Citrus Sinensis ID: 041140


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-----
MTNGDDEGVVLSTATFGFHGFDEFGELLALANIKIGYCNGSAYIGCIQSEREALLRFKQDLKDPANRLALWSDGNCCTWAGVVCNDSTGHVLELRLGNPFLHDDEPFWLEDYKDETSKLIGKINPSLLDLKHLVYLELSNNNFEKAQLPVFLGSMGSLRHIDLSRAEFTGMIPYQLGNLSNLQYLDLSSQIPLSFLYLENLSWLSGLSLLKHLDLTGVDLSTASDWFLVTNMLPSLQVLKLSACSLHNSLPELPIANFSSLYTLDLSYNEFDNTL
ccccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccccccccccccccccccEEEccccccEEEEEcccccccccccccccccccccccccEEccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccHHHHHccccccEEEcccccccccccHHHHHcccccccEEEccccccccccccccccccccccEEEcccccccccc
ccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccccccccccccEEEEEEcccccEEEEEEcccccccccccccccEEEcccccccccccHHHHccccccEEEccccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHHHHHccccccEEEcccccccccccHHHccccccccEEEEcccccccccccccccccccccEEEEcccccccccc
mtngddegvvlstatfgfhgfdEFGELLALANIKigycngsayIGCIQSEREALLRFKQDLkdpanrlalwsdgncctwagvvcndstghvlelrlgnpflhddepfwledykDETSKLIgkinpslldlKHLVYLELsnnnfekaqlpvflgsmgslrhidlsraeftgmipyqlgnlsnlqyldlssqiplsflylenlswlsglsllkhldltgvdlstASDWFLVTNMLPSLQVLKLSACslhnslpelpianfsslytldlsynefdntl
MTNGDDEGVVLSTATFGFHGFDEFGELLALANIKIGYCNGSAYIGCIQSEREALLRFKQDLKDPANRLALWSDGNCCTWAGVVCNDSTGHVLELRLGNPFLHDDEPFWLEDYKDETSKLIGKINPSLLDLKHLVYLELSNNNFEKAQLPVFLGSMGSLRHIDLSRAEFTGMIPYQLGNLSNLQYLDLSSQIPLSFLYLENLSWLSGLSLLKHLDLTGVDLSTASDWFLVTNMLPSLQVLKLSACSLHNSLPELPIANFSSLYTLDLSYNEFDNTL
MTNGDDEGVVLSTATFGFHGFDEFGELLALANIKIGYCNGSAYIGCIQSEREALLRFKQDLKDPANRLALWSDGNCCTWAGVVCNDSTGHVLELRLGNPFLHDDEPFWLEDYKDETSKLIGKINPSLLDLKHLVYLELSNNNFEKAQLPVFLGSMGSLRHIDLSRAEFTGMIPYQLGNLSNLQYLDLSSQIPLSFLYlenlswlsglsllkhldlTGVDLSTASDWFLVTNMLPSLQVLKLSACSLHNSLPELPIANFSSLYTLDLSYNEFDNTL
********VVLSTATFGFHGFDEFGELLALANIKIGYCNGSAYIGCIQSEREALLRFKQDLKDPANRLALWSDGNCCTWAGVVCNDSTGHVLELRLGNPFLHDDEPFWLEDYKDETSKLIGKINPSLLDLKHLVYLELSNNNFEKAQLPVFLGSMGSLRHIDLSRAEFTGMIPYQLGNLSNLQYLDLSSQIPLSFLYLENLSWLSGLSLLKHLDLTGVDLSTASDWFLVTNMLPSLQVLKLSACSLHNSLPELPIANFSSLYTLDLSYN******
**********LSTATFGFHGFDEFGELLALANIKIGYCNGSAYI*CIQSEREALLRFKQDLKDPANRLALWSDGNCCTWAGVVCNDSTGHVLELRLGNPFLHDDEPFWLEDYKDETSKLIGKINPSLLDLKHLVYLELSNNNFEKAQLPVFLGSMGSLRHIDLSRAEFTGMIPYQLGNLSNLQYLDLSSQIPLSFLYLENLSWLSGLSLLKHLDLTGVDLSTASDWFLVTNMLPSLQVLKLSACSLHNSLPELPIANFSSLYTLDLSYNEFD***
********VVLSTATFGFHGFDEFGELLALANIKIGYCNGSAYIGCIQSEREALLRFKQDLKDPANRLALWSDGNCCTWAGVVCNDSTGHVLELRLGNPFLHDDEPFWLEDYKDETSKLIGKINPSLLDLKHLVYLELSNNNFEKAQLPVFLGSMGSLRHIDLSRAEFTGMIPYQLGNLSNLQYLDLSSQIPLSFLYLENLSWLSGLSLLKHLDLTGVDLSTASDWFLVTNMLPSLQVLKLSACSLHNSLPELPIANFSSLYTLDLSYNEFDNTL
****DDEGVVLSTATFGFHGFDEFGELLALANIKIGYCNGSAYIGCIQSEREALLRFKQDLKDPANRLALWSDGNCCTWAGVVCNDSTGHVLELRLGNPFLHDDEPFWLEDYKDETSKLIGKINPSLLDLKHLVYLELSNNNFEKAQLPVFLGSMGSLRHIDLSRAEFTGMIPYQLGNLSNLQYLDLSSQIPLSFLYLENLSWLSGLSLLKHLDLTGVDLSTASDWFLVTNMLPSLQVLKLSACSLHNSLPELPIANFSSLYTLDLSYNEF****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTNGDDEGVVLSTATFGFHGFDEFGELLALANIKIGYCNGSAYIGCIQSEREALLRFKQDLKDPANRLALWSDGNCCTWAGVVCNDSTGHVLELRLGNPFLHDDEPFWLEDYKDETSKLIGKINPSLLDLKHLVYLELSNNNFEKAQLPVFLGSMGSLRHIDLSRAEFTGMIPYQLGNLSNLQYLDLSSQIPLSFLYLENLSWLSGLSLLKHLDLTGVDLSTASDWFLVTNMLPSLQVLKLSACSLHNSLPELPIANFSSLYTLDLSYNEFDNTL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query275 2.2.26 [Sep-21-2011]
Q9C9H7 847 Receptor-like protein 12 no no 0.821 0.266 0.313 2e-14
Q9LRT1 1016 Probably inactive leucine no no 0.734 0.198 0.313 3e-13
Q9FRS6 1029 Leucine-rich repeat recep no no 0.705 0.188 0.329 8e-13
Q00874 372 DNA-damage-repair/tolerat no no 0.767 0.567 0.3 8e-13
Q05091330 Polygalacturonase inhibit N/A no 0.8 0.666 0.301 9e-13
Q9C9N5 685 Probable inactive leucine no no 0.698 0.280 0.314 2e-11
Q8W4S5 614 Probable LRR receptor-lik no no 0.534 0.239 0.329 5e-11
Q42371 976 LRR receptor-like serine/ no no 0.734 0.206 0.292 8e-11
C0LGF4 591 LRR receptor-like serine/ no no 0.498 0.231 0.325 1e-10
O82318 960 Probably inactive leucine no no 0.632 0.181 0.303 2e-10
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 117/265 (44%), Gaps = 39/265 (14%)

Query: 46  CIQSEREALLRFKQDLKDPAN-------RLALWSDGNCCTWAGVVCNDSTGHVLELRLGN 98
           C   +R+ALL F+ +    A+       R       +CC W GV CND +G V+ L + N
Sbjct: 34  CRDDQRDALLEFRGEFPINASWHIMNQWRGPWNKSTDCCLWNGVTCNDKSGQVISLDIPN 93

Query: 99  PFLHD-----DEPFWLEDYKD---ETSKLIGKINPSLLDLKHLVYLELSNNNFEKAQLPV 150
            FL++        F L+  +        L G+I  SL +L HL  + L  N F   ++P 
Sbjct: 94  TFLNNYLKTNSSLFKLQYLRHLDLTNCNLYGEIPSSLGNLSHLTLVNLYFNKF-VGEIPA 152

Query: 151 FLGSMGSLRHIDLSRAEFTGMIPYQLGNLSNLQYLDLSS-----QIPLSFLYLENL---- 201
            +G++  LRH+ L+    TG IP  LGNLS L  L+L S     +IP S   L+ L    
Sbjct: 153 SIGNLNQLRHLILANNVLTGEIPSSLGNLSRLVNLELFSNRLVGKIPDSIGDLKQLRNLS 212

Query: 202 -----------SWLSGLSLLKHLDLTGVDLSTASDWFLVTNMLPSLQVLKLSACSLHNSL 250
                      S L  LS L HL LT   L    +       L  L+V+     SL  ++
Sbjct: 213 LASNNLIGEIPSSLGNLSNLVHLVLTHNQL--VGEVPASIGNLIELRVMSFENNSLSGNI 270

Query: 251 PELPIANFSSLYTLDLSYNEFDNTL 275
           P +  AN + L    LS N F +T 
Sbjct: 271 P-ISFANLTKLSIFVLSSNNFTSTF 294




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 Back     alignment and function description
>sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=2 SV=1 Back     alignment and function description
>sp|Q00874|DR100_ARATH DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2 Back     alignment and function description
>sp|Q05091|PGIP_PYRCO Polygalacturonase inhibitor OS=Pyrus communis GN=PGIP PE=1 SV=1 Back     alignment and function description
>sp|Q9C9N5|Y1668_ARATH Probable inactive leucine-rich repeat receptor-like protein kinase At1g66830 OS=Arabidopsis thaliana GN=At1g66830 PE=1 SV=1 Back     alignment and function description
>sp|Q8W4S5|Y5371_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g63710 OS=Arabidopsis thaliana GN=At5g63710 PE=2 SV=1 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description
>sp|C0LGF4|FEI1_ARATH LRR receptor-like serine/threonine-protein kinase FEI 1 OS=Arabidopsis thaliana GN=FEI1 PE=1 SV=1 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query275
209970631 962 HcrVf4 [Malus floribunda] 0.854 0.244 0.544 3e-63
350284761 915 receptor-like protein [Malus micromalus] 0.854 0.256 0.544 3e-63
14330718 915 HcrVf3 protein [Malus floribunda] 0.854 0.256 0.544 3e-63
350284753 915 receptor-like protein [Malus micromalus] 0.854 0.256 0.544 3e-63
350284745 976 receptor-like protein [Malus x domestica 0.850 0.239 0.556 5e-63
350284765 982 receptor-like protein [Malus sieversii] 0.836 0.234 0.550 5e-61
350284755 982 receptor-like protein [Malus micromalus] 0.836 0.234 0.550 6e-61
350284763 982 receptor-like protein [Malus micromalus] 0.836 0.234 0.550 6e-61
209970609 1041 AL07-2p [Malus floribunda] 0.869 0.229 0.536 1e-60
209970607 1045 M18S-3Ap [Malus floribunda] 0.887 0.233 0.542 1e-60
>gi|209970631|gb|ACJ03074.1| HcrVf4 [Malus floribunda] Back     alignment and taxonomy information
 Score =  248 bits (632), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 142/261 (54%), Positives = 177/261 (67%), Gaps = 26/261 (9%)

Query: 26  ELLALANI--KIGYCNGSAYIG--CIQSEREALLRFKQDLKDPANRLALW-----SDGNC 76
             LA+A I   IG CNG+      C +SER+ALL FKQDLKDP NRLA W     SD +C
Sbjct: 60  RFLAIATITFSIGLCNGNPGWPPLCKESERQALLMFKQDLKDPTNRLASWVAEEDSDSDC 119

Query: 77  CTWAGVVCNDSTGHVLELRLGN--PFLHDDEPFWLEDYKDETSKLIGKINPSLLDLKHLV 134
           C+W GVVC+ +TGH+ EL L N  PFL            D  S   GKINPSLL LKHL 
Sbjct: 120 CSWTGVVCDHTTGHIHELHLNNTDPFL------------DLKSSFGGKINPSLLSLKHLN 167

Query: 135 YLELSNNNFEKAQLPVFLGSMGSLRHIDLSRAEFTGMIPYQLGNLSNLQYLDLSSQIPLS 194
           +L+LSNN F   Q+P F GSM SL H++L+ + F G+IP++LGNLS+L+YL+LSS     
Sbjct: 168 FLDLSNNYFYPTQIPSFFGSMTSLTHLNLAYSRFGGIIPHKLGNLSSLRYLNLSSNS--I 225

Query: 195 FLYLENLSWLSGLSLLKHLDLTGVDLSTASDWFLVTNMLPSLQVLKLSACSLHNSLPELP 254
           +L +ENL W+SGLSLLKHLDL+GV+LS ASDW  VTNMLPSL  L +S C L+  +P LP
Sbjct: 226 YLKVENLQWISGLSLLKHLDLSGVNLSKASDWLQVTNMLPSLVKLIMSDCQLYQ-IPPLP 284

Query: 255 IANFSSLYTLDLSYNEFDNTL 275
             NF+SL  LDLS+N F++ +
Sbjct: 285 TTNFTSLVVLDLSFNNFNSLM 305




Source: Malus floribunda

Species: Malus floribunda

Genus: Malus

Family: Rosaceae

Order: Rosales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|350284761|gb|AEQ27752.1| receptor-like protein [Malus micromalus] Back     alignment and taxonomy information
>gi|14330718|emb|CAC40827.1| HcrVf3 protein [Malus floribunda] Back     alignment and taxonomy information
>gi|350284753|gb|AEQ27748.1| receptor-like protein [Malus micromalus] Back     alignment and taxonomy information
>gi|350284745|gb|AEQ27744.1| receptor-like protein [Malus x domestica] Back     alignment and taxonomy information
>gi|350284765|gb|AEQ27754.1| receptor-like protein [Malus sieversii] Back     alignment and taxonomy information
>gi|350284755|gb|AEQ27749.1| receptor-like protein [Malus micromalus] Back     alignment and taxonomy information
>gi|350284763|gb|AEQ27753.1| receptor-like protein [Malus micromalus] Back     alignment and taxonomy information
>gi|209970609|gb|ACJ03067.1| AL07-2p [Malus floribunda] Back     alignment and taxonomy information
>gi|209970607|gb|ACJ03066.1| M18S-3Ap [Malus floribunda] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query275
TAIR|locus:2044767 905 AT2G34930 "AT2G34930" [Arabido 0.872 0.265 0.355 7.2e-30
TAIR|locus:2825384 847 RLP12 "AT1G71400" [Arabidopsis 0.52 0.168 0.352 1.1e-18
TAIR|locus:2096339 786 RLP30 "receptor like protein 3 0.52 0.181 0.324 1.5e-18
TAIR|locus:2094613 784 RLP38 "receptor like protein 3 0.487 0.170 0.318 3.4e-17
TAIR|locus:2091353 1016 AT3G28040 [Arabidopsis thalian 0.763 0.206 0.322 1.5e-15
TAIR|locus:2090754 711 RLP43 "receptor like protein 4 0.730 0.282 0.296 1.3e-14
TAIR|locus:2078102 875 RLP33 "receptor like protein 3 0.650 0.204 0.318 1.4e-14
TAIR|locus:2085537 894 RLP34 "AT3G11010" [Arabidopsis 0.447 0.137 0.355 1.6e-14
TAIR|locus:2169404330 PGIP2 "polygalacturonase inhib 0.512 0.427 0.333 2.7e-14
TAIR|locus:2825389 784 RLP11 "AT1G71390" [Arabidopsis 0.512 0.179 0.331 5.7e-14
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 341 (125.1 bits), Expect = 7.2e-30, P = 7.2e-30
 Identities = 91/256 (35%), Positives = 135/256 (52%)

Query:    27 LLALANIKIGYCNGSAYIGCIQSEREALLRFKQDLKDPANRLALWSDGNCCTWAGVVCND 86
             +L L N+  G    +A   CI +ER+ALL F+  L D ++RL  WS  +CC W GV+C+ 
Sbjct:    17 ILLLKNLNYG---SAASPKCISTERQALLTFRAALTDLSSRLFSWSGPDCCNWPGVLCDA 73

Query:    87 STGHVLELRLGNPFLHDDEPFWLEDYKDETSKLIGKINPSLLDLKHLVYLELSNNNFEKA 146
              T HV+++ L NP     +    ++YK     L GKI+PSL  LK L YL+LS+N+F + 
Sbjct:    74 RTSHVVKIDLRNP----SQDVRSDEYK--RGSLRGKIHPSLTQLKFLSYLDLSSNDFNEL 127

Query:   147 QLPVFLGSMGSLRHIDLSRAEFTGMIPYQLGNLSNLQYLDLSSQI-----PLSFLYXXXX 201
             ++P F+G + SLR+++LS + F+G IP  LGNLS L+ LDL ++       LS       
Sbjct:   128 EIPEFIGQIVSLRYLNLSSSSFSGEIPTSLGNLSKLESLDLYAESFGDSGTLSLRASNLR 187

Query:   202 XXXXXXXXXXXXXXTGVDLSTASD-WFLVTNMLPSLQVLKLSACSLHNSLPELPI-ANFS 259
                             V+LS A + W    + + +L+ L L    L N  P L   A+  
Sbjct:   188 WLSSLSSSLKYLNMGYVNLSGAGETWLQDFSRISALKELHLFNSELKNLPPTLSSSADLK 247

Query:   260 SLYTLDLSYNEFDNTL 275
              L  LDLS N  ++ +
Sbjct:   248 LLEVLDLSENSLNSPI 263


GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0005618 "cell wall" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP;IMP
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096339 RLP30 "receptor like protein 30" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094613 RLP38 "receptor like protein 38" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091353 AT3G28040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090754 RLP43 "receptor like protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169404 PGIP2 "polygalacturonase inhibiting protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825389 RLP11 "AT1G71390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query275
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-15
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-10
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 3e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-06
PLN03210 1153 PLN03210, PLN03210, Resistant to P 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 76.8 bits (189), Expect = 1e-15
 Identities = 85/298 (28%), Positives = 119/298 (39%), Gaps = 75/298 (25%)

Query: 50  EREALLRFKQDLKDPANRLALWSDGN-CCTWAGVVCNDSTGHVLELRLGNPFLHDD---- 104
           E E LL FK  + DP   L+ W+     C W G+ CN+S+  V+ + L    +       
Sbjct: 30  ELELLLSFKSSINDPLKYLSNWNSSADVCLWQGITCNNSS-RVVSIDLSGKNISGKISSA 88

Query: 105 ---EPFWLEDYKDETSKLIGKINPSLLDLKH-LVYLELSNNNFE---------------- 144
               P+ ++      ++L G I   +      L YL LSNNNF                 
Sbjct: 89  IFRLPY-IQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDL 147

Query: 145 -----KAQLPVFLGSMGSLRHIDLSRAEFTGMIPYQLGNLSNLQYLDLSS-----QIPLS 194
                  ++P  +GS  SL+ +DL      G IP  L NL++L++L L+S     QIP  
Sbjct: 148 SNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRE 207

Query: 195 FLYLENLSW-------LSG--------LSLLKHLD-----LTGV------DLSTASDWFL 228
              +++L W       LSG        L+ L HLD     LTG       +L      FL
Sbjct: 208 LGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFL 267

Query: 229 VTNML-----PS------LQVLKLSACSLHNSLPELPIANFSSLYTLDLSYNEFDNTL 275
             N L     PS      L  L LS  SL   +PEL +    +L  L L  N F   +
Sbjct: 268 YQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPEL-VIQLQNLEILHLFSNNFTGKI 324


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 275
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.95
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.84
PLN03150623 hypothetical protein; Provisional 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.62
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.61
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.55
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.53
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.45
KOG0617264 consensus Ras suppressor protein (contains leucine 99.45
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.43
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.42
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.41
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.38
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.37
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.36
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.35
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.32
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.3
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.29
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.28
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.25
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 99.19
PLN03150623 hypothetical protein; Provisional 99.17
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.14
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.14
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.13
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.09
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.03
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.01
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.01
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.95
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.91
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.85
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.84
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.79
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.74
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.73
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.59
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.58
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.53
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.45
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.36
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.34
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.29
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.23
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.19
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.18
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.16
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.13
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.1
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.08
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.08
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.92
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.91
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.89
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.88
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.83
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.79
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.72
PRK15386 426 type III secretion protein GogB; Provisional 97.6
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 97.41
PRK15386 426 type III secretion protein GogB; Provisional 97.23
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.16
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.76
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.07
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.7
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.72
KOG4308 478 consensus LRR-containing protein [Function unknown 94.44
KOG4308 478 consensus LRR-containing protein [Function unknown 94.3
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.14
KOG1947 482 consensus Leucine rich repeat proteins, some prote 94.03
KOG1947 482 consensus Leucine rich repeat proteins, some prote 93.44
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.63
KOG0473 326 consensus Leucine-rich repeat protein [Function un 91.2
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.98
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 89.56
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.12
smart0037026 LRR Leucine-rich repeats, outliers. 89.12
KOG0473 326 consensus Leucine-rich repeat protein [Function un 88.82
KOG4341483 consensus F-box protein containing LRR [General fu 88.46
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 81.9
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 80.84
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.95  E-value=9.5e-28  Score=237.00  Aligned_cols=220  Identities=30%  Similarity=0.449  Sum_probs=148.9

Q ss_pred             CHHHHHHHHHHHhcCCCCCCCCCCC-CCCCCcccCceEecCCCCcEEEEEcCCCCCCCCCc------cccccccCCCCcc
Q 041140           47 IQSEREALLRFKQDLKDPANRLALW-SDGNCCTWAGVVCNDSTGHVLELRLGNPFLHDDEP------FWLEDYKDETSKL  119 (275)
Q Consensus        47 ~~~~~~~L~~~~~~~~~~~~~~~~W-~~~~~c~w~gv~c~~~~~~v~~l~l~~~~~~~l~~------~~L~~l~l~~n~l  119 (275)
                      .++|+.+|.+||+++.+|...+.+| ...+||.|.||+|++ .++|+.|+++++.+.+...      ..|+.|++++|++
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~  105 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWNSSADVCLWQGITCNN-SSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQL  105 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCCCCCCCCcCcceecCC-CCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCcc
Confidence            4589999999999998787778899 567899999999986 5799999999988765322      3567777788877


Q ss_pred             eeecCcccc-CCCCCCEEECCCCCCCCC---------------------CcchhhhCCccCCEEECCCCCCCCCCccccc
Q 041140          120 IGKINPSLL-DLKHLVYLELSNNNFEKA---------------------QLPVFLGSMGSLRHIDLSRAEFTGMIPYQLG  177 (275)
Q Consensus       120 ~~~lp~~l~-~l~~L~~L~Ls~n~l~~~---------------------~~p~~~~~l~~L~~L~L~~n~l~~~lp~~l~  177 (275)
                      +|.+|..+. .+++|++|++++|.+++.                     .+|..++.+++|++|++++|.+.+.+|..++
T Consensus       106 ~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~  185 (968)
T PLN00113        106 SGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLT  185 (968)
T ss_pred             CCcCChHHhccCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhh
Confidence            777776544 566666666666655543                     1455555555666666666655555555555


Q ss_pred             CCCCCCeEEcccCCCCCcccccccccccCCCCCCeeeccCCCCCCCCchhhhhCCCCCCcEEeccCCcCCCCCCCcccCC
Q 041140          178 NLSNLQYLDLSSQIPLSFLYLENLSWLSGLSLLKHLDLTGVDLSTASDWFLVTNMLPSLQVLKLSACSLHNSLPELPIAN  257 (275)
Q Consensus       178 ~l~~L~~L~Ls~n~~~~~~~~~~l~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~l~~  257 (275)
                      ++++|++|++++|.+.+..|..    ++++++|+.|++++|.+++.  .+..++.+++|++|++++|.+++. .|..++.
T Consensus       186 ~l~~L~~L~L~~n~l~~~~p~~----l~~l~~L~~L~L~~n~l~~~--~p~~l~~l~~L~~L~L~~n~l~~~-~p~~l~~  258 (968)
T PLN00113        186 NLTSLEFLTLASNQLVGQIPRE----LGQMKSLKWIYLGYNNLSGE--IPYEIGGLTSLNHLDLVYNNLTGP-IPSSLGN  258 (968)
T ss_pred             hCcCCCeeeccCCCCcCcCChH----HcCcCCccEEECcCCccCCc--CChhHhcCCCCCEEECcCceeccc-cChhHhC
Confidence            6666666666665555444444    56666666666666666654  233556666777777777766665 4446667


Q ss_pred             CCCcCEEecccCcCcee
Q 041140          258 FSSLYTLDLSYNEFDNT  274 (275)
Q Consensus       258 l~~L~~L~L~~N~l~g~  274 (275)
                      +++|++|++++|.++|.
T Consensus       259 l~~L~~L~L~~n~l~~~  275 (968)
T PLN00113        259 LKNLQYLFLYQNKLSGP  275 (968)
T ss_pred             CCCCCEEECcCCeeecc
Confidence            77777777777766653



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query275
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-09
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 5e-04
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 7e-04
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-04
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 6e-04
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Iteration: 1

Score = 58.2 bits (139), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 41/150 (27%), Positives = 70/150 (46%), Gaps = 14/150 (9%) Query: 46 CIQSEREALLRFKQDLKDPANRLALWSDGNCC--TWAGVVCNDSTGHVLELRLGNPFLHD 103 C +++ALL+ K+DL +P + +CC TW GV+C+ T L L+ Sbjct: 3 CNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNL 62 Query: 104 DEPFWLED-----------YKDETSKLIGKINPSLLDLKHLVYLELSNNNFEKAQLPVFL 152 +P+ + Y + L+G I P++ L L YL +++ N A +P FL Sbjct: 63 PKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGA-IPDFL 121 Query: 153 GSMGSLRHIDLSRAEFTGMIPYQLGNLSNL 182 + +L +D S +G +P + +L NL Sbjct: 122 SQIKTLVTLDFSYNALSGTLPPSISSLPNL 151
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query275
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-44
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-18
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-15
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-32
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-16
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-16
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-16
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-14
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-14
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-14
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 4e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-09
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-04
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-04
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 9e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-12
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-10
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-07
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-07
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-11
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-09
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-06
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-11
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-11
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-10
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-10
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-09
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-07
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-07
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-09
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-09
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-09
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 1e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-07
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-09
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 9e-08
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 9e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 3e-08
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 4e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 7e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 7e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 8e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 6e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 7e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  158 bits (403), Expect = 2e-44
 Identities = 59/231 (25%), Positives = 98/231 (42%), Gaps = 30/231 (12%)

Query: 45  GCIQSEREALLRFKQDLKDPANRLALWSDG-NCCTWAGVVCNDSTGHVLELRLGNPFLHD 103
             +  E   L+ FK  L D  N L  WS   N CT+ GV C      V  + L +  L  
Sbjct: 8   QSLYREIHQLISFKDVLPDK-NLLPDWSSNKNPCTFDGVTCR--DDKVTSIDLSSKPL-- 62

Query: 104 DEPFWLEDYKDETSKLIGKINPSLLDLKHLVYLELSNNNFEKAQLPVFLGSMGSLRHIDL 163
                        +     ++ SLL L  L  L LSN++     +  F     SL  +DL
Sbjct: 63  -------------NVGFSAVSSSLLSLTGLESLFLSNSHIN-GSVSGF-KCSASLTSLDL 107

Query: 164 SRAEFTGMIP--YQLGNLSNLQYLDLSSQIPLSFLYLENLSWLSGLSLLKHLDLTGVDLS 221
           SR   +G +     LG+ S L++L++SS    +  +   +S    L+ L+ LDL+   +S
Sbjct: 108 SRNSLSGPVTTLTSLGSCSGLKFLNVSS---NTLDFPGKVSGGLKLNSLEVLDLSANSIS 164

Query: 222 -TASDWFLVTNMLPSLQVLKLSACSLHNSLPELPIANFSSLYTLDLSYNEF 271
                 +++++    L+ L +S   +      + ++   +L  LD+S N F
Sbjct: 165 GANVVGWVLSDGCGELKHLAISGNKISGD---VDVSRCVNLEFLDVSSNNF 212


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query275
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.95
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.87
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.86
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.86
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.86
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.85
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.85
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.85
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.85
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.84
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.84
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.84
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.83
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.83
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.83
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.82
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.82
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.82
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.82
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.82
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.82
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.82
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.81
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.81
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.81
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.81
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.81
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.8
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.8
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.8
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.8
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.8
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.8
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.8
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.8
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.8
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.8
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.8
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.8
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.8
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.8
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.79
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.79
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.79
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.78
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.77
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.77
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.77
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.77
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.77
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.77
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.77
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.77
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.75
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.75
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.75
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.74
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.74
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.73
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.73
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.71
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.7
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.7
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.7
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.7
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.7
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.7
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.68
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.68
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.67
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.67
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.67
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.66
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.65
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.65
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.64
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.64
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.63
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.62
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.57
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.56
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.55
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.54
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.52
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.51
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.48
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.46
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.43
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.42
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.3
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.28
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.27
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.21
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.16
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.1
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.02
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.0
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.94
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.84
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.82
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.79
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.7
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.58
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.53
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.4
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.25
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.67
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.65
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.36
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.13
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.04
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.96
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.52
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.46
4fs7_A 394 Uncharacterized protein; leucine-rich repeats, pro 96.08
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.73
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=2.4e-33  Score=242.32  Aligned_cols=222  Identities=25%  Similarity=0.399  Sum_probs=169.1

Q ss_pred             CCCHHHHHHHHHHHhcCCCCCCCCCCC-CCCCCcc--cCceEecCCC--CcEEEEEcCCCCCCC---CCc-----ccccc
Q 041140           45 GCIQSEREALLRFKQDLKDPANRLALW-SDGNCCT--WAGVVCNDST--GHVLELRLGNPFLHD---DEP-----FWLED  111 (275)
Q Consensus        45 ~~~~~~~~~L~~~~~~~~~~~~~~~~W-~~~~~c~--w~gv~c~~~~--~~v~~l~l~~~~~~~---l~~-----~~L~~  111 (275)
                      .|.++|++||.+||+++.+|. .+.+| .+.+||.  |.||+|+...  ++|++++++++.+.+   +..     ..|+.
T Consensus         2 ~c~~~~~~aL~~~k~~~~~~~-~l~~W~~~~~~C~~~w~gv~C~~~~~~~~l~~L~L~~~~l~~~~~~~~~l~~l~~L~~   80 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLGNPT-TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNF   80 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTCSE
T ss_pred             CCCHHHHHHHHHHHHhcCCcc-cccCCCCCCCCCcCCCcceEeCCCCCCceEEEEECCCCCccCCcccChhHhCCCCCCe
Confidence            588999999999999998776 67899 5678998  9999998644  899999999999875   221     36778


Q ss_pred             ccCCC-CcceeecCccccCCCCCCEEECCCCCCCCCCcchhhhCCccCCEEECCCCCCCCCCcccccCCCCCCeEEcccC
Q 041140          112 YKDET-SKLIGKINPSLLDLKHLVYLELSNNNFEKAQLPVFLGSMGSLRHIDLSRAEFTGMIPYQLGNLSNLQYLDLSSQ  190 (275)
Q Consensus       112 l~l~~-n~l~~~lp~~l~~l~~L~~L~Ls~n~l~~~~~p~~~~~l~~L~~L~L~~n~l~~~lp~~l~~l~~L~~L~Ls~n  190 (275)
                      |++++ |.+.+.+|..++++++|++|++++|.+++. +|..+..+++|++|++++|.+.+.+|..++.+++|++|++++|
T Consensus        81 L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~-~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N  159 (313)
T 1ogq_A           81 LYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGA-IPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGN  159 (313)
T ss_dssp             EEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEE-CCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSS
T ss_pred             eeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCc-CCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCCCeEECcCC
Confidence            88884 888888888888888888888888888865 7888888888888888888888888888888888888888888


Q ss_pred             CCCCcccccccccccCCC-CCCeeeccCCCCCCC-Cc--------------------hhhhhCCCCCCcEEeccCCcCCC
Q 041140          191 IPLSFLYLENLSWLSGLS-LLKHLDLTGVDLSTA-SD--------------------WFLVTNMLPSLQVLKLSACSLHN  248 (275)
Q Consensus       191 ~~~~~~~~~~l~~l~~l~-~L~~L~L~~n~l~~~-~~--------------------~~~~~~~l~~L~~L~L~~n~l~~  248 (275)
                      .+.+..|..    +..++ +|++|++++|.+++. +.                    .+..+..+++|+.|++++|++++
T Consensus       160 ~l~~~~p~~----l~~l~~~L~~L~L~~N~l~~~~~~~~~~l~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~  235 (313)
T 1ogq_A          160 RISGAIPDS----YGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAF  235 (313)
T ss_dssp             CCEEECCGG----GGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECC
T ss_pred             cccCcCCHH----HhhhhhcCcEEECcCCeeeccCChHHhCCcccEEECcCCcccCcCCHHHhcCCCCCEEECCCCceee
Confidence            776555544    55555 566666666655532 11                    13355666777777777777766


Q ss_pred             CCCCcccCCCCCcCEEecccCcCcee
Q 041140          249 SLPELPIANFSSLYTLDLSYNEFDNT  274 (275)
Q Consensus       249 ~~~~~~l~~l~~L~~L~L~~N~l~g~  274 (275)
                      . ++ .+..+++|++|++++|+++|.
T Consensus       236 ~-~~-~~~~l~~L~~L~Ls~N~l~~~  259 (313)
T 1ogq_A          236 D-LG-KVGLSKNLNGLDLRNNRIYGT  259 (313)
T ss_dssp             B-GG-GCCCCTTCCEEECCSSCCEEC
T ss_pred             e-cC-cccccCCCCEEECcCCcccCc
Confidence            5 33 266677777777777777764



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 275
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-04
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 57.1 bits (136), Expect = 4e-10
 Identities = 35/143 (24%), Positives = 58/143 (40%), Gaps = 20/143 (13%)

Query: 46  CIQSEREALLRFKQDLKDPANRLALWSDGNCC--TWAGVVCNDSTG--HVLELRLGNPFL 101
           C   +++ALL+ K+DL +P    +     +CC  TW GV+C+  T    V  L L    L
Sbjct: 3   CNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNL 62

Query: 102 HDDEPFWLEDYKDETSKLIGKINPSLLDLKHLVYLELSNNNFEKAQLPVFLGSMGSLRHI 161
               P                I  SL +L +L +L +   N     +P  +  +  L ++
Sbjct: 63  PKPYP----------------IPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYL 106

Query: 162 DLSRAEFTGMIPYQLGNLSNLQY 184
            ++    +G IP  L  +  L  
Sbjct: 107 YITHTNVSGAIPDFLSQIKTLVT 129


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query275
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.82
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.78
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.77
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.77
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.68
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.67
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.65
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.64
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.61
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.61
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.6
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.58
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.45
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.43
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.38
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.38
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.28
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.27
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.26
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.25
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.17
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.15
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.07
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.04
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.7
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.6
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.54
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.44
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.2
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.16
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.71
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.65
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=3.3e-34  Score=245.37  Aligned_cols=225  Identities=23%  Similarity=0.387  Sum_probs=182.3

Q ss_pred             CCCHHHHHHHHHHHhcCCCCCCCCCCC-CCCCCcc--cCceEecCCC--CcEEEEEcCCCCCCCCC---c-----ccccc
Q 041140           45 GCIQSEREALLRFKQDLKDPANRLALW-SDGNCCT--WAGVVCNDST--GHVLELRLGNPFLHDDE---P-----FWLED  111 (275)
Q Consensus        45 ~~~~~~~~~L~~~~~~~~~~~~~~~~W-~~~~~c~--w~gv~c~~~~--~~v~~l~l~~~~~~~l~---~-----~~L~~  111 (275)
                      -|.++|++||++||+++.+|. .+++| .++|||.  |.||+|+...  .||++|+|+++.+.+..   .     ..|++
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~   80 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNF   80 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTCSE
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-cCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChHHhcCccccc
Confidence            488999999999999998774 57899 6789994  9999998643  48999999999887532   1     36888


Q ss_pred             ccCCC-CcceeecCccccCCCCCCEEECCCCCCCCCCcchhhhCCccCCEEECCCCCCCCCCcccccCCCCCCeEEcccC
Q 041140          112 YKDET-SKLIGKINPSLLDLKHLVYLELSNNNFEKAQLPVFLGSMGSLRHIDLSRAEFTGMIPYQLGNLSNLQYLDLSSQ  190 (275)
Q Consensus       112 l~l~~-n~l~~~lp~~l~~l~~L~~L~Ls~n~l~~~~~p~~~~~l~~L~~L~L~~n~l~~~lp~~l~~l~~L~~L~Ls~n  190 (275)
                      |++++ |+++|.+|++++++++|++|++++|.+.+. .+..+..+.+|+++++++|.+.+.+|..++.+++++++++++|
T Consensus        81 L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~-~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n  159 (313)
T d1ogqa_          81 LYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGA-IPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGN  159 (313)
T ss_dssp             EEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEE-CCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSS
T ss_pred             cccccccccccccccccccccccchhhhcccccccc-ccccccchhhhcccccccccccccCchhhccCcccceeecccc
Confidence            89986 899999999999999999999999999886 6677778888888888888888778888888888888888877


Q ss_pred             CCCCcccccc--------------------------------------------cccccCCCCCCeeeccCCCCCCCCch
Q 041140          191 IPLSFLYLEN--------------------------------------------LSWLSGLSLLKHLDLTGVDLSTASDW  226 (275)
Q Consensus       191 ~~~~~~~~~~--------------------------------------------l~~l~~l~~L~~L~L~~n~l~~~~~~  226 (275)
                      .+.+..|...                                            ...+..+++++.+++++|.+.+.+  
T Consensus       160 ~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~--  237 (313)
T d1ogqa_         160 RISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDL--  237 (313)
T ss_dssp             CCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBG--
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc--
Confidence            6554322210                                            012345667778888888777763  


Q ss_pred             hhhhCCCCCCcEEeccCCcCCCCCCCcccCCCCCcCEEecccCcCceeC
Q 041140          227 FLVTNMLPSLQVLKLSACSLHNSLPELPIANFSSLYTLDLSYNEFDNTL  275 (275)
Q Consensus       227 ~~~~~~l~~L~~L~L~~n~l~~~~~~~~l~~l~~L~~L~L~~N~l~g~i  275 (275)
                       ..+..+++|+.|++++|+++|. .|..++++++|++|+|++|+|+|+|
T Consensus       238 -~~~~~~~~L~~L~Ls~N~l~g~-iP~~l~~L~~L~~L~Ls~N~l~g~i  284 (313)
T d1ogqa_         238 -GKVGLSKNLNGLDLRNNRIYGT-LPQGLTQLKFLHSLNVSFNNLCGEI  284 (313)
T ss_dssp             -GGCCCCTTCCEEECCSSCCEEC-CCGGGGGCTTCCEEECCSSEEEEEC
T ss_pred             -cccccccccccccCccCeeccc-CChHHhCCCCCCEEECcCCcccccC
Confidence             2677889999999999999988 5668999999999999999999975



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure