Citrus Sinensis ID: 041071

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-----
MESLKTLVLSGCSKLKKFPDIVGGMECLQELRVDGTDIKELPVSIELMSGLVSLNLKDCRNLTTLPITIGNLECLQTLVLSGCSKIVKFPETVISVEDLSELFLDRTSITEVPSSIELLTKLQWLNLNDCRSLVRLPSSINGLTSLKTLNLSGCFKLENVPETLRQIESLEKLDISGTAIRQPLSSIFLMKNLKELSCRGCKGSPSSASWFLRFPINLMRWSSNPVALSFPSSLSGLCSLTKLDISDCDLGEGAIPSSIGDLCSLEELHLSGNNFFTLPASIYRLSSLLGIDLKECKMLQNLPRLPASIHWISLNGCVSLETLSDVLNLNEHQLPHLILNCVDCLKLAGNYDLALSLLKEYIKNSEGPWRDFCIVVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLEAYHPGFGWHLFRKQFGQAMSDHLFLYYLKRERISKVEFSSRSGLELKRCGLHPIYVHEGDKFNQTIGPVWNLNEFGHDCSGSTTSSERSFLKRSLEGYVGAAEASGNGCCNDDEEPQPKRFRQLE
cccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccHHHHccccccEEcccccccccccccccccccEEcccccccccccccHHcccccccccccccccccccccccHHHHHHHHHHHHHccccccccEEEEccccccccccccccccccEEEEEccccccccccEEEEEEEEEEEEcccccccccccEEEEEEEEcccEEEEEEEEcccEEEEEEEEEEEEEccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccc
ccccEEEEEccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEccccccccccccHccccccEEEEEccccccccccHHHcccccEEEEcccccccccccHHHcccccccEEEccccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEccccccccccccHcccccEEEccccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccHHHHHHHHcccccccccHHccccccccccEEEEccccccccccccccccccEEEccccccccccccccEEEEcccccccccEEEcccEEEEcccccEEEEEEEcccccccccccccHHHHHEEccccccccEEEEEccccEEEEEEEEcccccccccccccccEEEEEcc
MESLKTLVLSGcsklkkfpdivggMECLQElrvdgtdikelPVSIELMSGLVSlnlkdcrnlttlpitiGNLECLQTLVLSGCSkivkfpetvisVEDLSelfldrtsitevpsSIELLTKLQWlnlndcrslvrlpssingltslktlnlsgcfklenvpETLRQIESLEKldisgtairqpLSSIFLMKNLKelscrgckgspssasWFLRFpinlmrwssnpvalsfpsslsglcsltkldisdcdlgegaipssigdlcsleelhlsgnnfftlPASIYRLSSLLGIDLKECkmlqnlprlpasiHWISLNGCVSLETLSDVLnlnehqlphlILNCVDCLKLAGNYDLALSLLKEYIknsegpwrdfcivvpgseipewfeyqnnegssitistppktyknskleayhpgfgwHLFRKQFGQAMSDHLFLYYLKRERiskvefssrsglelkrcglhpiyvhegdkfnqtigpvwnlnefghdcsgsttssERSFLKRSLEGYvgaaeasgngccnddeepqpkrfrqle
MESLKTLVLsgcsklkkfpdivGGMECLQELRVDGTDIKELPVSIELMSGLVSLNLKDCRNLTTLPITIGNLECLQTLVLSGCSKIVKFPETVISVEDLSELFLDRTSITEVPSSIELLTKLQWLNLNDCRSLVRLPSSINGLTSLKTLNLSGCFKLENVPETLRQIESLEKLDISGTAIRQPLSSIFLMKNLKELSCRGCKGSPSSASWFLRFPINLMRWSSNPVALSFPSSLSGLCSLTKLDISDCDLGEGAIPSSIGDLCSLEELHLSGNNFFTLPASIYRLSSLLGIDLKECKMLQNLPRLPASIHWISLNGCVSLETLSDVLNLNEHQLPHLILNCVDCLKLAGNYDLALSLLKEYIknsegpwrdFCIVVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLEAYHPGFGWHLFRKQFGQAMSDHLFLYYLKRERISKVefssrsglelkrCGLHPIYVHEGDKFNQTIGPVWNLNEFGHDCSGSTTSSERSFLKRSLEGYVGAaeasgngccnddeepqpkrfrqle
MESLKTLVLSGCSKLKKFPDIVGGMECLQELRVDGTDIKELPVSIELMSGLVSLNLKDCRNLTTLPITIGNLECLQTLVLSGCSKIVKFPETVISVEDLSELFLDRTSITEVPSSIELLTKLQWLNLNDCRSLVRLPSSINGLTSLKTLNLSGCFKLENVPETLRQIESLEKLDISGTAIRQPLSSIFLMKNLKELSCRGCKGSPSSASWFLRFPINLMRWSSNPVALSFPSSLSGLCSLTKLDISDCDLGEGAIPSSIGDLCSLEELHLSGNNFFTLPASIYRLSSLLGIDLKECKMLQNLPRLPASIHWISLNGCVSLETLSDVLNLNEHQLPHLILNCVDCLKLAGNYDLALSLLKEYIKNSEGPWRDFCIVVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLEAYHPGFGWHLFRKQFGQAMSDHLFLYYLKRERISKVEFSSRSGLELKRCGLHPIYVHEGDKFNQTIGPVWNLNEFGHDCSGSTTSSERSFLKRSLEGYVGAAEASGNGCCNDDEEPQPKRFRQLE
*****TLVLSGCSKLKKFPDIVGGMECLQELRVDGTDIKELPVSIELMSGLVSLNLKDCRNLTTLPITIGNLECLQTLVLSGCSKIVKFPETVISVEDLSELFLDRTSITEVPSSIELLTKLQWLNLNDCRSLVRLPSSINGLTSLKTLNLSGCFKLENVPETLRQIESLEKLDISGTAIRQPLSSIFLMKNLKELSCRGCKGSPSSASWFLRFPINLMRWSSNPVALSFPSSLSGLCSLTKLDISDCDLGEGAIPSSIGDLCSLEELHLSGNNFFTLPASIYRLSSLLGIDLKECKMLQNLPRLPASIHWISLNGCVSLETLSDVLNLNEHQLPHLILNCVDCLKLAGNYDLALSLLKEYIKNSEGPWRDFCIVVPGSEIPEWFEYQNNE***ITI******YKNSKLEAYHPGFGWHLFRKQFGQAMSDHLFLYYLKRERISKVEFSSRSGLELKRCGLHPIYVHEGDKFNQTIGPVWNLNEFGHDC**********************************************
MESLKTLVLSGCSKLKKFPDIVGGMECLQELRVDGTDIKELPVSIELMSGLVSLNLKDCRNLTTLPITIGNLECLQTLVLSGCSKIVKFPETVISVEDLSELFLDRTSITEVPSSIELLTKLQWLNLNDCRSLVRLPSSINGLTSLKTLNLSGCFKLENVPETLRQIESLEKLDISGTAIRQPLSSIFLMKNLKELSCRGCKGSPSSASWFLRFPINLMRWSSNPVALSFPSSLSGLCSLTKLDISDCDLGEGAIPSSIGDLCSLEELHLSGNNFFTLPASIYRLSSLLGIDLKECKMLQNLPRLPASIHWISLNGCVSLETLSDVLNLNEHQLPHLILNCVDCLKLAGNYD*************EGPWRDFCIVVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLEAYHPGFGWHLFRKQFGQAMSDHLFLYYLKRERISKVEFSSRSGLELKRCGLHPIYVHEG******************************************************************
MESLKTLVLSGCSKLKKFPDIVGGMECLQELRVDGTDIKELPVSIELMSGLVSLNLKDCRNLTTLPITIGNLECLQTLVLSGCSKIVKFPETVISVEDLSELFLDRTSITEVPSSIELLTKLQWLNLNDCRSLVRLPSSINGLTSLKTLNLSGCFKLENVPETLRQIESLEKLDISGTAIRQPLSSIFLMKNLKELSCRGCKGSPSSASWFLRFPINLMRWSSNPVALSFPSSLSGLCSLTKLDISDCDLGEGAIPSSIGDLCSLEELHLSGNNFFTLPASIYRLSSLLGIDLKECKMLQNLPRLPASIHWISLNGCVSLETLSDVLNLNEHQLPHLILNCVDCLKLAGNYDLALSLLKEYIKNSEGPWRDFCIVVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLEAYHPGFGWHLFRKQFGQAMSDHLFLYYLKRERISKVEFSSRSGLELKRCGLHPIYVHEGDKFNQTIGPVWNLNEFGHD************LKRSLEGYVGAAEASGNGCCNDDEEPQPKRFRQLE
*ESLKTLVLSGCSKLKKFPDIVGGMECLQELRVDGTDIKELPVSIELMSGLVSLNLKDCRNLTTLPITIGNLECLQTLVLSGCSKIVKFPETVISVEDLSELFLDRTSITEVPSSIELLTKLQWLNLNDCRSLVRLPSSINGLTSLKTLNLSGCFKLENVPETLRQIESLEKLDISGTAIRQPLSSIFLMKNLKELSCRGCKGSPSSASWFLRFPINLMRWSSNPVALSFPSSLSGLCSLTKLDISDCDLGEGAIPSSIGDLCSLEELHLSGNNFFTLPASIYRLSSLLGIDLKECKMLQNLPRLPASIHWISLNGCVSLETLSDVLNLNEHQLPHLILNCVDCLKLAGNYDLALSLLKEYIKNSEGPWRDFCIVVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLEAYHPGFGWHLFRKQFGQAMSDHLFLYYLKRERISKVEFSSRSGLELKRCGLHPIYVHEGDKFNQTIGPVWNLNEFGHDCSGSTTSSERSFLKRSLEGYVGAAEASGNGCCNDDEEPQPKRFRQL*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESLKTLVLSGCSKLKKFPDIVGGMECLQELRVDGTDIKELPVSIELMSGLVSLNLKDCRNLTTLPITIGNLECLQTLVLSGCSKIVKFPETVISVEDLSELFLDRTSITEVPSSIELLTKLQWLNLNDCRSLVRLPSSINGLTSLKTLNLSGCFKLENVPETLRQIESLEKLDISGTAIRQPLSSIFLMKNLKELSCRGCKGSPSSASWFLRFPINLMRWSSNPVALSFPSSLSGLCSLTKLDISDCDLGEGAIPSSIGDLCSLEELHLSGNNFFTLPASIYRLSSLLGIDLKECKMLQNLPRLPASIHWISLNGCVSLETLSDVLNLNEHQLPHLILNCVDCLKLAGNYDLALSLLKEYIKNSEGPWRDFCIVVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLEAYHPGFGWHLFRKQFGQAMSDHLFLYYLKRERISKVEFSSRSGLELKRCGLHPIYVHEGDKFNQTIGPVWNLNEFGHDCSGSTTSSERSFLKRSLEGYVGAAEASGNGCCNDDEEPQPKRFRQLE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query535 2.2.26 [Sep-21-2011]
Q403921144 TMV resistance protein N N/A no 0.702 0.328 0.315 2e-35
Q9SZ67 1895 Probable WRKY transcripti no no 0.357 0.100 0.390 1e-22
O235301301 Protein SUPPRESSOR OF npr no no 0.476 0.196 0.331 5e-21
Q9RBS2 1024 Protein PopC OS=Ralstonia yes no 0.545 0.285 0.299 1e-19
Q80TH2 1402 Protein LAP2 OS=Mus muscu yes no 0.613 0.233 0.286 1e-17
Q96RT1 1412 Protein LAP2 OS=Homo sapi no no 0.614 0.233 0.279 2e-15
P49606 2493 Adenylate cyclase OS=Usti N/A no 0.555 0.119 0.299 3e-15
P0CB16 1201 Putative disease resistan no no 0.549 0.244 0.276 3e-15
P23799630 Putative adenylate cyclas N/A no 0.581 0.493 0.291 3e-14
Q4R6F0863 Leucine-rich repeat and d N/A no 0.532 0.330 0.26 3e-14
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score =  150 bits (380), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 129/409 (31%), Positives = 210/409 (51%), Gaps = 33/409 (8%)

Query: 3    SLKTLVLSGCSKLKKFPDIVGGMECLQELRV-DGTDIKELPVSIELMSGLVSLNLKDCRN 61
            SL+ + LS   +L + PD  G M  L+ + +   ++++E+  S+   S ++ L L DC++
Sbjct: 620  SLRRIDLSWSKRLTRTPDFTG-MPNLEYVNLYQCSNLEEVHHSLGCCSKVIGLYLNDCKS 678

Query: 62   LTTLPITIGNLECLQTLVLSGCSKIVKFPETVISVEDLSELFLDRTSITEVPSSI-ELLT 120
            L   P    N+E L+ L L  C  + K PE    ++   ++ +  + I E+PSSI +  T
Sbjct: 679  LKRFPCV--NVESLEYLGLRSCDSLEKLPEIYGRMKPEIQIHMQGSGIRELPSSIFQYKT 736

Query: 121  KLQWLNLNDCRSLVRLPSSINGLTSLKTLNLSGCFKLENVPETLRQIESLEKLDISGTAI 180
             +  L L + ++LV LPSSI  L SL +L++SGC KLE++PE +  +++L   D S T I
Sbjct: 737  HVTKLLLWNMKNLVALPSSICRLKSLVSLSVSGCSKLESLPEEIGDLDNLRVFDASDTLI 796

Query: 181  RQPLSSIFLMKNLKELSCRGCKGSPSSASWFLRFPINLMRWSSNPVALSFPSSLSGLCSL 240
             +P SSI  +  L  L  RG K                     + V   FP    GL SL
Sbjct: 797  LRPPSSIIRLNKLIILMFRGFK---------------------DGVHFEFPPVAEGLHSL 835

Query: 241  TKLDISDCDLGEGAIPSSIGDLCSLEELHLSGNNFFTLPASIYRLSSLLGIDLKECKMLQ 300
              L++S C+L +G +P  IG L SL++L LS NNF  LP+SI +L +L  +DLK+C+ L 
Sbjct: 836  EYLNLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGALQSLDLKDCQRLT 895

Query: 301  NLPRLPASIHWISLNGCVSLETLSDVLNLNEHQLPHLILNCV--DCLKLAGNYDL--ALS 356
             LP LP  ++ + ++  ++L+ +   L     +L  + L+    D +     Y +   +S
Sbjct: 896  QLPELPPELNELHVDCHMALKFIH-YLVTKRKKLHRVKLDDAHNDTMYNLFAYTMFQNIS 954

Query: 357  LLKEYIKNSEGPWRDFCIVVPGSE-IPEWFEYQNNEGSSITISTPPKTY 404
             ++  I  S+          P  E IP WF +Q  + SS++++ P   Y
Sbjct: 955  SMRHDISASDSLSLTVFTGQPYPEKIPSWFHHQGWD-SSVSVNLPENWY 1002
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 Back     alignment and function description
>sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 Back     alignment and function description
>sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description
>sp|P23799|ESAG8_TRYBB Putative adenylate cyclase regulatory protein OS=Trypanosoma brucei brucei GN=ESAG8 PE=2 SV=1 Back     alignment and function description
>sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query535
147802475 1244 hypothetical protein VITISV_027841 [Viti 0.757 0.325 0.452 3e-78
224127726 1203 tir-nbs-lrr resistance protein [Populus 0.983 0.437 0.374 7e-75
359493293 1640 PREDICTED: TMV resistance protein N-like 0.871 0.284 0.407 9e-74
147822714 1254 hypothetical protein VITISV_015601 [Viti 0.734 0.313 0.453 1e-73
359495221 1181 PREDICTED: TMV resistance protein N-like 0.734 0.332 0.453 2e-73
451798988 1219 TMV resistance protein N-like protein 6 0.749 0.328 0.423 5e-73
451798990 1335 TMV resistance protein N-like protein 7 0.749 0.300 0.410 2e-71
359486075 1291 PREDICTED: TMV resistance protein N-like 0.764 0.316 0.416 2e-71
359493250 1439 PREDICTED: TMV resistance protein N-like 0.745 0.277 0.431 1e-70
147770134 1414 hypothetical protein VITISV_040107 [Viti 0.764 0.289 0.414 1e-70
>gi|147802475|emb|CAN61853.1| hypothetical protein VITISV_027841 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  299 bits (765), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 192/424 (45%), Positives = 264/424 (62%), Gaps = 19/424 (4%)

Query: 1    MESLKTLVLSGCSKLKKFPDIVGGMECLQELRVDGTDIKELPVSIELMSGLVSLNLKDCR 60
            +E LK L LSGCS LK FP+I G M+ L EL +DGT I ELP SI  ++GL+ L+L++C+
Sbjct: 599  LECLKYLSLSGCSDLKNFPEIQGNMQHLSELYLDGTAISELPFSIGYLTGLILLDLENCK 658

Query: 61   NLTTLPITIGNLECLQTLVLSGCSKIVKFPETVISVEDLSELFLDRTSITEVPSSIELLT 120
             L +LP +I  L+ L+TL+LS CSK+  FPE + ++E L +L LD T++ ++  SIE L 
Sbjct: 659  RLKSLPSSICKLKSLETLILSACSKLESFPEIMENMEHLKKLLLDGTALKQLHPSIEHLN 718

Query: 121  KLQWLNLNDCRSLVRLPSSINGLTSLKTLNLSGCFKLENVPETLRQIESLEKLDISGTAI 180
             L  LNL DC++L  LP SI  L SL+TL +SGC KL+ +PE L  ++ L KL   GT +
Sbjct: 719  GLVSLNLRDCKNLATLPCSIGNLKSLETLIVSGCSKLQQLPENLGSLQCLVKLQADGTLV 778

Query: 181  RQPLSSIFLMKNLKELSCRGCKGSPSSASWFLRFPINLM-RWSSNPVALSFPSSLSGLCS 239
            RQP SSI L++NL+ LS  GCKG  S+ SW   F   L+ R SS+ + L  P SLSGLCS
Sbjct: 779  RQPPSSIVLLRNLEILSFGGCKGLASN-SWSSLFSFWLLPRKSSDTIGLQLP-SLSGLCS 836

Query: 240  LTKLDISDCDLGEGAIPSSIGDLCSLEELHLSGNNFFTLPASIYRLSSLLGIDLKECKML 299
            L +LDISDC+L EGA+P  I +L SLE L+LS NNFF+LPA I +LS L  + L  CK L
Sbjct: 837  LRELDISDCNLMEGAVPFDICNLSSLETLNLSRNNFFSLPAGISKLSKLRFLSLNHCKSL 896

Query: 300  QNLPRLPASIHWISLNGCVSLETL---SDVLNLNEHQLPHLILNCVDCLKLAG----NYD 352
              +P LP+SI  ++   C SL T+   S V N N+     L+    +C  L      + D
Sbjct: 897  LQIPELPSSIIEVNAQYCSSLNTILTPSSVCN-NQPVCRWLVFTLPNCFNLDAENPCSND 955

Query: 353  LA-----LSLLKEYIKNSEG--PWRDFCIVVPGSEIPEWFEYQNNEGSSITISTPPKTYK 405
            +A     + ++   ++  +   P   F I +PGSEIP+W   Q N GS +TI  PP  ++
Sbjct: 956  MAIISPRMQIVTNMLQKLQNFLPDFGFSIFLPGSEIPDWISNQ-NLGSEVTIELPPHWFE 1014

Query: 406  NSKL 409
            ++ L
Sbjct: 1015 SNFL 1018

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224127726|ref|XP_002329162.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870943|gb|EEF08074.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359493293|ref|XP_002273413.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147822714|emb|CAN68293.1| hypothetical protein VITISV_015601 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495221|ref|XP_002274238.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|451798988|gb|AGF69192.1| TMV resistance protein N-like protein 6 [Vitis labrusca] Back     alignment and taxonomy information
>gi|451798990|gb|AGF69193.1| TMV resistance protein N-like protein 7 [Vitis labrusca] Back     alignment and taxonomy information
>gi|359486075|ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493250|ref|XP_002268462.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147770134|emb|CAN76615.1| hypothetical protein VITISV_040107 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query535
TAIR|locus:21759911294 AT5G17680 [Arabidopsis thalian 0.708 0.292 0.340 1.6e-39
TAIR|locus:21634261187 TAO1 "target of AVRB operation 0.710 0.320 0.334 8.2e-39
TAIR|locus:2827629 1355 AT2G17050 [Arabidopsis thalian 0.766 0.302 0.317 3.5e-36
TAIR|locus:22058241384 AT1G27170 [Arabidopsis thalian 0.717 0.277 0.293 1.1e-32
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.693 0.187 0.311 4.7e-32
TAIR|locus:22058041556 AT1G27180 [Arabidopsis thalian 0.717 0.246 0.283 5.5e-30
TAIR|locus:21181061219 AT4G12010 [Arabidopsis thalian 0.659 0.289 0.314 7.1e-29
TAIR|locus:20981451240 AT3G44630 [Arabidopsis thalian 0.6 0.258 0.315 1.2e-27
TAIR|locus:21479921189 AT5G11250 [Arabidopsis thalian 0.616 0.277 0.323 9.5e-26
TAIR|locus:21674571191 AT5G36930 [Arabidopsis thalian 0.551 0.247 0.332 2.1e-25
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 434 (157.8 bits), Expect = 1.6e-39, P = 1.6e-39
 Identities = 138/405 (34%), Positives = 214/405 (52%)

Query:     5 KTLVLSGCSKLKKFPDIVGGMECLQELRV-DGTDIKELPVSIELMSGLVSLNLKDCRNLT 63
             + L LS  +K+++ P  +  + CL +L + D   ++ LP  +  +  L SLNL  CR L 
Sbjct:   719 RRLYLSS-TKIEELPSSISRLSCLVKLDMSDCQRLRTLPSYLGHLVSLKSLNLDGCRRLE 777

Query:    64 TLPITIGNLECLQTLVLSGCSKIVKFPETVISVEDLSELFLDRTSITEVPSSIELLTKLQ 123
              LP T+ NL  L+TL +SGC  + +FP    S+E L    +  TSI E+P+ I  L++L+
Sbjct:   778 NLPDTLQNLTSLETLEVSGCLNVNEFPRVSTSIEVLR---ISETSIEEIPARICNLSQLR 834

Query:   124 WLNLNDCRSLVRLPSSINGLTSLKTLNLSGCFKLENVP-ETLRQIESLEKLDISGTAIRQ 182
              L++++ + L  LP SI+ L SL+ L LSGC  LE+ P E  + +  L   D+  T+I++
Sbjct:   835 SLDISENKRLASLPVSISELRSLEKLKLSGCSVLESFPLEICQTMSCLRWFDLDRTSIKE 894

Query:   183 PLSSIFLMKNLKELSCRGC--KGSPSSASWFLRFPINLMRWSS-NPVAL--SFPSSLSGL 237
                +I  +  L+ L       + +P S +   R  +  +  S   P  L  S    LS  
Sbjct:   895 LPENIGNLVALEVLQASRTVIRRAPWSIARLTRLQVLAIGNSFFTPEGLLHSLCPPLSRF 954

Query:   238 CSLTKLDISDCDLGEGAIPSSIGDLCSLEELHLSGNNFFTLPASIYRLSSLLGIDLKECK 297
               L  L +S+ ++ E  IP+SIG+L +L EL LSGNNF  +PASI RL+ L  ++L  C+
Sbjct:   955 DDLRALSLSNMNMTE--IPNSIGNLWNLLELDLSGNNFEFIPASIKRLTRLNRLNLNNCQ 1012

Query:   298 MLQNLP-RLPASIHWISLNGCVSLETLSDVLNLNEHQLPHLILNCVDCLKLAGNYDLALS 356
              LQ LP  LP  + +I ++ C SL ++S   N  ++ L  L+ +  +C KL      A  
Sbjct:  1013 RLQALPDELPRGLLYIYIHSCTSLVSISGCFN--QYCLRKLVAS--NCYKLD---QAAQI 1065

Query:   357 LLKEYIK-NSEGPWRDFCIVVPGSEIPEWFEYQNNEGSSITISTP 400
             L+   +K  S  P   +    PGS+IP  F +Q   G S+ I  P
Sbjct:  1066 LIHRNLKLESAKPEHSY---FPGSDIPTCFNHQVM-GPSLNIQLP 1106
GO:0005622 "intracellular" evidence=IEA
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827629 AT2G17050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098145 AT3G44630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167457 AT5G36930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.01250006
tir-nbs-lrr resistance protein (1203 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query535
PLN032101153 PLN03210, PLN03210, Resistant to P 8e-20
PLN032101153 PLN03210, PLN03210, Resistant to P 8e-16
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-11
PLN032101153 PLN03210, PLN03210, Resistant to P 8e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-05
PRK15386426 PRK15386, PRK15386, type III secretion protein Gog 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 93.4 bits (232), Expect = 8e-20
 Identities = 88/283 (31%), Positives = 129/283 (45%), Gaps = 53/283 (18%)

Query: 1   MESLKTLVLSGCSKLKKFPDIVGGMECLQELRVDGTDIKELPVSIELMSGLVSLNLKDCR 60
           ++SL  L LSGCS+LK FPDI      +  L +D T I+E P ++ L   L  L L + +
Sbjct: 703 LKSLYRLNLSGCSRLKSFPDISTN---ISWLDLDETAIEEFPSNLRL-ENLDELILCEMK 758

Query: 61  NLTTLPITIGNLECLQTLVLSGCSKIVKFPETVISVEDLSELFL-DRTSITEVPSSIELL 119
           +   L   +  L  L T++            +      L+ LFL D  S+ E+PSSI+ L
Sbjct: 759 S-EKLWERVQPLTPLMTML----------SPS------LTRLFLSDIPSLVELPSSIQNL 801

Query: 120 TKLQWLNLNDCRSLVRLPSSINGLTSLKTLNLSGCFKLENVPETLRQIESLEKLDISGTA 179
            KL+ L + +C +L  LP+ IN L SL++L+LSGC +L   P+    I     L++S T 
Sbjct: 802 HKLEHLEIENCINLETLPTGIN-LESLESLDLSGCSRLRTFPDISTNISD---LNLSRTG 857

Query: 180 IRQPLSSIFLMKNLKELSCRGCKGSPSSASWFLRFPINLMRWSSNPVALSFPSSLSGLCS 239
           I +    I    NL  L   GC               NL R S N         +S L  
Sbjct: 858 IEEVPWWIEKFSNLSFLDMNGCN--------------NLQRVSLN---------ISKLKH 894

Query: 240 LTKLDISDCDLGEGAIPSSIGDLCSLEELHLSGNNFFTLPASI 282
           L  +D SDC    GA+  +  +    E    + N    LP+++
Sbjct: 895 LETVDFSDC----GALTEASWNGSPSEVAMATDNIHSKLPSTV 933

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 535
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
PLN032101153 Resistant to P. syringae 6; Provisional 99.91
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.9
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.89
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.88
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.85
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.82
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.8
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.79
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.7
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.7
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.6
KOG0617264 consensus Ras suppressor protein (contains leucine 99.58
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.53
KOG4237498 consensus Extracellular matrix protein slit, conta 99.44
KOG4237498 consensus Extracellular matrix protein slit, conta 99.38
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.32
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.25
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.16
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.12
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.1
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.09
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.03
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.98
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.96
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.92
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.83
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.78
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.73
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.72
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.71
KOG4341483 consensus F-box protein containing LRR [General fu 98.6
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.58
PRK15386426 type III secretion protein GogB; Provisional 98.57
KOG4341483 consensus F-box protein containing LRR [General fu 98.55
PRK15386426 type III secretion protein GogB; Provisional 98.53
PLN03150623 hypothetical protein; Provisional 98.51
PLN03150623 hypothetical protein; Provisional 98.5
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.27
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.26
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.22
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.21
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.16
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.15
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.93
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.81
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.72
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.61
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.6
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.59
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.45
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.35
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.34
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.33
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.2
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.12
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.07
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.48
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.28
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.88
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.38
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.89
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.76
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.72
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.18
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.84
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.41
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.33
smart0037026 LRR Leucine-rich repeats, outliers. 89.03
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.03
KOG4308478 consensus LRR-containing protein [Function unknown 87.04
KOG4308478 consensus LRR-containing protein [Function unknown 85.66
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.71
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.34
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 82.62
smart0037026 LRR Leucine-rich repeats, outliers. 82.62
KOG0473326 consensus Leucine-rich repeat protein [Function un 82.14
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=100.00  E-value=9.5e-38  Score=362.90  Aligned_cols=447  Identities=24%  Similarity=0.329  Sum_probs=289.0

Q ss_pred             CCCCcEEecCCCcC------CCCCCcccCCC-CcCcEEEeeccCCcccchhhhcCCCccEEeccCCCCCCccCcccCCCC
Q 041071            1 MESLKTLVLSGCSK------LKKFPDIVGGM-ECLQELRVDGTDIKELPVSIELMSGLVSLNLKDCRNLTTLPITIGNLE   73 (535)
Q Consensus         1 L~~L~~L~Ls~~~~------l~~lp~~~~~~-~~L~~L~L~~~~l~~l~~~i~~l~~L~~L~Ls~~~~l~~lp~~l~~l~   73 (535)
                      |++|++|.+..+..      ...+|..+..+ .+|+.|.+.++.++.+|..+ .+.+|+.|+++++. +..+|..+..++
T Consensus       557 m~~L~~L~~~~~~~~~~~~~~~~lp~~~~~lp~~Lr~L~~~~~~l~~lP~~f-~~~~L~~L~L~~s~-l~~L~~~~~~l~  634 (1153)
T PLN03210        557 MRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNF-RPENLVKLQMQGSK-LEKLWDGVHSLT  634 (1153)
T ss_pred             CccccEEEEecccccccccceeecCcchhhcCcccEEEEecCCCCCCCCCcC-CccCCcEEECcCcc-ccccccccccCC
Confidence            56778887765421      12345444343 45788888887777787766 46778888887754 556776677778


Q ss_pred             CCCEEeccCCCCCccCcccccCCCCCceeecccc-cCcccCccccCCCCCCEeccccCcCCCccCccccCCCCCceeecc
Q 041071           74 CLQTLVLSGCSKIVKFPETVISVEDLSELFLDRT-SITEVPSSIELLTKLQWLNLNDCRSLVRLPSSINGLTSLKTLNLS  152 (535)
Q Consensus        74 ~L~~L~Ls~c~~l~~~p~~l~~l~~L~~L~L~~~-~i~~lp~~i~~l~~L~~L~L~~c~~l~~lp~~i~~l~~L~~L~Ls  152 (535)
                      +|+.|+|++|..+..+|. +..+++|++|++++| .+..+|.+++.+++|+.|++++|..+..+|..+ ++++|+.|+++
T Consensus       635 ~Lk~L~Ls~~~~l~~ip~-ls~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~i-~l~sL~~L~Ls  712 (1153)
T PLN03210        635 GLRNIDLRGSKNLKEIPD-LSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLS  712 (1153)
T ss_pred             CCCEEECCCCCCcCcCCc-cccCCcccEEEecCCCCccccchhhhccCCCCEEeCCCCCCcCccCCcC-CCCCCCEEeCC
Confidence            888888887777777764 666778888888775 456777778888888888888887777777655 57788888888


Q ss_pred             CccCCCCchhhhhccccccEEEecCccccCCCcccccCCCCcEEEcCCCCCCCCCC--------ccccccccccccccCC
Q 041071          153 GCFKLENVPETLRQIESLEKLDISGTAIRQPLSSIFLMKNLKELSCRGCKGSPSSA--------SWFLRFPINLMRWSSN  224 (535)
Q Consensus       153 ~c~~l~~lp~~l~~l~~L~~L~L~~~~i~~~~~~i~~l~~L~~L~L~~~~~~~~~~--------~~~~~~~l~~l~l~~n  224 (535)
                      +|..+..+|..   ..+|+.|++++|.+..+|..+ .+++|+.|.+.++.......        .......++.+++++|
T Consensus       713 gc~~L~~~p~~---~~nL~~L~L~~n~i~~lP~~~-~l~~L~~L~l~~~~~~~l~~~~~~l~~~~~~~~~sL~~L~Ls~n  788 (1153)
T PLN03210        713 GCSRLKSFPDI---STNISWLDLDETAIEEFPSNL-RLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDI  788 (1153)
T ss_pred             CCCCccccccc---cCCcCeeecCCCccccccccc-cccccccccccccchhhccccccccchhhhhccccchheeCCCC
Confidence            88777777653   356777788888777776554 45566666655543211100        0011123455555555


Q ss_pred             CcccccCCcccCCCCCCEEecCCCCCCCCCCCCCC--------------------CCCCCCCEEeCCCCcCCCCChhhcC
Q 041071          225 PVALSFPSSLSGLCSLTKLDISDCDLGEGAIPSSI--------------------GDLCSLEELHLSGNNFFTLPASIYR  284 (535)
Q Consensus       225 ~~~~~lp~~l~~l~~L~~L~Ls~~~l~~~~lp~~l--------------------~~l~~L~~L~Ls~n~l~~lp~~i~~  284 (535)
                      .....+|.++.++++|+.|+|++|.... .+|..+                    ....+|+.|+|++|.+..+|.++..
T Consensus       789 ~~l~~lP~si~~L~~L~~L~Ls~C~~L~-~LP~~~~L~sL~~L~Ls~c~~L~~~p~~~~nL~~L~Ls~n~i~~iP~si~~  867 (1153)
T PLN03210        789 PSLVELPSSIQNLHKLEHLEIENCINLE-TLPTGINLESLESLDLSGCSRLRTFPDISTNISDLNLSRTGIEEVPWWIEK  867 (1153)
T ss_pred             CCccccChhhhCCCCCCEEECCCCCCcC-eeCCCCCccccCEEECCCCCccccccccccccCEeECCCCCCccChHHHhc
Confidence            5555555555555556666655553211 133221                    1134678888888888999999999


Q ss_pred             CCCCcEEeccCCcccccCCCCC---CCcceEeccCccccccccccccccc---------ccC---CCceeeccCchhhcc
Q 041071          285 LSSLLGIDLKECKMLQNLPRLP---ASIHWISLNGCVSLETLSDVLNLNE---------HQL---PHLILNCVDCLKLAG  349 (535)
Q Consensus       285 l~~L~~L~L~~c~~L~~lp~lp---~sL~~L~~~~C~sL~~l~~~~n~~~---------~~~---~~l~~~c~nC~kL~~  349 (535)
                      +++|+.|++++|+.++.+|..+   ++|+.+++.+|.+|+.++....+..         ..+   ..+.|.  ||++|++
T Consensus       868 l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~~~~l~~~~~~~~~~~~n~~~~~p~~~~l~f~--nC~~L~~  945 (1153)
T PLN03210        868 FSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFI--NCFNLDQ  945 (1153)
T ss_pred             CCCCCEEECCCCCCcCccCcccccccCCCeeecCCCcccccccCCCCchhhhhhcccccccCCchhccccc--cccCCCc
Confidence            9999999999999999998644   4677889999999998765332110         111   123455  9999974


Q ss_pred             chhHHHHHHHHHhhcCCCCCcceEEEccCCCCCcccccccCCCceEE-EeCCCCCCCCCceE-E---e-c----C-C---
Q 041071          350 NYDLALSLLKEYIKNSEGPWRDFCIVVPGSEIPEWFEYQNNEGSSIT-ISTPPKTYKNSKLE-A---Y-H----P-G---  415 (535)
Q Consensus       350 ~~~~~~~~~~~~~~~~~~~~~~~~~~~pg~~iP~wf~~~~~~g~si~-~~lp~~~~~~~~~g-a---~-~----~-~---  415 (535)
                      ..         .+..+..   ...+++||.+||+||.||+ .|++++ |++|+.|+...|.| +   + .    + .   
T Consensus       946 ~a---------~l~~~~~---~~~~~l~g~evp~~f~hr~-~g~sl~~i~l~~~~~~~~~~~f~~c~v~~~~~~~~~~~~ 1012 (1153)
T PLN03210        946 EA---------LLQQQSI---FKQLILSGEEVPSYFTHRT-TGASLTNIPLLHISPCQPFFRFRACAVVDSESFFIISVS 1012 (1153)
T ss_pred             hh---------hhccccc---ceEEECCCccCchhccCCc-ccceeeeeccCCcccCCCccceEEEEEEecCccccCCCc
Confidence            22         1111111   1357899999999999999 899998 99999998776776 3   2 1    1 1   


Q ss_pred             --CceEEEEec-cC----CCCCCeEEEEEEecCCcc----------------c-----c--ceeecC-C-C-ceeeeece
Q 041071          416 --FGWHLFRKQ-FG----QAMSDHLFLYYLKRERIS----------------K-----V--EFSSRS-G-L-ELKRCGLH  462 (535)
Q Consensus       416 --~~~~~~~~~-~~----~~~~dh~~~~~~~~~~~~----------------~-----~--~f~~~~-~-~-~vk~cG~~  462 (535)
                        +.|.+.... .+    ....+|+|+.|....++.                +     .  +|.+.. . . +||+||||
T Consensus      1013 ~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~cg~~ 1092 (1153)
T PLN03210       1013 FDIQVCCRFIDRLGNHFDSPYQPHVFSVTKKGSHLVIFDCCFPLNEDNAPLAELNYDHVDIQFRLTNKNSQLKLKGCGIR 1092 (1153)
T ss_pred             eeEEEEEEEECCCCCccccCCCceeEeeeccccceEEecccccccccccchhccCCceeeEEEEEecCCCCeEEEeeeEE
Confidence              122222111 11    246678888776643211                0     0  232211 1 2 79999999


Q ss_pred             EeeecccCc
Q 041071          463 PIYVHEGDK  471 (535)
Q Consensus       463 ~v~~~~~~~  471 (535)
                      ++|..+..+
T Consensus      1093 ~~~~~~~~~ 1101 (1153)
T PLN03210       1093 LSEDDSSLN 1101 (1153)
T ss_pred             EeccCCCcc
Confidence            999766443

syringae 6; Provisional
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query535
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 1e-12
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 5e-11
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-06
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-06
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 4e-06
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 2e-05
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 2e-05
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 5e-04
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 86/196 (43%), Gaps = 35/196 (17%)
Query: 15  LKKFPDIVGGMECLQELRVDGTDIKELPVSIELMSGLVSLNLKDCRN-LTTLPITIGNLE 73
           L +FPD    +  LQ   +D   + ELP + +  +GL +L L   RN L  LP +I +L 
Sbjct: 93  LPQFPDQAFRLSHLQHXTIDAAGLXELPDTXQQFAGLETLTL--ARNPLRALPASIASLN 150
Query: 74  CLQTLVLSGCSKIVKFPETVISVE---------DLSELFLDRTSITEVPSSI-------- 116
            L+ L +  C ++ + PE + S +         +L  L L+ T I  +P+SI        
Sbjct: 151 RLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKS 210
Query: 117 ---------------ELLTKLQWLNLNDCRSLVRLPSSINGLTSLKTLNLSGCFKLENVP 161
                            L KL+ L+L  C +L   P    G   LK L L  C  L  +P
Sbjct: 211 LKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLP 270
Query: 162 ETLRQIESLEKLDISG 177
             + ++  LEKLD+ G
Sbjct: 271 LDIHRLTQLEKLDLRG 286
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query535
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-55
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-40
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-37
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-32
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-31
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-19
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-29
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-29
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-29
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-21
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-13
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-25
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-24
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-24
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-08
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-20
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-18
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-16
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-12
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-20
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-18
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-20
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-20
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-20
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-13
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-18
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-17
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-11
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-09
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 9e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-09
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 4e-06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 5e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  188 bits (480), Expect = 2e-55
 Identities = 68/347 (19%), Positives = 121/347 (34%), Gaps = 51/347 (14%)

Query: 3   SLKTLVLSGCSKLKKFPDIVGGMECLQELRVDGTDIKELPVSIELMSGLVSLNLKDCRNL 62
             + L   G + L+ + D++   +       +         +    S    +  +  R L
Sbjct: 13  GRENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQAN----SNNPQIETRTGRAL 68

Query: 63  TTLPITIGNL--ECLQTLVLSGCSKIVKFPETVISVEDLSELFLDRTSITEVPSSIELLT 120
                 + +        L L     + +FP+    +  L  + +D   + E+P +++   
Sbjct: 69  KATADLLEDATQPGRVALELRSV-PLPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQFA 127

Query: 121 KLQWLNLNDCRSLVRLPSSINGLTSLKTLNLSGCFKLENVPETLRQIE---------SLE 171
            L+ L L     L  LP+SI  L  L+ L++  C +L  +PE L   +         +L+
Sbjct: 128 GLETLTLARN-PLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQ 186

Query: 172 KLDISGTAIRQPLSSIFLMKNLKELSCRGCKGSPSSASWFLRFPINLMRWSSNPVALSFP 231
            L +  T IR   +SI  ++NLK L  R            L                +  
Sbjct: 187 SLRLEWTGIRSLPASIANLQNLKSLKIRNSP---------LS---------------ALG 222

Query: 232 SSLSGLCSLTKLDISDCDLGEGAIPSSIGDLCSLEELHLSGNNFFT-LPASIYRLSSLLG 290
            ++  L  L +LD+  C       P   G    L+ L L   +    LP  I+RL+ L  
Sbjct: 223 PAIHHLPKLEELDLRGCTALRN-YPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEK 281

Query: 291 IDLKECKMLQNLPRLPASIHWISLNGCVSLETLSDVLNLNEHQLPHL 337
           +DL+ C  L  LP          +    +   +    +L      H 
Sbjct: 282 LDLRGCVNLSRLPS--------LIAQLPANCIILVPPHLQAQLDQHR 320
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query535
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.98
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.97
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.96
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.96
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.94
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.93
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.91
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.91
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.9
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.9
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.9
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.89
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.89
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.88
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.88
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.88
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.87
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.86
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.85
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.84
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.83
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.82
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.82
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.82
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.82
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.82
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.82
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.81
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.81
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.81
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.8
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.8
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.8
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.8
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.8
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.79
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.79
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.78
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.76
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.76
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.75
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.75
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.74
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.74
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.72
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.71
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.7
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.7
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.65
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.65
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.65
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.64
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.64
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.64
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.61
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.61
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.61
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.6
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.59
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.58
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.58
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.58
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.58
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.57
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.57
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.53
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.48
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.45
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.4
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.4
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.39
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.37
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.37
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.33
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.31
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.29
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.28
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.28
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.27
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.2
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.12
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.11
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.03
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.03
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.02
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.88
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.88
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.77
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.77
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.76
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.63
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.61
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.6
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.56
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.38
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.35
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.9
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.9
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.76
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.7
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.63
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.4
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.38
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.33
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.88
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.47
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=8.8e-33  Score=310.67  Aligned_cols=317  Identities=22%  Similarity=0.216  Sum_probs=197.2

Q ss_pred             CCCCcEEecCCCcCCCCCCcc-cCCCCcCcEEEeeccCCc-ccchhhhcCC-CccEEeccCCCCC---------------
Q 041071            1 MESLKTLVLSGCSKLKKFPDI-VGGMECLQELRVDGTDIK-ELPVSIELMS-GLVSLNLKDCRNL---------------   62 (535)
Q Consensus         1 L~~L~~L~Ls~~~~l~~lp~~-~~~~~~L~~L~L~~~~l~-~l~~~i~~l~-~L~~L~Ls~~~~l---------------   62 (535)
                      +++|++|+|++|...+.+|.. ++.+++|++|++++|.+. .+|..+..+. +|++|++++|...               
T Consensus       317 l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L  396 (768)
T 3rgz_A          317 CSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTL  396 (768)
T ss_dssp             CTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCC
T ss_pred             CCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCc
Confidence            467778888877666566643 667777777777777776 6666665554 5555555555433               


Q ss_pred             -----------CccCcccCCCCCCCEEeccCCCCCccCcccccCCCCCceeecccccCc-ccCccccCCCCCCEeccccC
Q 041071           63 -----------TTLPITIGNLECLQTLVLSGCSKIVKFPETVISVEDLSELFLDRTSIT-EVPSSIELLTKLQWLNLNDC  130 (535)
Q Consensus        63 -----------~~lp~~l~~l~~L~~L~Ls~c~~l~~~p~~l~~l~~L~~L~L~~~~i~-~lp~~i~~l~~L~~L~L~~c  130 (535)
                                 ..+|..++++++|++|++++|...+.+|..++.+++|++|++++|.+. .+|..++.+++|+.|++++|
T Consensus       397 ~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N  476 (768)
T 3rgz_A          397 QELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN  476 (768)
T ss_dssp             CEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSS
T ss_pred             cEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCC
Confidence                       344555555555555555555544455555555666666666666555 45555666666666666666


Q ss_pred             cCCCccCccccCCCCCceeeccCccCCCCchhhhhccccccEEEecCcccc-CCCcccccCCCCcEEEcCCCCCCCCCCc
Q 041071          131 RSLVRLPSSINGLTSLKTLNLSGCFKLENVPETLRQIESLEKLDISGTAIR-QPLSSIFLMKNLKELSCRGCKGSPSSAS  209 (535)
Q Consensus       131 ~~l~~lp~~i~~l~~L~~L~Ls~c~~l~~lp~~l~~l~~L~~L~L~~~~i~-~~~~~i~~l~~L~~L~L~~~~~~~~~~~  209 (535)
                      ...+.+|..+.++++|++|++++|...+.+|.+++.+++|+.|++++|.+. .+|..+..+++|+.|++++|......+.
T Consensus       477 ~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~  556 (768)
T 3rgz_A          477 DLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPA  556 (768)
T ss_dssp             CCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCG
T ss_pred             cccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCCh
Confidence            555556666666666666666666555566666666666666666666665 4555666666666666666654322221


Q ss_pred             ccccc-----------------------------------------------ccccccccCCCcccccCCcccCCCCCCE
Q 041071          210 WFLRF-----------------------------------------------PINLMRWSSNPVALSFPSSLSGLCSLTK  242 (535)
Q Consensus       210 ~~~~~-----------------------------------------------~l~~l~l~~n~~~~~lp~~l~~l~~L~~  242 (535)
                      .....                                               ....+++..+.+.+..|..+..+++|+.
T Consensus       557 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~  636 (768)
T 3rgz_A          557 AMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMF  636 (768)
T ss_dssp             GGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCE
T ss_pred             HHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccE
Confidence            11100                                               0001122223444445555666777888


Q ss_pred             EecCCCCCCCCCCCCCCCCCCCCCEEeCCCCcCC-CCChhhcCCCCCcEEeccCCcccccCCCC---CCCcceEeccCcc
Q 041071          243 LDISDCDLGEGAIPSSIGDLCSLEELHLSGNNFF-TLPASIYRLSSLLGIDLKECKMLQNLPRL---PASIHWISLNGCV  318 (535)
Q Consensus       243 L~Ls~~~l~~~~lp~~l~~l~~L~~L~Ls~n~l~-~lp~~i~~l~~L~~L~L~~c~~L~~lp~l---p~sL~~L~~~~C~  318 (535)
                      |+|++|+++ +.+|..++.+++|+.|+|++|.+. .+|..++.+++|+.|+|++|+..+.+|..   .++|+.|+++++.
T Consensus       637 LdLs~N~l~-g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~  715 (768)
T 3rgz_A          637 LDMSYNMLS-GYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNN  715 (768)
T ss_dssp             EECCSSCCB-SCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSE
T ss_pred             EECcCCccc-ccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCc
Confidence            888888874 567888888888888888888887 77888888888888888888877777752   2456666666654
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 535
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 68.9 bits (167), Expect = 2e-13
 Identities = 49/286 (17%), Positives = 104/286 (36%), Gaps = 13/286 (4%)

Query: 43  VSIELMSGLVSLNLKDCRNLTTLPITIGNLECLQTLVLSGCSKIVKFPETVISVEDLSEL 102
           V  +L      L+L++ +          NL+ L TL+L         P     +  L  L
Sbjct: 25  VPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERL 84

Query: 103 FLDRTSITEVPSSIELLTKLQWLNLNDCRSLVRLPSSINGLTSLKTLNLSGCFKLENVPE 162
           +L +  + E+P  +    +   ++ N+   + +   +      +  L  +          
Sbjct: 85  YLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENG 144

Query: 163 TLRQIESLEKLDISGTAIRQPLSSIFLMKNLKELSCRGCKGSPSSASWFLR-FPINLMRW 221
             + ++ L  + I+ T I      +    +L EL   G K +   A+       +  +  
Sbjct: 145 AFQGMKKLSYIRIADTNITTIPQGLP--PSLTELHLDGNKITKVDAASLKGLNNLAKLGL 202

Query: 222 SSNPVALSFPSSLSGLCSLTKLDISDCDLGEGAIPSSIGDLCSLEELHLSGNNF------ 275
           S N ++     SL+    L +L +++  L +  +P  + D   ++ ++L  NN       
Sbjct: 203 SFNSISAVDNGSLANTPHLRELHLNNNKLVK--VPGGLADHKYIQVVYLHNNNISAIGSN 260

Query: 276 -FTLPASIYRLSSLLGIDLKECKMLQNLPRLPASIHWISLNGCVSL 320
            F  P    + +S  G+ L     +Q     P++   + +   V L
Sbjct: 261 DFCPPGYNTKKASYSGVSLFSNP-VQYWEIQPSTFRCVYVRAAVQL 305
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query535
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.92
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.91
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.88
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.88
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.88
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.83
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.81
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.81
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.8
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.78
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.55
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.44
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.39
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.34
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.34
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.34
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.31
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.31
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.26
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.23
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.17
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.08
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.05
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.9
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.79
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.73
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.56
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.17
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.17
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.57
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.4
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.92  E-value=4.9e-25  Score=218.60  Aligned_cols=251  Identities=18%  Similarity=0.227  Sum_probs=197.5

Q ss_pred             CcCcEEEeeccCCc---ccchhhhcCCCccEEeccCC-CCCCccCcccCCCCCCCEEeccCCCCCccCcccccCCCCCce
Q 041071           26 ECLQELRVDGTDIK---ELPVSIELMSGLVSLNLKDC-RNLTTLPITIGNLECLQTLVLSGCSKIVKFPETVISVEDLSE  101 (535)
Q Consensus        26 ~~L~~L~L~~~~l~---~l~~~i~~l~~L~~L~Ls~~-~~l~~lp~~l~~l~~L~~L~Ls~c~~l~~~p~~l~~l~~L~~  101 (535)
                      .+++.|+|+++.+.   .+|..++++++|++|+|++| .....+|..|+++++|++|+|++|......+..+..+.+|++
T Consensus        50 ~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~  129 (313)
T d1ogqa_          50 YRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVT  129 (313)
T ss_dssp             CCEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCE
T ss_pred             EEEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcc
Confidence            46888999997776   68889999999999999874 445578888999999999999998877778888888999999


Q ss_pred             eecccccCc-ccCccccCCCCCCEeccccCcCCCccCccccCCCCC-ceeeccCccCCCCchhhhhccccccEEEecCcc
Q 041071          102 LFLDRTSIT-EVPSSIELLTKLQWLNLNDCRSLVRLPSSINGLTSL-KTLNLSGCFKLENVPETLRQIESLEKLDISGTA  179 (535)
Q Consensus       102 L~L~~~~i~-~lp~~i~~l~~L~~L~L~~c~~l~~lp~~i~~l~~L-~~L~Ls~c~~l~~lp~~l~~l~~L~~L~L~~~~  179 (535)
                      ++++.|.+. .+|..++.++.|+.+++++|...+.+|..+..+..+ +.+++++|......|..+..+..+ .+++..+.
T Consensus       130 l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~  208 (313)
T d1ogqa_         130 LDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNM  208 (313)
T ss_dssp             EECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSE
T ss_pred             cccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccc-cccccccc
Confidence            999988776 678889999999999999988888888888887776 778888886666677777776554 68888776


Q ss_pred             cc-CCCcccccCCCCcEEEcCCCCCCCCCCccccccccccccccCCCcccccCCcccCCCCCCEEecCCCCCCCCCCCCC
Q 041071          180 IR-QPLSSIFLMKNLKELSCRGCKGSPSSASWFLRFPINLMRWSSNPVALSFPSSLSGLCSLTKLDISDCDLGEGAIPSS  258 (535)
Q Consensus       180 i~-~~~~~i~~l~~L~~L~L~~~~~~~~~~~~~~~~~l~~l~l~~n~~~~~lp~~l~~l~~L~~L~Ls~~~l~~~~lp~~  258 (535)
                      .. .++..+..+++|+.+++.++....                       .++ .+..+++|+.|+|++|+++ +.+|..
T Consensus       209 ~~~~~~~~~~~~~~l~~l~~~~~~l~~-----------------------~~~-~~~~~~~L~~L~Ls~N~l~-g~iP~~  263 (313)
T d1ogqa_         209 LEGDASVLFGSDKNTQKIHLAKNSLAF-----------------------DLG-KVGLSKNLNGLDLRNNRIY-GTLPQG  263 (313)
T ss_dssp             EEECCGGGCCTTSCCSEEECCSSEECC-----------------------BGG-GCCCCTTCCEEECCSSCCE-ECCCGG
T ss_pred             ccccccccccccccccccccccccccc-----------------------ccc-ccccccccccccCccCeec-ccCChH
Confidence            66 455666677888888877765431                       222 3666778888888888884 458888


Q ss_pred             CCCCCCCCEEeCCCCcCC-CCChhhcCCCCCcEEeccCCcccccCC
Q 041071          259 IGDLCSLEELHLSGNNFF-TLPASIYRLSSLLGIDLKECKMLQNLP  303 (535)
Q Consensus       259 l~~l~~L~~L~Ls~n~l~-~lp~~i~~l~~L~~L~L~~c~~L~~lp  303 (535)
                      ++.+++|++|+|++|+++ .+| .++.+++|+.+++++|+.+...|
T Consensus       264 l~~L~~L~~L~Ls~N~l~g~iP-~~~~L~~L~~l~l~~N~~l~g~p  308 (313)
T d1ogqa_         264 LTQLKFLHSLNVSFNNLCGEIP-QGGNLQRFDVSAYANNKCLCGSP  308 (313)
T ss_dssp             GGGCTTCCEEECCSSEEEEECC-CSTTGGGSCGGGTCSSSEEESTT
T ss_pred             HhCCCCCCEEECcCCcccccCC-CcccCCCCCHHHhCCCccccCCC
Confidence            888888888888888888 677 45778888888888888776544
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure