Citrus Sinensis ID: 041089

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710---
MTFLFLLNSHSCFADSNEMDRLALLAIKSQLQDPLGVTKSWNNSINLCQWTGVTCGHRHQRVTELDLESQNIGGFLSPYIGNLSFLRVINLANNRFHGQIPKEVGRLFRLETIVLSNNSFSGKIPTNLSRCFNLIDFWVHTNNLVGEIQAIIGNWLKLERLSLYDNQLTGQLRPSIGNLSALQTFDIAGNKLDGRIPDSLGQLRNLNYLGTSENDFSGMFPLSVCNISSLDEAYLFKNRFKGSLPVCLGFNLPKLTVLVVAQNNLTGFLPQSLSNASKLEWLELNENHFSGQVRINFNSLPNLSKLYLGRNNLGTRTSTDLDFITLLTNCSKLVKLGLVFNRFGGALPHSIANLSTTMTLIAMAGNQISGTIPPEIRNLFNLNGLGLEYNQLTGTIPPAIGELRNLQYLGLVGNNIRGIIPDSIGNLTLLNILQLGFNKLQGSIPSYLGKCQNLMQLSAPNNQLNGTLPPQIFGITPLSKLLDLSENHFSGSIPLEVGNLKSLVQLDISRNHFSNEIPVTLSACTTLEYLLMQGNSFNGSIPQSLNALKSIKELDLSCNNLSGQIPIHLQDLPFLEYLNLSYNHFEGEVPKKGVFSNETRISLTGNEQLCGGLGELHLPACHSVGRRKETITLLKVVIPVIGLVLILLMCFIVVYTRRTKLAHKLSSALLMEQQFPIVSYAELSKATKEFSSSNRIGKGSFGFVYKGNLGEGG
cEEEEHHHHHHHcccccHHHHHHHHHHHHcccccccccccccccccccccEEEEEccccccEEEEEccccccEEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEccccccEEcccccccccccccEEEEEccccEEcccHHHHccccccccccccccccccccHHHHccccccEEEccccccccccccccccccccccEEccccccEEcccHHHHcccccccEEEcccccccccccHHHHHHccccEEccccccccccccccccccccccEEEcccccccccccccccccccccccccccEEEcccccccccccHHHHHcccccccEEccccEEEEcccccccccccccEEEccccEEEEcccccccccccccEEEccccccEEcccHHHHcccccccEEccccEEcccccccccccccccccccccccccccccHHHHcccccHHHHccccccccccccHHHHcccccccEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHccccccccHHHHHHHHcccccccEEccccccEEEEEEccccc
cEEEEEEHHHHHccccccHHHHHHHHHHHHccccccccccccccccccccEEEEEcccccEEEEEEcccccccEcccHHHHHHHHHHEEEcccccccccccHHHHHHHHHEEEEccccccccccccccccccccEEEEEccccccccccHHHccccccEEEEEccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccccEEEccccEEEEEccHHHHHcccccEEEcccccccccccccHccccccEEEEEccccccccccccHHHHHHHccccccEEEEEccccccccccccHccccccccEEEEEEEccEEEccHHHHHcccccEEEcccccEEccccHHHHHcccccEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHccccccEEEccccEEEEEccHHHHHcccccEEEccccccccccccccccccEEEEEEcccccccccccHHHHHcccccEEEcccccccccccHHHHHHHHHHHEcccccccccccccccEEEcccEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHcccccccHHHHHHHHccccHHHccccccccEEEEEEccccc
MTFLFLlnshscfadsneMDRLALLAIKSQlqdplgvtkswnnsinlcqwtgvtcghrhqrvteldlesqniggflspyignLSFLRVINLAnnrfhgqipkevgRLFRLETIVlsnnsfsgkiptnlsrcFNLIDFWVHTNNLVGEIQAIIGNWLKLerlslydnqltgqlrpsignlsalqtfdiagnkldgripdslgqlrnlnylgtsendfsgmfplsvcnissldeAYLFknrfkgslpvclgfnlpKLTVLVVAQNnltgflpqslsnasklEWLELnenhfsgqvrinfnslpnlsklylgrnnlgtrtstdlDFITLLTNCSKLVKLGLVFnrfggalphsiANLSTTMTLIAMAgnqisgtippeirnlfnlnglgleynqltgtippaigelrnlqylglvgnnirgiipdsignLTLLNILQLGFNklqgsipsylgkcqnlmqlsapnnqlngtlppqifgitplsklldlsenhfsgsiplevgnlksLVQLDisrnhfsneipvtlsaCTTLEYLLMQgnsfngsipQSLNALKSIKELDLScnnlsgqipihlqdlpfleyLNLSYnhfegevpkkgvfsnetrisltgneqlcgglgelhlpachsvgrrKETITLLKVVIPVIGLVLILLMCFIVVYTRRTKLAHKLSSALLMEQQFPIVSYAELSKAtkefsssnrigkgsfgfvykgnlgegg
MTFLFLLNSHSCFADSNEMDRLALLAIKSQLQDPLGVTKSWNNSINLCQWTGVTCGHRHQRVTELDLESQNIGGFLSPYIGNLSFLRVINLANNRFHGQIPKEVGRLFRLETIVLSnnsfsgkiptNLSRCFNLIDFWVHTNNLVGEIQAIIGNWLKLERLSLYDNQLTGQLRPSIGNLSALQTFDIAGNKLDGRIPDSLGQLRNLNYLGTSENDFSGMFPLSVCNISSLDEAYLFKNRFKGSLPVCLGFNLPKLTVLVVAQNNLTGFLPQSLSNASKLEWLELNENHFSGQVRINFNSLPNLSKLYLGRNNLGTRTSTDLDFITLLTNCSKLVKLGLVFNRFGGALPHSIANLSTTMTLIAMAGNQISGTIPPEIRNLFNLNGLGLEYNQLTGTIPPAIGELRNLQYLGLVGNNIRGIIPDSIGNLTLLNILQLGFNKLQGSIPSYLGKCQNLMQLSAPNNQLNGTLPPQIFGITPLSKLLDLSENHFSGSIPLEVGNLKSLVQLDISRNHFSNEIPVTLSACTTLEYLLMQGNSFNGSIPQSLNALKSIKELDLSCNNLSGQIPIHLQDLPFLEYLNLSYNHFEGEVPKKGVFSNETRISLTGNEQLCGGLGELHLPACHSVGRRKETITLLKVVIPVIGLVLILLMCFIVVYTRRTKLAHKLSSALLMEQQFPIVSYAELSKATKefsssnrigkgsfgfvykgnlgegg
MTFLFLLNSHSCFADSNEMDRLALLAIKSQLQDPLGVTKSWNNSINLCQWTGVTCGHRHQRVTELDLESQNIGGFLSPYIGNLSFLRVINLANNRFHGQIPKEVGRLFRLETIVLSNNSFSGKIPTNLSRCFNLIDFWVHTNNLVGEIQAIIGNWLKLERLSLYDNQLTGQLRPSIGNLSALQTFDIAGNKLDGRIPDSLGQLRNLNYLGTSENDFSGMFPLSVCNISSLDEAYLFKNRFKGSLPVCLGFNLPKLTVLVVAQNNLTGFLPQSLSNASKLEWLELNENHFSGQVRINFNSLPNLSKLYLGRNNLGTRTSTDLDFITLLTNCSKLVKLGLVFNRFGGALPHSIANLSTTMTLIAMAGNQISGTIPPEIRNLFNLNGLGLEYNQLTGTIPPAIGELRNLQYLGLVGNNIRGIIPDSIGNLTLLNILQLGFNKLQGSIPSYLGKCQNLMQLSAPNNQLNGTLPPQIFGITPLSKLLDLSENHFSGSIPLEVGNLKSLVQLDISRNHFSNEIPVTLSACTTLEYLLMQGNSFNGSIPQSLNALKSIKELDLSCNNLSGQIPIHLQDLPFLEYLNLSYNHFEGEVPKKGVFSNETRISLTGNEQLCGGLGELHLPACHSVGRRKETITllkvvipviglvlillMCFIVVYTRRTKLAHKLSSALLMEQQFPIVSYAELSKATKEFSSSNRIGKGSFGFVYKGNLGEGG
**FLFLLNSHSCFADSNEMDRLALLAIKSQLQDPLGVTKSWNNSINLCQWTGVTCGHRHQRVTELDLESQNIGGFLSPYIGNLSFLRVINLANNRFHGQIPKEVGRLFRLETIVLSNNSFSGKIPTNLSRCFNLIDFWVHTNNLVGEIQAIIGNWLKLERLSLYDNQLTGQLRPSIGNLSALQTFDIAGNKLDGRIPDSLGQLRNLNYLGTSENDFSGMFPLSVCNISSLDEAYLFKNRFKGSLPVCLGFNLPKLTVLVVAQNNLTGFLPQSLSNASKLEWLELNENHFSGQVRINFNSLPNLSKLYLGRNNLGTRTSTDLDFITLLTNCSKLVKLGLVFNRFGGALPHSIANLSTTMTLIAMAGNQISGTIPPEIRNLFNLNGLGLEYNQLTGTIPPAIGELRNLQYLGLVGNNIRGIIPDSIGNLTLLNILQLGFNKLQGSIPSYLGKCQNLMQLSAPNNQLNGTLPPQIFGITPLSKLLDLSENHFSGSIPLEVGNLKSLVQLDISRNHFSNEIPVTLSACTTLEYLLMQGNSFNGSIPQSLNALKSIKELDLSCNNLSGQIPIHLQDLPFLEYLNLSYNHFEGEVPKKGVFSNETRISLTGNEQLCGGLGELHLPACHSVGRRKETITLLKVVIPVIGLVLILLMCFIVVYTRRTKLAHKLSSALLMEQQFPIVSYAELS*************KGSFGFVYK*******
MTFLFLLNSHSCFADSNEMDRLALLAIKSQLQDPLGVTKSWNNSINLCQWTGVTCGHRHQRVTELDLESQNIGGFLSPYIGNLSFLRVINLANNRFHGQIPKEVGRLFRLETIVLSNNSFSGKIPTNLSRCFNLIDFWVHTNNLVGEIQAIIGNWLKLERLSLYDNQLTGQLRPSIGNLSALQTFDIAGNKLDGRIPDSLGQLRNLNYLGTSENDFSGMFPLSVCNISSLDEAYLFKNRFKGSLPVCLGFNLPKLTVLVVAQNNLTGFLPQSLSNASKLEWLELNENHFSGQVRINFNSLPNLSKLYLGRNNLGTRTSTDLDFITLLTNCSKLVKLGLVFNRFGGALPHSIANLSTTMTLIAMAGNQISGTIPPEIRNLFNLNGLGLEYNQLTGTIPPAIGELRNLQYLGLVGNNIRGIIPDSIGNLTLLNILQLGFNKLQGSIPSYLGKCQNLMQLSAPNNQLNGTLPPQIFGITPLSKLLDLSENHFSGSIPLEVGNLKSLVQLDISRNHFSNEIPVTLSACTTLEYLLMQGNSFNGSIPQSLNALKSIKELDLSCNNLSGQIPIHLQDLPFLEYLNLSYNHFEGEVPKKGVFSNETRISLTGNEQLCGGLG********************KVVIPVIGLVLILLMCFIVVY*********************IVSYAELSKATKEFSSSNRIGKGSFGFVYKGNLGE**
MTFLFLLNSHSCFADSNEMDRLALLAIKSQLQDPLGVTKSWNNSINLCQWTGVTCGHRHQRVTELDLESQNIGGFLSPYIGNLSFLRVINLANNRFHGQIPKEVGRLFRLETIVLSNNSFSGKIPTNLSRCFNLIDFWVHTNNLVGEIQAIIGNWLKLERLSLYDNQLTGQLRPSIGNLSALQTFDIAGNKLDGRIPDSLGQLRNLNYLGTSENDFSGMFPLSVCNISSLDEAYLFKNRFKGSLPVCLGFNLPKLTVLVVAQNNLTGFLPQSLSNASKLEWLELNENHFSGQVRINFNSLPNLSKLYLGRNNLGTRTSTDLDFITLLTNCSKLVKLGLVFNRFGGALPHSIANLSTTMTLIAMAGNQISGTIPPEIRNLFNLNGLGLEYNQLTGTIPPAIGELRNLQYLGLVGNNIRGIIPDSIGNLTLLNILQLGFNKLQGSIPSYLGKCQNLMQLSAPNNQLNGTLPPQIFGITPLSKLLDLSENHFSGSIPLEVGNLKSLVQLDISRNHFSNEIPVTLSACTTLEYLLMQGNSFNGSIPQSLNALKSIKELDLSCNNLSGQIPIHLQDLPFLEYLNLSYNHFEGEVPKKGVFSNETRISLTGNEQLCGGLGELHLPACHSVGRRKETITLLKVVIPVIGLVLILLMCFIVVYTRRTKLAHKLSSALLMEQQFPIVSYAELSKATKEFSSSNRIGKGSFGFVYKGNLGEGG
MTFLFLLNSHSCFADSNEMDRLALLAIKSQLQDPLGVTKSWNNSINLCQWTGVTCGHRHQRVTELDLESQNIGGFLSPYIGNLSFLRVINLANNRFHGQIPKEVGRLFRLETIVLSNNSFSGKIPTNLSRCFNLIDFWVHTNNLVGEIQAIIGNWLKLERLSLYDNQLTGQLRPSIGNLSALQTFDIAGNKLDGRIPDSLGQLRNLNYLGTSENDFSGMFPLSVCNISSLDEAYLFKNRFKGSLPVCLGFNLPKLTVLVVAQNNLTGFLPQSLSNASKLEWLELNENHFSGQVRINFNSLPNLSKLYLGRNNLGTRTSTDLDFITLLTNCSKLVKLGLVFNRFGGALPHSIANLSTTMTLIAMAGNQISGTIPPEIRNLFNLNGLGLEYNQLTGTIPPAIGELRNLQYLGLVGNNIRGIIPDSIGNLTLLNILQLGFNKLQGSIPSYLGKCQNLMQLSAPNNQLNGTLPPQIFGITPLSKLLDLSENHFSGSIPLEVGNLKSLVQLDISRNHFSNEIPVTLSACTTLEYLLMQGNSFNGSIPQSLNALKSIKELDLSCNNLSGQIPIHLQDLPFLEYLNLSYNHFEGEVPKKGVFSNETRISLTGNEQLCGGLGELHLPACHSVGRRKETITLLKVVIPVIGLVLILLMCFIVVYTRRTKL******ALLMEQQFPIVSYAELSKATKEFSSSNRIGKGSFGFVYKGNLG***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTFLFLLNSHSCFADSNEMDRLALLAIKSQLQDPLGVTKSWNNSINLCQWTGVTCGHRHQRVTELDLESQNIGGFLSPYIGNLSFLRVINLANNRFHGQIPKEVGRLFRLETIVLSNNSFSGKIPTNLSRCFNLIDFWVHTNNLVGEIQAIIGNWLKLERLSLYDNQLTGQLRPSIGNLSALQTFDIAGNKLDGRIPDSLGQLRNLNYLGTSENDFSGMFPLSVCNISSLDEAYLFKNRFKGSLPVCLGFNLPKLTVLVVAQNNLTGFLPQSLSNASKLEWLELNENHFSGQVRINFNSLPNLSKLYLGRNNLGTRTSTDLDFITLLTNCSKLVKLGLVFNRFGGALPHSIANLSTTMTLIAMAGNQISGTIPPEIRNLFNLNGLGLEYNQLTGTIPPAIGELRNLQYLGLVGNNIRGIIPDSIGNLTLLNILQLGFNKLQGSIPSYLGKCQNLMQLSAPNNQLNGTLPPQIFGITPLSKLLDLSENHFSGSIPLEVGNLKSLVQLDISRNHFSNEIPVTLSACTTLEYLLMQGNSFNGSIPQSLNALKSIKELDLSCNNLSGQIPIHLQDLPFLEYLNLSYNHFEGEVPKKGVFSNETRISLTGNEQLCGGLGELHLPACHSVGRRKETITLLKVVIPVIGLVLILLMCFIVVYTRRTKLAHKLSSALLMEQQFPIVSYAELSKATKEFSSSNRIGKGSFGFVYKGNLGEGG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query713 2.2.26 [Sep-21-2011]
C0LGP4 1010 Probable LRR receptor-lik yes no 0.977 0.690 0.429 1e-141
C0LGT6 1031 LRR receptor-like serine/ no no 0.971 0.672 0.426 1e-139
Q9SD62 1025 Putative receptor-like pr no no 0.971 0.676 0.427 1e-124
O49318 1124 Probable leucine-rich rep no no 0.983 0.623 0.312 9e-83
Q9LVP0 1102 Probable leucine-rich rep no no 0.959 0.620 0.314 3e-81
Q8VZG8 1045 Probable LRR receptor-lik no no 0.976 0.666 0.313 1e-80
Q9FL28 1173 LRR receptor-like serine/ no no 0.936 0.569 0.303 3e-80
Q9LHP4 1141 Receptor-like protein kin no no 0.918 0.574 0.301 3e-77
Q9M2Z1 1002 Leucine-rich repeat recep no no 0.932 0.663 0.315 7e-77
Q9SHI2 1101 Leucine-rich repeat recep no no 0.966 0.625 0.297 2e-76
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function desciption
 Score =  502 bits (1292), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 306/713 (42%), Positives = 429/713 (60%), Gaps = 16/713 (2%)

Query: 5   FLLNSHSCFADSNEMDRLALLAIKSQL-QDPLGVTKSWNNSINLCQWTGVTCGHRHQRVT 63
            LL +H  F D  E DR ALL  KSQ+ +D   V  SWN+S  LC W GVTCG +++RVT
Sbjct: 13  MLLETHG-FTD--ETDRQALLQFKSQVSEDKRVVLSSWNHSFPLCNWKGVTCGRKNKRVT 69

Query: 64  ELDLESQNIGGFLSPYIGNLSFLRVINLANNRFHGQIPKEVGRLFRLETIVLSNNSFSGK 123
            L+L    +GG +SP IGNLSFL  ++L  N F G IP+EVG+L RLE + +  N   G 
Sbjct: 70  HLELGRLQLGGVISPSIGNLSFLVSLDLYENFFGGTIPQEVGQLSRLEYLDMGINYLRGP 129

Query: 124 IPTNLSRCFNLIDFWVHTNNLVGEIQAIIGNWLKLERLSLYDNQLTGQLRPSIGNLSALQ 183
           IP  L  C  L++  + +N L G + + +G+   L +L+LY N + G+L  S+GNL+ L+
Sbjct: 130 IPLGLYNCSRLLNLRLDSNRLGGSVPSELGSLTNLVQLNLYGNNMRGKLPTSLGNLTLLE 189

Query: 184 TFDIAGNKLDGRIPDSLGQLRNLNYLGTSENDFSGMFPLSVCNISSLDEAYLFKNRFKGS 243
              ++ N L+G IP  + QL  +  L    N+FSG+FP ++ N+SSL    +  N F G 
Sbjct: 190 QLALSHNNLEGEIPSDVAQLTQIWSLQLVANNFSGVFPPALYNLSSLKLLGIGYNHFSGR 249

Query: 244 LPVCLGFNLPKLTVLVVAQNNLTGFLPQSLSNASKLEWLELNENHFSGQVRINFNSLPNL 303
           L   LG  LP L    +  N  TG +P +LSN S LE L +NEN+ +G +   F ++PNL
Sbjct: 250 LRPDLGILLPNLLSFNMGGNYFTGSIPTTLSNISTLERLGMNENNLTGSIP-TFGNVPNL 308

Query: 304 SKLYLGRNNLGTRTSTDLDFITLLTNCSKLVKLGLVFNRFGGALPHSIANLSTTMTLIAM 363
             L+L  N+LG+ +S DL+F+T LTNC++L  LG+  NR GG LP SIANLS  +  + +
Sbjct: 309 KLLFLHTNSLGSDSSRDLEFLTSLTNCTQLETLGIGRNRLGGDLPISIANLSAKLVTLDL 368

Query: 364 AGNQISGTIPPEIRNLFNLNGLGLEYNQLTGTIPPAIGELRNLQYLGLVGNNIRGIIPDS 423
            G  ISG+IP +I NL NL  L L+ N L+G +P ++G+L NL+YL L  N + G IP  
Sbjct: 369 GGTLISGSIPYDIGNLINLQKLILDQNMLSGPLPTSLGKLLNLRYLSLFSNRLSGGIPAF 428

Query: 424 IGNLTLLNILQLGFNKLQGSIPSYLGKCQNLMQLSAPNNQLNGTLPPQIFGITPLSKLLD 483
           IGN+T+L  L L  N  +G +P+ LG C +L++L   +N+LNGT+P +I  I  L + LD
Sbjct: 429 IGNMTMLETLDLSNNGFEGIVPTSLGNCSHLLELWIGDNKLNGTIPLEIMKIQQLLR-LD 487

Query: 484 LSENHFSGSIPLEVGNLKSLVQLDISRNHFSNEIPVTLSACTTLEYLLMQGNSFNGSIPQ 543
           +S N   GS+P ++G L++L  L +  N  S ++P TL  C T+E L ++GN F G IP 
Sbjct: 488 MSGNSLIGSLPQDIGALQNLGTLSLGDNKLSGKLPQTLGNCLTMESLFLEGNLFYGDIPD 547

Query: 544 SLNALKSIKELDLSCNNLSGQIPIHLQDLPFLEYLNLSYNHFEGEVPKKGVFSNETRISL 603
            L  L  +KE+DLS N+LSG IP +      LEYLNLS+N+ EG+VP KG+F N T +S+
Sbjct: 548 -LKGLVGVKEVDLSNNDLSGSIPEYFASFSKLEYLNLSFNNLEGKVPVKGIFENATTVSI 606

Query: 604 TGNEQLCGGLGELHLPACHSVGR---RKETITLLKVVIPV---IGLVLILLMCFIVVYTR 657
            GN  LCGG+    L  C S      +K +  L KVVI V   I L+L+L M  + +   
Sbjct: 607 VGNNDLCGGIMGFQLKPCLSQAPSVVKKHSSRLKKVVIGVSVGITLLLLLFMASVTLIWL 666

Query: 658 RTKLAHKLS---SALLMEQQFPIVSYAELSKATKEFSSSNRIGKGSFGFVYKG 707
           R +  +K +   +   +E     +SY +L  AT  FSSSN +G GSFG VYK 
Sbjct: 667 RKRKKNKETNNPTPSTLEVLHEKISYGDLRNATNGFSSSNMVGSGSFGTVYKA 719

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 Back     alignment and function description
>sp|Q9SD62|Y3471_ARATH Putative receptor-like protein kinase At3g47110 OS=Arabidopsis thaliana GN=At3g47110 PE=3 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query713
224081190 1011 predicted protein [Populus trichocarpa] 0.974 0.687 0.472 1e-167
147853780 1904 hypothetical protein VITISV_030954 [Viti 0.970 0.363 0.492 1e-166
359482058 1040 PREDICTED: probable LRR receptor-like se 0.970 0.665 0.492 1e-166
224115346 1017 predicted protein [Populus trichocarpa] 0.988 0.693 0.477 1e-165
255581223 1015 receptor-kinase, putative [Ricinus commu 0.970 0.681 0.471 1e-159
255577438 1028 receptor-kinase, putative [Ricinus commu 0.966 0.670 0.457 1e-159
224141953 1026 predicted protein [Populus trichocarpa] 0.973 0.676 0.464 1e-158
356529793 922 PREDICTED: probable LRR receptor-like se 0.974 0.753 0.452 1e-158
224116466 1008 predicted protein [Populus trichocarpa] 0.971 0.687 0.459 1e-157
444737622 1032 Putative LRR receptor-like serine/threon 0.974 0.673 0.465 1e-156
>gi|224081190|ref|XP_002306327.1| predicted protein [Populus trichocarpa] gi|222855776|gb|EEE93323.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  595 bits (1535), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 332/702 (47%), Positives = 452/702 (64%), Gaps = 7/702 (0%)

Query: 15  DSNEMDRLALLAIKSQLQDPLGVTKSWNNSINLCQWTGVTCGHRHQRVTELDLESQNIGG 74
           + NE DRL+LLA K+Q+ DPL    SWN S + C+W+GV CGHRHQR+ EL+L+S  + G
Sbjct: 29  EGNETDRLSLLAFKAQITDPLDALSSWNASTHFCKWSGVICGHRHQRIVELNLQSSQLTG 88

Query: 75  FLSPYIGNLSFLRVINLANNRFHGQIPKEVGRLFRLETIVLSNNSFSGKIPTNLSRCFNL 134
            LSP+IGNLSFLRV+NL  N F   IP+E+GRLFRL+ +VL NN+FSG+IP N+S C NL
Sbjct: 89  NLSPHIGNLSFLRVLNLEGNYFSRDIPQELGRLFRLQRLVLGNNTFSGEIPVNISSCSNL 148

Query: 135 IDFWVHTNNLVGEIQAIIGNWLKLERLSLYDNQLTGQLRPSIGNLSALQTFDIAGNKLDG 194
           +   + +NNL G+I A +G+  KL    L  N L G +  S GNLS++Q F    N L G
Sbjct: 149 LVLHLGSNNLTGKIPAQLGSLSKLGAFVLQGNNLVGDIPSSFGNLSSVQNFFWTKNYLRG 208

Query: 195 RIPDSLGQLRNLNYLGTSENDFSGMFPLSVCNISSLDEAYLFKNRFKGSLPVCLGFNLPK 254
            IP+SLG L+ L Y   +END SG  P S+CNISSL    L +N+  GSLP  LG NLP 
Sbjct: 209 GIPESLGNLKRLKYFAVAENDLSGTIPSSICNISSLAYVSLGQNQLHGSLPPDLGLNLPN 268

Query: 255 LTVLVVAQNNLTGFLPQSLSNASKLEWLELNENHFSGQVRINFNSLPNLSKLYLGRNNLG 314
           L  LV+  N+L G +P +LSNASK+  ++L+ N+ +G++  +  SLP+L KL +  N+LG
Sbjct: 269 LAYLVINFNHLNGPIPATLSNASKIFLVDLSYNNLTGKIP-DLASLPDLQKLLVHHNDLG 327

Query: 315 TRTSTDLDFITLLTNCSKLVKLGLVFNRFGGALPHSIANLSTTMTLIAMAGNQISGTIPP 374
                DL F+  L N + L  LG+  N FGG LP  ++N ST +  I    NQI G+IP 
Sbjct: 328 NGEEDDLSFLYTLANSTNLESLGINDNNFGGVLPEIVSNFSTNLKGITFGRNQIHGSIPT 387

Query: 375 EIRNLFNLNGLGLEYNQLTGTIPPAIGELRNLQYLGLVGNNIRGIIPDSIGNLTLLNILQ 434
           EI NL +L+ L LE NQL G IP +IG+L+NL  L L  N I G IP S+GN+T L  + 
Sbjct: 388 EIGNLISLDTLSLETNQLHGIIPSSIGKLQNLAALYLNENKISGSIPSSLGNITSLVEVS 447

Query: 435 LGFNKLQGSIPSYLGKCQNLMQLSAPNNQLNGTLPPQIFGITPLSKLLDLSENHFSGSIP 494
              N LQG+IP+ LG    L+ L    N L+G +P ++ GI+ LS LL L +N  +GS+P
Sbjct: 448 FAQNNLQGTIPASLGNWHKLLILDLSQNNLSGPIPKEVLGISSLSVLLYLHDNQLTGSLP 507

Query: 495 LEVGNLKSLVQLDISRNHFSNEIPVTLSACTTLEYLLMQGNSFNGSIPQSLNALKSIKEL 554
            EVG L +L  L +S+N  S EIP +L +C +LE L + GN F G +P  L++L++++ L
Sbjct: 508 SEVGQLVNLGFLRVSKNRLSGEIPKSLDSCKSLEGLDLGGNFFEGPVPD-LSSLRALQML 566

Query: 555 DLSCNNLSGQIPIHLQDLPFLEYLNLSYNHFEGEVPKKGVFSNETRISLTGNEQLCGGLG 614
            LS NNLSGQIP  L+D   LE L+LSYN FEGEVP++GVF N +RIS+ GN++LCGG+ 
Sbjct: 567 LLSYNNLSGQIPQFLKDFKLLETLDLSYNDFEGEVPEQGVFENTSRISVQGNKKLCGGIP 626

Query: 615 ELHLPACHS---VGRRKETITLLKVVIPVIGLVLILLMCFIVVYTRRTKLAHKLSSALLM 671
           +L LP C S      +  T  +L + IP   L ++L+  F++ Y+R+TK   + +S    
Sbjct: 627 QLDLPKCTSNEPARPKSHTKLILIIAIPCGFLGIVLMTSFLLFYSRKTK--DEPASGPSW 684

