ 109 (283)
+++..+...+..+.++.++.. ...+.+|+ +|+||.+++.+.
T Consensus 105 TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~-~G~TpL~~A~~~ 146 (169)
T 4gpm_A 105 TPLHHAAENGHKEVVKLLISKGADVNTSDS-DGRTPLDLAREH 146 (169)
T ss_dssp CHHHHHHHTTCHHHHHHHHHTTCCTTCCCT-TSCCHHHHHHHT
T ss_pred CHHHHHHHcCCHHHHHHHHHcCCCccccCC-CCCCHHHHHHHc
Confidence 455555444444555544433 23456777 999999887554
|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 283 | ||||
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 2e-04 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 3e-04 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 0.002 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 0.003 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 0.003 |
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Transcription factor inhibitor I-kappa-B-beta, IKBB species: Mouse (Mus musculus) [TaxId: 10090]
Score = 39.7 bits (91), Expect = 2e-04
Identities = 21/128 (16%), Positives = 40/128 (31%), Gaps = 3/128 (2%)
Query: 5 VNQKGQTILHVAVRRRRHDIFQFIVEKMPLYVPKWAARIDENGYTILHHVADMKHYEYGI 64
V + G T LH+AV + F++ ++ ++ G T LH A +
Sbjct: 5 VTEDGDTALHLAVIHQHEPFLDFLLGFSA--GHEYLDLQNDLGQTALHLAAILGEASTVE 62
Query: 65 RPGPVYQFQEELQWFECVKDIAPSHYTMHRDTRKNMTAGDLFNRTHEDQ-LKKAQDWIKE 123
+ + H + R D L ++QD +
Sbjct: 63 KLYAAGAGVLVAERGGHTALHLACRVRAHTCACVLLQPRPSHPRDASDTYLTQSQDCTPD 122
Query: 124 TSESCSIL 131
TS + + +
Sbjct: 123 TSHAPAAV 130
|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 283 | |||
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.46 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.39 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.29 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.24 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.22 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.21 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.2 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.15 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.14 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.13 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.12 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.1 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.1 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.09 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.06 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.04 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.03 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.02 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.02 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.0 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 98.97 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 98.97 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 98.95 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 98.93 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 98.92 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 98.9 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 98.89 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 98.88 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 98.87 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 98.87 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 98.86 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 98.85 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 98.82 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 98.81 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 98.72 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 98.71 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 98.71 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 98.65 |
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Myotrophin species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.46 E-value=3.2e-14 Score=107.94 Aligned_cols=82 Identities=20% Similarity=0.195 Sum_probs=61.2
Q ss_pred cccccCCCChHHHHHHHhCCHHHHHHHHHhCCCCcccccccccCCCCcHHHHHHhcCCcccccCCCChhhhHHHhhhhhh
Q 041061 2 LSTVNQKGQTILHVAVRRRRHDIFQFIVEKMPLYVPKWAARIDENGYTILHHVADMKHYEYGIRPGPVYQFQEELQWFEC 81 (283)
Q Consensus 2 ie~~D~~G~t~LH~Av~~g~~~iv~~Ll~~~~~~~~~~vn~~D~~GnTpLHlAa~~~~~~~~~~~g~al~l~~~l~~~~~ 81 (283)
++.+|++|+||||+|+.+|+.+++++|++++ ..+|.+|.+|+||||+|+..++.+ .
T Consensus 28 ~n~~~~~g~t~lh~A~~~~~~~~~~~ll~~g-----~din~~d~~g~tpLh~A~~~~~~~-------------------~ 83 (118)
T d1myoa_ 28 VNRTLEGGRKPLHYAADCGQLEILEFLLLKG-----ADINAPDKHHITPLLSAVYEGHVS-------------------C 83 (118)
T ss_dssp CCCCSSSSCCTTHHHHHHSTTTHHHHHHHSS-----CTTTCCSSSCSCHHHHHHTTTCCH-------------------H
T ss_pred ccccccccccccccccccccccccccccccc-----ceeeecccccccchhhhhhcCchh-------------------h
Confidence 4567888999999999999999998888763 458888889999999998887743 2
Q ss_pred hhccccc-ccccccccccCCcccccccc
Q 041061 82 VKDIAPS-HYTMHRDTRKNMTAGDLFNR 108 (283)
Q Consensus 82 v~~~~~~-~~~~~~n~~~G~T~~dl~~~ 108 (283)
++.++.. ...+.+|+ +|+||.+++..
T Consensus 84 v~~Ll~~Gad~~~~d~-~G~t~l~~a~~ 110 (118)
T d1myoa_ 84 VKLLLSKGADKTVKGP-DGLTALEATDN 110 (118)
T ss_dssp HHHHHTTCCCSSSSSS-STCCCCCTCSS
T ss_pred hhhhhcccccceeeCC-CCCCHHHHHhH
Confidence 2333322 23566777 99999998743
|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|