Query: 672 EQQFPIVSYAELSKATKEFSSSNRIGKGSFGFVYKGNLGEGG 713
           E  F  ++Y +L +AT  FSSSN +G G+FG VY+G L   G
Sbjct: 685 ESSFQRLTYQDLLQATDGFSSSNLVGAGAFGSVYRGTLTSDG 726

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147853780|emb|CAN83822.1| hypothetical protein VITISV_030954 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482058|ref|XP_002274540.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224115346|ref|XP_002317009.1| predicted protein [Populus trichocarpa] gi|222860074|gb|EEE97621.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255581223|ref|XP_002531424.1| receptor-kinase, putative [Ricinus communis] gi|223528974|gb|EEF30966.1| receptor-kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255577438|ref|XP_002529598.1| receptor-kinase, putative [Ricinus communis] gi|223530931|gb|EEF32790.1| receptor-kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224141953|ref|XP_002324325.1| predicted protein [Populus trichocarpa] gi|222865759|gb|EEF02890.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356529793|ref|XP_003533472.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Glycine max] Back     alignment and taxonomy information
>gi|224116466|ref|XP_002331904.1| predicted protein [Populus trichocarpa] gi|222874576|gb|EEF11707.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|444737622|emb|CCM07279.1| Putative LRR receptor-like serine/threonine-protein kinase FLS2 [Musa balbisiana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query713
TAIR|locus:2075661 1025 AT3G47110 [Arabidopsis thalian 0.971 0.676 0.430 2.7e-139
TAIR|locus:2149922 1031 EFR "EF-TU receptor" [Arabidop 0.971 0.672 0.422 1.1e-137
TAIR|locus:2079142 1010 AT3G47570 [Arabidopsis thalian 0.980 0.692 0.417 1.5e-136
UNIPROTKB|Q40640 1025 Xa21 "Receptor kinase-like pro 0.963 0.670 0.426 1.1e-135
TAIR|locus:2079157 1011 AT3G47580 [Arabidopsis thalian 0.987 0.696 0.408 6e-135
TAIR|locus:2075631 1009 AT3G47090 [Arabidopsis thalian 0.970 0.685 0.407 2.2e-128
UNIPROTKB|O24435 813 O24435 "Receptor kinase-like p 0.868 0.761 0.400 2.8e-114
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.840 0.527 0.364 6.3e-89
TAIR|locus:2046525 1124 AT2G33170 [Arabidopsis thalian 0.833 0.528 0.334 1e-86
TAIR|locus:2085949 1141 AT3G24240 [Arabidopsis thalian 0.762 0.476 0.356 3.9e-83
TAIR|locus:2075661 AT3G47110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1363 (484.9 bits), Expect = 2.7e-139, P = 2.7e-139
 Identities = 304/706 (43%), Positives = 426/706 (60%)

Query:    16 SNEMDRLALLAIKSQLQDPLGVTK-SWNNSINLCQWTGVTCGHRHQRVTELDLESQNIGG 74
             + E D+ ALL  KSQ+ +   V   SWN+S+ LC WTGV CG +H+RVT +DL    + G
Sbjct:    36 TEETDKQALLEFKSQVSETSRVVLGSWNDSLPLCSWTGVKCGLKHRRVTGVDLGGLKLTG 95

Query:    75 FLSPYIGNLSFLRVINLANNRFHGQIPKEVGRLFRLETIVLSNNSFSGKIPTNLSRCFNL 134
              +SP++GNLSFLR +NLA+N FHG IP EVG LFRL+ + +SNN F G IP  LS C +L
Sbjct:    96 VVSPFVGNLSFLRSLNLADNFFHGAIPSEVGNLFRLQYLNMSNNLFGGVIPVVLSNCSSL 155

Query:   135 IDFWVHTNNLVGEIQAIIGNWLKLERLSLYDNQLTGQLRPSIGNLSALQTFDIAGNKLDG 194
                 + +N+L   +    G+  KL  LSL  N LTG+   S+GNL++LQ  D   N+++G
Sbjct:   156 STLDLSSNHLEQGVPLEFGSLSKLVLLSLGRNNLTGKFPASLGNLTSLQMLDFIYNQIEG 215

Query:   195 RIPDSLGQLRNLNYLGTSENDFSGMFPLSVCNISSLDEAYLFKNRFKGSLPVCLGFNLPK 254
              IP  + +L+ + +   + N F+G+FP  + N+SSL    +  N F G+L    G  LP 
Sbjct:   216 EIPGDIARLKQMIFFRIALNKFNGVFPPPIYNLSSLIFLSITGNSFSGTLRPDFGSLLPN 275

Query:   255 LTVLVVAQNNLTGFLPQSLSNASKLEWLELNENHFSGQVRINFNSLPNLSKLYLGRNNLG 314
             L +L +  N+ TG +P++LSN S L  L++  NH +G++ ++F  L NL  L L  N+LG
Sbjct:   276 LQILYMGINSFTGTIPETLSNISSLRQLDIPSNHLTGKIPLSFGRLQNLLLLGLNNNSLG 335

Query:   315 TRTSTDLDFITLLTNCSKLVKLGLVFNRFGGALPHSIANLSTTMTLIAMAGNQISGTIPP 374
               +S DLDF+  LTNCS+L  L + FN+ GG LP  IANLST +T +++ GN ISG+IP 
Sbjct:   336 NYSSGDLDFLGALTNCSQLQYLNVGFNKLGGQLPVFIANLSTQLTELSLGGNLISGSIPH 395

Query:   375 EIRNLFNLNGLGLEYNQLTGTIPPAIGELRNLQYLGLVGNNIRGIIPDSIGNLTLLNILQ 434
              I NL +L  L L  N LTG +PP++GEL  L+ + L  N + G IP S+GN++ L  L 
Sbjct:   396 GIGNLVSLQTLDLGENLLTGKLPPSLGELSELRKVLLYSNGLSGEIPSSLGNISGLTYLY 455

Query:   435 LGFNKLQGSIPSYLGKCQNLMQLSAPNNQLNGTLPPQIFGITPLSKLLDLSENHFSGSIP 494
             L  N  +GSIPS LG C  L+ L+   N+LNG++P ++  + P   +L++S N   G + 
Sbjct:   456 LLNNSFEGSIPSSLGSCSYLLDLNLGTNKLNGSIPHELMEL-PSLVVLNVSFNLLVGPLR 514

Query:   495 LEVGNLKSLVQLDISRNHFSNEIPVTLSACTTLEYLLMQGNSFNGSIPQSLNALKSIKEL 554
              ++G LK L+ LD+S N  S +IP TL+ C +LE+LL+QGNSF G IP  +  L  ++ L
Sbjct:   515 QDIGKLKFLLALDVSYNKLSGQIPQTLANCLSLEFLLLQGNSFVGPIPD-IRGLTGLRFL 573

Query:   555 DLSCNNLSGQIPIHLQDLPFLEYLNLSYNHFEGEVPKKGVFSNETRISLTGNEQLCGGLG 614
             DLS NNLSG IP ++ +   L+ LNLS N+F+G VP +GVF N + +S+ GN  LCGG+ 
Sbjct:   574 DLSKNNLSGTIPEYMANFSKLQNLNLSLNNFDGAVPTEGVFRNTSAMSVFGNINLCGGIP 633

Query:   615 ELHLPACH-SVGRRKETITXXXXXXXXXXXXXXXXMCFIVVYTRRTKLAHKLSSALLME- 672
              L L  C   + RR  ++                 +C  VVY    KL  K   A   E 
Sbjct:   634 SLQLQPCSVELPRRHSSVRKIITICVSAVMAALLLLCLCVVYLCWYKLRVKSVRANNNEN 693

Query:   673 -QQF-PI------VSYAELSKATKEFSSSNRIGKGSFGFVYKGNLG 710
              + F P+      +SY EL K T  FSSSN IG G+FG V+KG LG
Sbjct:   694 DRSFSPVKSFYEKISYDELYKTTGGFSSSNLIGSGNFGAVFKGFLG 739
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
TAIR|locus:2149922 EFR "EF-TU receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079142 AT3G47570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40640 Xa21 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2079157 AT3G47580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075631 AT3G47090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O24435 O24435 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046525 AT2G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00050192
hypothetical protein (1011 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query713
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-111
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-09
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 6e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  358 bits (921), Expect = e-111
 Identities = 227/661 (34%), Positives = 344/661 (52%), Gaps = 20/661 (3%)

Query: 1   MTFLFLLNSHSCFADSNEMDRLALLAIKSQLQDPLGVTKSWNNSINLCQWTGVTCGHRHQ 60
           M F   LN     A+  E+    LL+ KS + DPL    +WN+S ++C W G+TC +   
Sbjct: 15  MLFFLFLNFSMLHAEELEL----LLSFKSSINDPLKYLSNWNSSADVCLWQGITCNN-SS 69

Query: 61  RVTELDLESQNIGGFLSPYIGNLSFLRVINLANNRFHGQIPKEVGRL-FRLETIVLSNNS 119
           RV  +DL  +NI G +S  I  L +++ INL+NN+  G IP ++      L  + LSNN+
Sbjct: 70  RVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNN 129

Query: 120 FSGKIPTNLSRCFNLIDFWVHTNNLVGEIQAIIGNWLKLERLSLYDNQLTGQLRPSIGNL 179
           F+G IP         +D  +  N L GEI   IG++  L+ L L  N L G++  S+ NL
Sbjct: 130 FTGSIPRGSIPNLETLD--LSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNL 187

Query: 180 SALQTFDIAGNKLDGRIPDSLGQLRNLNYLGTSENDFSGMFPLSVCNISSLDEAYLFKNR 239
           ++L+   +A N+L G+IP  LGQ+++L ++    N+ SG  P  +  ++SL+   L  N 
Sbjct: 188 TSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNN 247

Query: 240 FKGSLPVCLGFNLPKLTVLVVAQNNLTGFLPQSLSNASKLEWLELNENHFSGQVRINFNS 299
             G +P  LG NL  L  L + QN L+G +P S+ +  KL  L+L++N  SG++      
Sbjct: 248 LTGPIPSSLG-NLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQ 306

Query: 300 LPNLSKLYLGRNNLGTRTSTDLDFITLLTNCSKLVKLGLVFNRFGGALPHSIANLSTTMT 359
           L NL  L+L  NN   +    L      T+  +L  L L  N+F G +P ++      +T
Sbjct: 307 LQNLEILHLFSNNFTGKIPVAL------TSLPRLQVLQLWSNKFSGEIPKNLGK-HNNLT 359

Query: 360 LIAMAGNQISGTIPPEIRNLFNLNGLGLEYNQLTGTIPPAIGELRNLQYLGLVGNNIRGI 419
           ++ ++ N ++G IP  + +  NL  L L  N L G IP ++G  R+L+ + L  N+  G 
Sbjct: 360 VLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGE 419

Query: 420 IPDSIGNLTLLNILQLGFNKLQGSIPSYLGKCQNLMQLSAPNNQLNGTLPPQIFGITPLS 479
           +P     L L+  L +  N LQG I S      +L  LS   N+  G LP   FG   L 
Sbjct: 420 LPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLP-DSFGSKRLE 478

Query: 480 KLLDLSENHFSGSIPLEVGNLKSLVQLDISRNHFSNEIPVTLSACTTLEYLLMQGNSFNG 539
            L DLS N FSG++P ++G+L  L+QL +S N  S EIP  LS+C  L  L +  N  +G
Sbjct: 479 NL-DLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSG 537

Query: 540 SIPQSLNALKSIKELDLSCNNLSGQIPIHLQDLPFLEYLNLSYNHFEGEVPKKGVFSNET 599
            IP S + +  + +LDLS N LSG+IP +L ++  L  +N+S+NH  G +P  G F    
Sbjct: 538 QIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAIN 597

Query: 600 RISLTGNEQLCGGLGELHLPACHSVGRRKETITLLKVVIPVIGLVLILLMCFIVVYTRRT 659
             ++ GN  LCGG     LP C  V  RK       +   +   +++ L+ F  V+ R  
Sbjct: 598 ASAVAGNIDLCGGDTTSGLPPCKRV--RKTPSWWFYITCTLGAFLVLALVAFGFVFIRGR 655

Query: 660 K 660
            
Sbjct: 656 N 656

Length = 968
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 713
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
PLN032101153 Resistant to P. syringae 6; Provisional 99.91
PLN032101153 Resistant to P. syringae 6; Provisional 99.91
KOG4237498 consensus Extracellular matrix protein slit, conta 99.89
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.82
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
KOG0617264 consensus Ras suppressor protein (contains leucine 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
PLN03150623 hypothetical protein; Provisional 99.63
PLN03150623 hypothetical protein; Provisional 99.54
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.28
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.28
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.18
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.16
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.15
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.07
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.03
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.01
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.01
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.99
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.95
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.94
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.9
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.82
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.81
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.79
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.75
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.67
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.55
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.44
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.43
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.34
KOG1187 361 consensus Serine/threonine protein kinase [Signal 98.34
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.25
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.22
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.2
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.11
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.1
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.01
PRK15386426 type III secretion protein GogB; Provisional 97.94
PRK15386426 type III secretion protein GogB; Provisional 97.89
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.8
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.71
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.71
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.53
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.42
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.4
KOG4341483 consensus F-box protein containing LRR [General fu 97.35
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.34
KOG4341483 consensus F-box protein containing LRR [General fu 97.28
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.22
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.65
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.26
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.01
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.89
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.73
KOG3653 534 consensus Transforming growth factor beta/activin 95.43
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.27
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.17
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.8
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 94.18
KOG4308478 consensus LRR-containing protein [Function unknown 93.88
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.24
PLN03224 507 probable serine/threonine protein kinase; Provisio 91.93
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.73
KOG4308478 consensus LRR-containing protein [Function unknown 91.32
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.81
KOG0193 678 consensus Serine/threonine protein kinase RAF [Sig 88.7
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 87.9
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 86.33
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.14
smart0037026 LRR Leucine-rich repeats, outliers. 85.91
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.91
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.93
smart0037026 LRR Leucine-rich repeats, outliers. 84.93
PTZ00284 467 protein kinase; Provisional 80.77
KOG3864221 consensus Uncharacterized conserved protein [Funct 80.59
KOG3864221 consensus Uncharacterized conserved protein [Funct 80.36
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=4.1e-83  Score=753.12  Aligned_cols=686  Identities=33%  Similarity=0.513  Sum_probs=597.6

Q ss_pred             HhhcccCCCCCHHHHHHHHHHHHhCCCCCCCCCCCCCCCCCCCccccccCCCCCcEEEEECCCCCcceecCccccCCCCC
Q 041089            7 LNSHSCFADSNEMDRLALLAIKSQLQDPLGVTKSWNNSINLCQWTGVTCGHRHQRVTELDLESQNIGGFLSPYIGNLSFL   86 (713)
Q Consensus         7 ~~~~~~~~~~~~~~~~~ll~~k~~~~~~~~~~~~w~~~~~~c~w~gv~c~~~~~~v~~L~L~~~~l~~~~~~~l~~l~~L   86 (713)
                      +.+..+++...++|+.||++||+.+.+|.+.+.+|+...+||.|.||.|+. .++|+.|||+++.+.+.+++++..+++|
T Consensus        17 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~~~~~~~~~~l~~L   95 (968)
T PLN00113         17 FFLFLNFSMLHAEELELLLSFKSSINDPLKYLSNWNSSADVCLWQGITCNN-SSRVVSIDLSGKNISGKISSAIFRLPYI   95 (968)
T ss_pred             HHHHHHccCCCHHHHHHHHHHHHhCCCCcccCCCCCCCCCCCcCcceecCC-CCcEEEEEecCCCccccCChHHhCCCCC
Confidence            334445555577899999999999988888889998888999999999986 4799999999999999999999999999


Q ss_pred             CEEECCCCCCCccCchhhh-ccCCCCeeeecCCCCcccCCccccCCCCCcEEEccCCccccccchhhcCcCCCCEEeccC
Q 041089           87 RVINLANNRFHGQIPKEVG-RLFRLETIVLSNNSFSGKIPTNLSRCFNLIDFWVHTNNLVGEIQAIIGNWLKLERLSLYD  165 (713)
Q Consensus        87 ~~L~Ls~n~l~~~~p~~~~-~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~Ls~  165 (713)
                      ++|+|++|++.+.+|..+. .+++|++|+|++|.+++.+|.  +.+++|++|++++|.+.+.+|..++++++|++|++++
T Consensus        96 ~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~  173 (968)
T PLN00113         96 QTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGG  173 (968)
T ss_pred             CEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECcc
Confidence            9999999999999998765 999999999999999988885  5689999999999999999999999999999999999


Q ss_pred             ccccccCcccccCCCCCcEEEccCCCCCCCCCccccCCCCCCEEeCCCCcCcCCCcccccCCCcceEEEccCCCCcccCC
Q 041089          166 NQLTGQLRPSIGNLSALQTFDIAGNKLDGRIPDSLGQLRNLNYLGTSENDFSGMFPLSVCNISSLDEAYLFKNRFKGSLP  245 (713)
Q Consensus       166 n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~p  245 (713)
                      |.+.+.+|..++++++|++|++++|.+.+.+|..++++++|++|++++|.+.+.+|..+.++++|++|++++|.+++.+|
T Consensus       174 n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p  253 (968)
T PLN00113        174 NVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIP  253 (968)
T ss_pred             CcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCCCCCEEeCCCCcCcccCCccCcCCCCCcEEeccCcccccccccccCCCCCCCeEEcCCCcccCcCCCCccccc
Q 041089          246 VCLGFNLPKLTVLVVAQNNLTGFLPQSLSNASKLEWLELNENHFSGQVRINFNSLPNLSKLYLGRNNLGTRTSTDLDFIT  325 (713)
Q Consensus       246 ~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~~  325 (713)
                      ..+. ++++|+.|++++|.+.+.+|..+.++++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+      ..+.
T Consensus       254 ~~l~-~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~------~~~~  326 (968)
T PLN00113        254 SSLG-NLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTG------KIPV  326 (968)
T ss_pred             hhHh-CCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCC------cCCh
Confidence            8887 89999999999999999999999999999999999999999999999999999999999999876      4556


Q ss_pred             cccCCCCCcEEeeeccccccccChhhhhccccccEEEccCCceeecCCccccCCCCCCEEeccCCcccccCCcccccccc
Q 041089          326 LLTNCSKLVKLGLVFNRFGGALPHSIANLSTTMTLIAMAGNQISGTIPPEIRNLFNLNGLGLEYNQLTGTIPPAIGELRN  405 (713)
Q Consensus       326 ~l~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~l~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~  405 (713)
                      .+..+++|+.|++++|.+.+.+|..+.... +|+.+++++|.+++.+|.++..+++|+.|++++|.+.+.+|..+..+++
T Consensus       327 ~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~-~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~  405 (968)
T PLN00113        327 ALTSLPRLQVLQLWSNKFSGEIPKNLGKHN-NLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRS  405 (968)
T ss_pred             hHhcCCCCCEEECcCCCCcCcCChHHhCCC-CCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCC
Confidence            678899999999999999999999888775 8999999999999999999999999999999999999999999999999


Q ss_pred             cceeecccccccccCCccccCCCCCCEEEccCCcccccCChhhhcCCCCcEEeCCCCCCCCCCCccccCcccccchhccc
Q 041089          406 LQYLGLVGNNIRGIIPDSIGNLTLLNILQLGFNKLQGSIPSYLGKCQNLMQLSAPNNQLNGTLPPQIFGITPLSKLLDLS  485 (713)
Q Consensus       406 L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~l~~~~~L~~L~l~~n~l~~~~~~~~~~~~~l~~~l~ls  485 (713)
                      |++|++++|++++.+|..+..+++|+.|++++|.+++.+|..+..+++|+.|++++|++.+.+|..+. ... ++.|+++
T Consensus       406 L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~-~~~-L~~L~ls  483 (968)
T PLN00113        406 LRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFG-SKR-LENLDLS  483 (968)
T ss_pred             CCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccc-ccc-ceEEECc
Confidence            99999999999999999999999999999999999999999999999999999999999988887653 333 4589999


Q ss_pred             CCcCCCCCCccccCCCCCcEEeCCCCcCCccCcccCcCCCCCceeeCcCCcccccCCcccccCCCCCEEeCCCCcccccC
Q 041089          486 ENHFSGSIPLEVGNLKSLVQLDISRNHFSNEIPVTLSACTTLEYLLMQGNSFNGSIPQSLNALKSIKELDLSCNNLSGQI  565 (713)
Q Consensus       486 ~n~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~ls~n~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~  565 (713)
                      +|++++.+|..+.++++|++|++++|++.+.+|..+..+++|++|+|++|.+++.+|..+..+++|+.|||++|++++.+
T Consensus       484 ~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~  563 (968)
T PLN00113        484 RNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEI  563 (968)
T ss_pred             CCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccCCCCCCCCEEeCCCccCcccCCCCCCCCCCCcccccCCCCCCCCCCCCCCCccccCCccccceeeEEEEehhhHHHH
Q 041089          566 PIHLQDLPFLEYLNLSYNHFEGEVPKKGVFSNETRISLTGNEQLCGGLGELHLPACHSVGRRKETITLLKVVIPVIGLVL  645 (713)
Q Consensus       566 p~~l~~l~~L~~L~ls~n~l~~~~p~~~~~~~l~~~~~~~n~~lc~~~~~~~~~~c~~~~~~~~~~~~~~i~~~~~~~~~  645 (713)
                      |..+..+++|+++++++|++.|.+|..+.+.++....+.||+.+|+..+....++|....  +.....++++++++++++
T Consensus       564 p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~~~~~~~~c~~~~--~~~~~~~~~~~~~~~~~~  641 (968)
T PLN00113        564 PKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGDTTSGLPPCKRVR--KTPSWWFYITCTLGAFLV  641 (968)
T ss_pred             ChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCccccCCCCCcccc--ccceeeeehhHHHHHHHH
Confidence            999999999999999999999999999999889999999999999876444456775321  111111222222222222


Q ss_pred             HHHHHHHhhhhhhhccc-cccch--hhhhcc------cCccccHHHHHHHHhccCcCCeeccCCCceEEEEEeC
Q 041089          646 ILLMCFIVVYTRRTKLA-HKLSS--ALLMEQ------QFPIVSYAELSKATKEFSSSNRIGKGSFGFVYKGNLG  710 (713)
Q Consensus       646 ~l~~~~~~~~~~~~~~~-~~~~~--~~~~~~------~~~~~~~~~l~~at~~f~~~~~iG~GgfG~VYk~~l~  710 (713)
                      +++++++++++++++.. .+..+  ...+..      ....++++++   .+.|.+.++||+|+||.||||+..
T Consensus       642 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~ig~G~~g~Vy~~~~~  712 (968)
T PLN00113        642 LALVAFGFVFIRGRNNLELKRVENEDGTWELQFFDSKVSKSITINDI---LSSLKEENVISRGKKGASYKGKSI  712 (968)
T ss_pred             HHHHHHHHHHHHhhhcccccccccccccccccccccccchhhhHHHH---HhhCCcccEEccCCCeeEEEEEEC
Confidence            22222222222222211 11111  001110      1122344444   345788999999999999999874

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query713
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-52
3rgx_A768 Structural Insight Into Brassinosteroid Perception 5e-52
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-23
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 1e-14
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 1e-14
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 1e-14
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 3e-14
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 4e-14
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 4e-14
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 4e-14
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 3e-06
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 3e-06
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 2e-05
3zyo_A411 Crystal Structure Of The N-Terminal Leucine Rich Re 4e-05
3j0a_A844 Homology Model Of Human Toll-Like Receptor 5 Fitted 9e-05
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-04
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 1e-04
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 2e-04
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 2e-04
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 3e-04
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 3e-04
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 7e-04
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 3e-04
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 3e-04
3zyi_A452 Netring2 In Complex With Ngl2 Length = 452 4e-04
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 8e-04
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 8e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score =  202 bits (515), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 204/661 (30%), Positives = 292/661 (44%), Gaps = 87/661 (13%)
Query: 39  KSWNNSINLCQWTG-VTCGHRHQRVTELDLESQNIGG------FLSPYIGNLSFLRVINL 91
           K  N S N   + G V+ G +   +  LDL + +I G       LS   G L  L +   
Sbjct: 126 KFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAI--- 182
Query: 92  ANNRFHGQIPKEVGRLFRLETIVLSNNSFSGKIPTNLSRCFNLIDFWVHTNNLVGEIQAI 151
           + N+  G +  +V R   LE + +S+N+FS  IP  L  C  L    +  N L G+    
Sbjct: 183 SGNKISGDV--DVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRA 239
Query: 152 IGNWLKLERLSLYDNQLTGQLRPSIGNLSALQTFDIAGNKLDGRIPDSL-GQLRNLNYLG 210
           I    +L+ L++  NQ  G + P    L +LQ   +A NK  G IPD L G    L  L 
Sbjct: 240 ISTCTELKLLNISSNQFVGPIPPLP--LKSLQYLSLAENKFTGEIPDFLSGACDTLTGLD 297
Query: 211 TSENDFSGMFPLSVCNISSLDEAYLFKNRFKGSLPVCLGFNLPKLTVLVVAQNNLTGFLP 270
            S N F G  P    + S L+   L  N F G LP+     +  L VL ++ N  +G LP
Sbjct: 298 LSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELP 357
Query: 271 QSLSN-ASKLEWLELNENHFSGQVRINFNSLPN--LSKLYLGRNNLGTRTSTDLDFITLL 327
           +SL+N ++ L  L+L+ N+FSG +  N    P   L +LYL  N    +          L
Sbjct: 358 ESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPP------TL 411
Query: 328 TNCSKLVKLGLVFNRFGGALPHSIANLSTTMTLIAMAGNQISGTIPPEIRNLFNLNGLGL 387
           +NCS+LV L L FN   G +P S+ +LS    L  +  N + G IP E+  +  L  L L
Sbjct: 412 SNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDL-KLWLNMLEGEIPQELMYVKTLETLIL 470
Query: 388 EYNQLTGTIPPAIGELRNLQYLGLVGNNIRGIIPDSIGNLTLLNILQLGFNKLQGSIPSY 447
           ++N LTG IP  +    NL ++ L  N + G IP  IG L  L IL+L  N   G+IP+ 
Sbjct: 471 DFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAE 530
Query: 448 LGKCQNLMQLSAPNNQLNGTLPPQIF---------------------------------- 473
           LG C++L+ L    N  NGT+P  +F                                  
Sbjct: 531 LGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNL 590
Query: 474 ----GITP--LSKL-----LDLSENHFSGSIPLEVGNLKSLVQLDISRNHFSNEIPVTLS 522
               GI    L++L      +++   + G       N  S++ LD+S N  S  IP  + 
Sbjct: 591 LEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIG 650
Query: 523 ACTTLEYLLMQGNSFNGSIPQSLNALKSIKELDLSCNNLSGQIPIHLQDLPFLEYLNLSY 582
           +   L  L +  N  +GSIP  +  L+ +  LDLS N L G+IP  +  L  L  ++LS 
Sbjct: 651 SMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSN 710
Query: 583 NHFEGEVPKKGVFSNETRISLTGNEQLCGGLGELHLPAC------------HSVGRRKET 630
           N+  G +P+ G F          N  LCG      LP C             S GRR E 
Sbjct: 711 NNLSGPIPEMGQFETFPPAKFLNNPGLCG----YPLPRCDPSNADGYAHHQRSHGRRLEN 766
Query: 631 I 631
           +
Sbjct: 767 L 767
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query713
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-148
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-137
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-31
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-19
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-72
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-27
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-92
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-91
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-61
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-50
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-34
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-80
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-80
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-74
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-74
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-38
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-24
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-78
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-43
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-77
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-60
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-56
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-68
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-63
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-52
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-27
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-60
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-51
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-48
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-24
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-47
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-29
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-25
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-44
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-43
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-42
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-40
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-37
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-32
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-29
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-24
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-39
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-39
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-37
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-34
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-31
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-36
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-36
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-25
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-30
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-23
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-30
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-29
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-25
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-20
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-28
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-28
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-28
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-27
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-17
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-14
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-25
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-24
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-24
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-24
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-19
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-17
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-17
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-04
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 1e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-08
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 2e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-05
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 6e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 9e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  448 bits (1156), Expect = e-148
 Identities = 164/568 (28%), Positives = 254/568 (44%), Gaps = 27/568 (4%)

Query: 63  TELDLESQNIGGFLSPYIGNLSFLRVINLANNRFHGQIPKEVGRLFRLETIVLSNNSFSG 122
             LD+ S N    + P++G+ S L+ ++++ N+  G   + +     L+ + +S+N F G
Sbjct: 203 EFLDVSSNNFSTGI-PFLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVG 261

Query: 123 KIPTNLSRCFNLIDFWVHTNNLVGEI-QAIIGNWLKLERLSLYDNQLTGQLRPSIGNLSA 181
            IP       +L    +  N   GEI   + G    L  L L  N   G + P  G+ S 
Sbjct: 262 PIPP--LPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSL 319

Query: 182 LQTFDIAGNKLDGRIP-DSLGQLRNLNYLGTSENDFSGMFPLSVCNIS-SLDEAYLFKNR 239
           L++  ++ N   G +P D+L ++R L  L  S N+FSG  P S+ N+S SL    L  N 
Sbjct: 320 LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 379

Query: 240 FKGSLPVCLGFN-LPKLTVLVVAQNNLTGFLPQSLSNASKLEWLELNENHFSGQVRINFN 298
           F G +   L  N    L  L +  N  TG +P +LSN S+L  L L+ N+ SG +  +  
Sbjct: 380 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 439

Query: 299 SLPNLSKLYLGRNNL-GTRTSTDLDFITLLTNCSKLVKLGLVFNRFGGALPHSIANLSTT 357
           SL  L  L L  N L G            L     L  L L FN   G +P  ++N  T 
Sbjct: 440 SLSKLRDLKLWLNMLEGEIPQE-------LMYVKTLETLILDFNDLTGEIPSGLSNC-TN 491

Query: 358 MTLIAMAGNQISGTIPPEIRNLFNLNGLGLEYNQLTGTIPPAIGELRNLQYLGLVGNNIR 417
           +  I+++ N+++G IP  I  L NL  L L  N  +G IP  +G+ R+L +L L  N   
Sbjct: 492 LNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFN 551

Query: 418 GIIPDSIGNLTLLNILQLGFNKLQGSIPSYLGKCQNLMQLSAPNN--QLNGTLPPQIFGI 475
           G IP ++   +      +  N + G    Y+       +     N  +  G    Q+  +
Sbjct: 552 GTIPAAMFKQSGK----IAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRL 607

Query: 476 TPLSKLLDLSENHFSGSIPLEVGNLKSLVQLDISRNHFSNEIPVTLSACTTLEYLLMQGN 535
           +  +   +++   + G       N  S++ LD+S N  S  IP  + +   L  L +  N
Sbjct: 608 STRNPC-NITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHN 666

Query: 536 SFNGSIPQSLNALKSIKELDLSCNNLSGQIPIHLQDLPFLEYLNLSYNHFEGEVPKKGVF 595
             +GSIP  +  L+ +  LDLS N L G+IP  +  L  L  ++LS N+  G +P+ G F
Sbjct: 667 DISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQF 726

Query: 596 SNETRISLTGNEQLCGGLGELHLPACHS 623
                     N  LCG      LP C  
Sbjct: 727 ETFPPAKFLNNPGLCG----YPLPRCDP 750
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query713
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.68
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.67
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.65
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.54
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.53
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.53
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.53
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.52
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.5
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.49
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.46
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.45
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.39
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.36
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.31
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.27
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.26
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.25
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.23
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.19
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.97
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.97
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.91
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.84
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.76
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.63
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.42
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.35
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.11
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.06
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.26
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.03
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.9
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.5
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 92.83
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 92.53
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 92.33
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 91.2
4aoj_A 329 High affinity nerve growth factor receptor; transf 90.12
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 89.15
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 85.92
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 85.05
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 84.14
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 83.49
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 82.85
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 81.38
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 80.95
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 80.51
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 80.31
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2.7e-82  Score=726.50  Aligned_cols=603  Identities=29%  Similarity=0.433  Sum_probs=452.4

Q ss_pred             ccCCCCCHHHHHHHHHHHHhCCCCCCCCCCCCCCCCCCCccccccCCCCCcEEEEECCCCCccee---cC----------
Q 041089           11 SCFADSNEMDRLALLAIKSQLQDPLGVTKSWNNSINLCQWTGVTCGHRHQRVTELDLESQNIGGF---LS----------   77 (713)
Q Consensus        11 ~~~~~~~~~~~~~ll~~k~~~~~~~~~~~~w~~~~~~c~w~gv~c~~~~~~v~~L~L~~~~l~~~---~~----------   77 (713)
                      ++++++.++||+||++||+++.||. .+++|+.+++||+|.||+|+  .++|++|||+++.+.|.   ++          
T Consensus         4 ~~~~~~~~~~~~all~~k~~~~~~~-~l~~W~~~~~~C~w~gv~C~--~~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~   80 (768)
T 3rgz_A            4 ASPSQSLYREIHQLISFKDVLPDKN-LLPDWSSNKNPCTFDGVTCR--DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLE   80 (768)
T ss_dssp             ----CCHHHHHHHHHHHHTTCSCTT-SSTTCCTTSCGGGSTTEEEE--TTEEEEEECTTSCCCEEHHHHHHHTTTCTTCC
T ss_pred             CccccCCHHHHHHHHHHHhhCCCcc-cccCCCCCCCCcCCcceEEC--CCcEEEEECCCCCcCCccCccChhHhccCccc
Confidence            3445557889999999999999988 89999988899999999998  58999999999999886   43          


Q ss_pred             -------------ccccCCCCCCEEECCCCCCCccCch--hhhccCCCCeeeecCCCCcccCCccc-cCCCCCcEEEccC
Q 041089           78 -------------PYIGNLSFLRVINLANNRFHGQIPK--EVGRLFRLETIVLSNNSFSGKIPTNL-SRCFNLIDFWVHT  141 (713)
Q Consensus        78 -------------~~l~~l~~L~~L~Ls~n~l~~~~p~--~~~~l~~L~~L~Ls~n~l~~~~p~~l-~~l~~L~~L~l~~  141 (713)
                                   +.++++++|++|||++|.+.|.+|.  .++++++|++|+|++|.+++.+|..+ .++++|++|++++
T Consensus        81 ~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~  160 (768)
T 3rgz_A           81 SLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSA  160 (768)
T ss_dssp             EEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCS
T ss_pred             ccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCC
Confidence                         4778889999999999999988888  89999999999999999998888776 7888999999999


Q ss_pred             Cccccccchh---hcCcCCCCEEeccCccccccCcccccCCCCCcEEEccCCCCCCCCCccccCCCCCCEEeCCCCcCcC
Q 041089          142 NNLVGEIQAI---IGNWLKLERLSLYDNQLTGQLRPSIGNLSALQTFDIAGNKLDGRIPDSLGQLRNLNYLGTSENDFSG  218 (713)
Q Consensus       142 n~~~~~~~~~---l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~~~~  218 (713)
                      |.+++..|..   +.++++|++|++++|.+++..+.  .++++|++|++++|.+++.+|. ++++++|++|++++|.+.+
T Consensus       161 n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~--~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~  237 (768)
T 3rgz_A          161 NSISGANVVGWVLSDGCGELKHLAISGNKISGDVDV--SRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSG  237 (768)
T ss_dssp             SCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBC--TTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCS
T ss_pred             CccCCcCChhhhhhccCCCCCEEECCCCcccccCCc--ccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCC
Confidence            9888877766   56666666666666665544332  4555555555555555544444 5555555555555555555


Q ss_pred             CCcccccCCCcceEE----------------------EccCCCCcccCCccccCCCCCCCEEeCCCCcCcccCCccCcCC
Q 041089          219 MFPLSVCNISSLDEA----------------------YLFKNRFKGSLPVCLGFNLPKLTVLVVAQNNLTGFLPQSLSNA  276 (713)
Q Consensus       219 ~~~~~~~~l~~L~~L----------------------~l~~n~l~~~~p~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l  276 (713)
                      .+|..+.++++|++|                      ++++|.+++.+|..++..+++|++|++++|.+++.+|..+.++
T Consensus       238 ~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l  317 (768)
T 3rgz_A          238 DFSRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSC  317 (768)
T ss_dssp             CHHHHTTTCSSCCEEECCSSCCEESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGC
T ss_pred             cccHHHhcCCCCCEEECCCCcccCccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcC
Confidence            555555544444444                      4444444455555555334677777777777776677777777


Q ss_pred             CCCcEEeccCcccccccccc-cCCCCCCCeEEcCCCcccCcCCCCcc-------------------ccccccC--CCCCc
Q 041089          277 SKLEWLELNENHFSGQVRIN-FNSLPNLSKLYLGRNNLGTRTSTDLD-------------------FITLLTN--CSKLV  334 (713)
Q Consensus       277 ~~L~~L~l~~n~l~~~~~~~-l~~l~~L~~L~l~~n~l~~~~~~~~~-------------------~~~~l~~--~~~L~  334 (713)
                      ++|++|++++|.+++.+|.. +..+++|++|++++|.+.+..+..+.                   .+..+..  +++|+
T Consensus       318 ~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~  397 (768)
T 3rgz_A          318 SLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQ  397 (768)
T ss_dssp             TTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCC
T ss_pred             CCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCcc
Confidence            77777777777776665544 66677777777777766532221110                   0111111  45566


Q ss_pred             EEeeeccccccccChhhhhccccccEEEccCCceeecCCccccCCCCCCEEeccCCcccccCCcccccccccceeecccc
Q 041089          335 KLGLVFNRFGGALPHSIANLSTTMTLIAMAGNQISGTIPPEIRNLFNLNGLGLEYNQLTGTIPPAIGELRNLQYLGLVGN  414 (713)
Q Consensus       335 ~L~l~~n~~~~~~~~~~~~~~~~L~~l~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n  414 (713)
                      +|++++|.+++.+|..+..+. +|+.|++++|.+++.+|..+..+++|++|++++|.+++.+|..+..+++|++|++++|
T Consensus       398 ~L~L~~n~l~~~~p~~l~~l~-~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N  476 (768)
T 3rgz_A          398 ELYLQNNGFTGKIPPTLSNCS-ELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN  476 (768)
T ss_dssp             EEECCSSEEEEECCGGGGGCT-TCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSS
T ss_pred             EEECCCCccccccCHHHhcCC-CCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCC
Confidence            666666666666666665554 6777777777777777777777777777777777777777777777777777777777


Q ss_pred             cccccCCccccCCCCCCEEEccCCcccccCChhhhcCCCCcEEeCCCCCCCCCCCccccCcccccchhcccCCcCCCCCC
Q 041089          415 NIRGIIPDSIGNLTLLNILQLGFNKLQGSIPSYLGKCQNLMQLSAPNNQLNGTLPPQIFGITPLSKLLDLSENHFSGSIP  494 (713)
Q Consensus       415 ~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~l~~~~~L~~L~l~~n~l~~~~~~~~~~~~~l~~~l~ls~n~~~~~~~  494 (713)
                      ++.+.+|..+..+++|++|++++|++++.+|.+++.+++|++|++++|++.|.+|..+..+..+. .|++++|+++|.+|
T Consensus       477 ~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~-~L~Ls~N~l~g~ip  555 (768)
T 3rgz_A          477 DLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLI-WLDLNTNLFNGTIP  555 (768)
T ss_dssp             CCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCC-EEECCSSEEESBCC
T ss_pred             cccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCC-EEECCCCccCCcCC
Confidence            77777777777777777777777777777777777777777777777777777777777666654 77777777776665


Q ss_pred             cc----------------------------------------------------------------------ccCCCCCc
Q 041089          495 LE----------------------------------------------------------------------VGNLKSLV  504 (713)
Q Consensus       495 ~~----------------------------------------------------------------------~~~l~~L~  504 (713)
                      ..                                                                      +..+++|+
T Consensus       556 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~  635 (768)
T 3rgz_A          556 AAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMM  635 (768)
T ss_dssp             GGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCC
T ss_pred             hHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhcccccc
Confidence            43                                                                      34467899


Q ss_pred             EEeCCCCcCCccCcccCcCCCCCceeeCcCCcccccCCcccccCCCCCEEeCCCCcccccCCccCCCCCCCCEEeCCCcc
Q 041089          505 QLDISRNHFSNEIPVTLSACTTLEYLLMQGNSFNGSIPQSLNALKSIKELDLSCNNLSGQIPIHLQDLPFLEYLNLSYNH  584 (713)
Q Consensus       505 ~L~Ls~n~l~~~~p~~~~~~~~L~~L~ls~n~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~ls~n~  584 (713)
                      +||+++|+++|.+|..++.+++|+.|+|++|+++|.+|..++.+++|+.|||++|+++|.+|..+..+++|++||+++|+
T Consensus       636 ~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~  715 (768)
T 3rgz_A          636 FLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNN  715 (768)
T ss_dssp             EEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSE
T ss_pred             EEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcccCCCCCCCCCCCcccccCCCCCCCCCCCCCCCccccCC
Q 041089          585 FEGEVPKKGVFSNETRISLTGNEQLCGGLGELHLPACHSVG  625 (713)
Q Consensus       585 l~~~~p~~~~~~~l~~~~~~~n~~lc~~~~~~~~~~c~~~~  625 (713)
                      ++|.+|..+++.++...++.|||.+||.+    .+.|....
T Consensus       716 l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~----l~~C~~~~  752 (768)
T 3rgz_A          716 LSGPIPEMGQFETFPPAKFLNNPGLCGYP----LPRCDPSN  752 (768)
T ss_dssp             EEEECCSSSSGGGSCGGGGCSCTEEESTT----SCCCCSCC
T ss_pred             ccccCCCchhhccCCHHHhcCCchhcCCC----CcCCCCCc
Confidence            99999999999999999999999999975    34786543
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 713
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-28
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-20
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.003
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-22
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 4e-06
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 6e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 9e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-04
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 4e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 5e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.003
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 6e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score =  114 bits (284), Expect = 2e-28
 Identities = 71/305 (23%), Positives = 121/305 (39%), Gaps = 13/305 (4%)

Query: 17  NEMDRLALLAIKSQLQDPLGVTKSWNNSINLCQ--WTGVTC--GHRHQRVTELDLESQNI 72
           N  D+ ALL IK  L +P     SW  + + C   W GV C    +  RV  LDL   N+
Sbjct: 4   NPQDKQALLQIKKDLGNP-TTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNL 62

Query: 73  GGF--LSPYIGNLSFLRVINLANN-RFHGQIPKEVGRLFRLETIVLSNNSFSGKIPTNLS 129
                +   + NL +L  + +       G IP  + +L +L  + +++ + SG IP  LS
Sbjct: 63  PKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLS 122

Query: 130 RCFNLIDFWVHTNNLVGEIQAIIGNWLKLERLSLYDNQLTGQLRPSIGNLSALQT-FDIA 188
           +   L+      N L G +   I +   L  ++   N+++G +  S G+ S L T   I+
Sbjct: 123 QIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTIS 182

Query: 189 GNKLDGRIPDSLGQLRNLNYLGTSENDFSGMFPLSVCNISSLDEAYLFKNRFKGSLPVCL 248
            N+L G+IP +   L       +          L   +    +   +   +   +  +  
Sbjct: 183 RNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDK---NTQKIHLAKNSLAFDLGK 239

Query: 249 GFNLPKLTVLVVAQNNLTGFLPQSLSNASKLEWLELNENHFSGQVRINFNSLPNLSKLYL 308
                 L  L +  N + G LPQ L+    L  L ++ N+  G++     +L        
Sbjct: 240 VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP-QGGNLQRFDVSAY 298

Query: 309 GRNNL 313
             N  
Sbjct: 299 ANNKC 303
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query713
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.98
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.8
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.76
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.53
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.42
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.42
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.26
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.26
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.22
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.38
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.3
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.74
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.66
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.22
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.86
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 88.51
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 81.13
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 81.01
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=4.2e-41  Score=341.23  Aligned_cols=293  Identities=27%  Similarity=0.424  Sum_probs=259.3

Q ss_pred             CCCHHHHHHHHHHHHhCCCCCCCCCCCCCCCCCCC--ccccccCCCC--CcEEEEECCCCCcce--ecCccccCCCCCCE
Q 041089           15 DSNEMDRLALLAIKSQLQDPLGVTKSWNNSINLCQ--WTGVTCGHRH--QRVTELDLESQNIGG--FLSPYIGNLSFLRV   88 (713)
Q Consensus        15 ~~~~~~~~~ll~~k~~~~~~~~~~~~w~~~~~~c~--w~gv~c~~~~--~~v~~L~L~~~~l~~--~~~~~l~~l~~L~~   88 (713)
                      -|.++||+||++||+.+.||. .+++|..+.|||.  |.||+|+...  .||++|||+++++.|  .+|++++++++|++
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~   80 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNF   80 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTCSE
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-cCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChHHhcCccccc
Confidence            378999999999999998874 6899998889995  9999998643  489999999999988  57899999999999


Q ss_pred             EECCC-CCCCccCchhhhccCCCCeeeecCCCCcccCCccccCCCCCcEEEccCCccccccchhhcCcCCCCEEeccCcc
Q 041089           89 INLAN-NRFHGQIPKEVGRLFRLETIVLSNNSFSGKIPTNLSRCFNLIDFWVHTNNLVGEIQAIIGNWLKLERLSLYDNQ  167 (713)
Q Consensus        89 L~Ls~-n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~Ls~n~  167 (713)
                      |+|++ |++.|.+|..|+++++|++|+|++|++.+..+..+..+.+|++++++.|.+.+.+|..+.++++|+++++++|.
T Consensus        81 L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~  160 (313)
T d1ogqa_          81 LYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNR  160 (313)
T ss_dssp             EEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSC
T ss_pred             cccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccceeeccccc
Confidence            99997 89999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCcccccCCCCC-cEEEccCCCCCCCCCccccCCCCCCEEeCCCCcCcCCCcccccCCCcceEEEccCCCCcccCCc
Q 041089          168 LTGQLRPSIGNLSAL-QTFDIAGNKLDGRIPDSLGQLRNLNYLGTSENDFSGMFPLSVCNISSLDEAYLFKNRFKGSLPV  246 (713)
Q Consensus       168 l~~~~~~~l~~l~~L-~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~p~  246 (713)
                      +.+.+|..+..+..+ +.+++++|++++..|..+.++..+ .++++.+...+.+|..+..+++++.++++++.+.+.+|.
T Consensus       161 l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~~  239 (313)
T d1ogqa_         161 ISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGK  239 (313)
T ss_dssp             CEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGGG
T ss_pred             cccccccccccccccccccccccccccccccccccccccc-ccccccccccccccccccccccccccccccccccccccc
Confidence            999999999888876 889999999998888888877655 699999999999999998999999999999988876653


Q ss_pred             cccCCCCCCCEEeCCCCcCcccCCccCcCCCCCcEEeccCcccccccccccCCCCCCCeEEcCCCc
Q 041089          247 CLGFNLPKLTVLVVAQNNLTGFLPQSLSNASKLEWLELNENHFSGQVRINFNSLPNLSKLYLGRNN  312 (713)
Q Consensus       247 ~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~  312 (713)
                       +. .+++|+.|++++|+++|.+|..+.++++|++|+|++|+++|.+|. +..+++|+.+++++|+
T Consensus       240 -~~-~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         240 -VG-LSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNK  302 (313)
T ss_dssp             -CC-CCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSS
T ss_pred             -cc-cccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCc
Confidence             43 678899999999999988888898899999999999998887774 5667777777777775
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure