Citrus Sinensis ID: 041155


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-
MIRCIDEEREAVLTFKESLVDESGVLSSWGPEDEKRDCCKWTGVGCSNRTGHVIKLEIQPIDFDSFPLRVFPILLIITMTVGIRLLQQLFLLVILLQLEPRVADSNNMIRCIDEEREALLTFKESLVDESGVLSSWGPEDEKRDRCKWAGVGCSNRTGHVIKLEIQPIDFGSFPLRGTISPALLQLHRLTYLDLSLNNFSGSPIPEFIGSLTKLSYLDLSFAEFEGPIPSHLGNLSALQHLDLSLNHLFSVGNLDWLSHLSSLTYLDLGSNNLSRSTDWLQVVGNLPLLTTLYLYRCHLPPIVPLSLSNLNYSTSLQFLELSENNLTNSIYPYNLVLLGLDSNLLRGSIPVAFKHMVSLSFLGLASNEFEGGVPDFFANMCSLTMLNISDNKLRGHFPELIQNLSSGCTKNSLEMLYLSSNEITGSVPDLGGFSSLKELYLENNRLNGFTNNSIGQMSKLRTLSLNGNSLR
cccccHHHHHHHHHHHHcccccccccccccccccccccccccEEEcccccccEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccccccccccccccccccEEEEEccccccEEEEEEccccccccccEEEccccccccccccEEEccccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHHccccccEEEcccccccccccHHHHHcccccccEEEccccccccccccccccccccccccEEEccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEccccccccccHHHHHHcccccccccccEEEccccccccccccccccccccEEEcccccccccccHHccccccccEEEccccccc
ccccccHHHHHHHHHHHHccccccccccccccccccccccEEEEEEccccccEEEEEEcccccccccccccHHHcccccccEEEcccccccccccccccEEEcccccccccccHHHHHHHHHHHHHHccccccccccccHccccccEEEEEcccccccccccccccEEEcccccccccccHHHcccccccEEEccccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHHHccccccEEEcccccccccccccHHHccccccEEEEEccccccccccHHHcccccccccEEEEcccccccccccHHHcEEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccHHcccccccEEEEcccccccccccccccccccEEEcccccccccccHHHcccccccEEEccccccc
MIRCIDEEREAVLTFKESLVdesgvlsswgpedekrdcckwtgvgcsnrtghvikleiqpidfdsfplrvfPILLIITMTVGIRLLQQLFLLVILLQleprvadsnnmIRCIDEEREALLTFKESLVdesgvlsswgpedekrdrckwagvgcsnrtghvikleiqpidfgsfplrgtispaLLQLHRLTYLDlslnnfsgspipefigsltklsyldlsfaefegpipshlgnlsALQHLDLSLNHlfsvgnldwlshlssltyldlgsnnlsrstdwlqvvgnlpllttlylyrchlppivplslsnlnystSLQFLELSEnnltnsiypyNLVLLGLdsnllrgsiPVAFKHMVSLSFLGlasnefeggvpdfFANMCSLTmlnisdnklrgHFPELIQNlssgctknsLEMLYLSSneitgsvpdlggfsslkELYLennrlngftnnsigqmSKLRTLSLNGNSLR
MIRCIDEEREAVLtfkeslvdesgvlsswgpedekrdcCKWTGVGCSNRTGHVIKLEIQPIDFDSFPLRVFPILLIITMTVGIRLLQQLFLLVILLQLEPRVADSNNMIRCIDEEREALLTFkeslvdesgvlsswgpedekrdrcKWAGVGCSNRTGHVIKLEIQPIDFGSFPLRGTISPALLQLHRLTYLDLSLNNFSGSPIPEFIGSLTKLSYLDLSFAEFEGPIPSHLGNLSALQHLDLSLNHLFSVGNLDWLSHLSSLTYLDLGSNNLSRSTDWLQVVGNLPLLTTLYLYRCHLPPIVPLSLSNLNYSTSLQFLELSENNLTNSIYPYNLVLLGLDSNLLRGSIPVAFKHMVSLSFLGLASNEFEGGVPDFFANMCSLTMLNISDNKLRGHFPELIQNLSSGCTKNSLEMLYLSSNEITGSVPDLGGFSSLKELYLENNRLNGftnnsigqmsklrtlslngnslr
MIRCIDEEREAVLTFKESLVDESGVLSSWGPEDEKRDCCKWTGVGCSNRTGHVIKLEIQPIDFDSFPLRVFPILLIITMTVGIRllqqlfllvillqlEPRVADSNNMIRCIDEEREALLTFKESLVDESGVLSSWGPEDEKRDRCKWAGVGCSNRTGHVIKLEIQPIDFGSFPLRGTISPALLQLHRLTYLDLSLNNFSGSPIPEFIGSLTKLSYLDLSFAEFEGPIPSHLGNLSALQHLDLSLNHLFSVGNLDWLSHLSSLTYLDLGSNNLSRSTDWLQVVGNLPLLTTLYLYRCHLPPIVPlslsnlnystslQFLELSENNLTNSIYPYNlvllgldsnllRGSIPVAFKHMVSLSFLGLASNEFEGGVPDFFANMCSLTMLNISDNKLRGHFPELIQNLSSGCTKNSLEMLYLSSNEITGSVPDLGGFSSLKELYLENNRLNGFTNNSIGQMSKLRTLSLNGNSLR
**********AVLTFKESLVDESGVLSSWGPEDEKRDCCKWTGVGCSNRTGHVIKLEIQPIDFDSFPLRVFPILLIITMTVGIRLLQQLFLLVILLQLEPRVADSNNMIRCIDEEREALLTFKESLVDESGVLSSWG*****RDRCKWAGVGCSNRTGHVIKLEIQPIDFGSFPLRGTISPALLQLHRLTYLDLSLNNFSGSPIPEFIGSLTKLSYLDLSFAEFEGPIPSHLGNLSALQHLDLSLNHLFSVGNLDWLSHLSSLTYLDLGSNNLSRSTDWLQVVGNLPLLTTLYLYRCHLPPIVPLSLSNLNYSTSLQFLELSENNLTNSIYPYNLVLLGLDSNLLRGSIPVAFKHMVSLSFLGLASNEFEGGVPDFFANMCSLTMLNISDNKLRGHFPELIQNLSSGCTKNSLEMLYLSSNEITGSVPDLGGFSSLKELYLENNRLNGFT*********************
*IRCIDEEREAVLTFKESLVDESGVLSSWGPEDEKRDCCKWTGVGCSNRTGHVIKLEIQPIDFDSFPLRVF*ILLIITMTVGIRLLQQLFLLVILLQLEPRVAD*N*******EEREALLTFKESLVDESGVLSSWGPEDEKRDRCKWAGVGCSNRTGHVIKLEIQPIDFGSFPLRGTISPALLQLHRLTYLDLSLNNFSGSPIPEFIGSLTKLSYLDLSFAEFEGPIPSHLGNLSALQHLDLSLNHLFSVGNLDWLSHLSSLTYLDLGSNNLSRSTDWLQVVGNLPLLTTLYLYRCHLPPIVPLSLSNLNYSTSLQFLELSENNLTNSIYPYNLVLLGLDSNLLRGSIPVAFKHMVSLSFLGLASNEFEGGVPDFFANMCSLTMLNISDNKLRGHFPELIQNLSSGCTKNSLEMLYLSSNEITGSVPDLGGFSSLKELYLENNRLNGFTNNSIGQMSKLRTLSLNGNSL*
MIRCIDEEREAVLTFKESLVDESGVLSSWGPEDEKRDCCKWTGVGCSNRTGHVIKLEIQPIDFDSFPLRVFPILLIITMTVGIRLLQQLFLLVILLQLEPRVADSNNMIRCIDEEREALLTFKESLVDESGVLSSWGPEDEKRDRCKWAGVGCSNRTGHVIKLEIQPIDFGSFPLRGTISPALLQLHRLTYLDLSLNNFSGSPIPEFIGSLTKLSYLDLSFAEFEGPIPSHLGNLSALQHLDLSLNHLFSVGNLDWLSHLSSLTYLDLGSNNLSRSTDWLQVVGNLPLLTTLYLYRCHLPPIVPLSLSNLNYSTSLQFLELSENNLTNSIYPYNLVLLGLDSNLLRGSIPVAFKHMVSLSFLGLASNEFEGGVPDFFANMCSLTMLNISDNKLRGHFPELIQNLSSGCTKNSLEMLYLSSNEITGSVPDLGGFSSLKELYLENNRLNGFTNNSIGQMSKLRTLSLNGNSLR
**RCIDEEREAVLTFKESLVDESGVLSSWGPEDEKRDCCKWTGVGCSNRTGHVIKLEIQPIDFDSFPLRVFPILLIITMTVGIRLLQQLFLLVILLQLEPRVADSNNMIRCIDEEREALLTFKESLVDESGVLSSWGPEDEKRDRCKWAGVGCSNRTGHVIKLEIQPIDFGSFPLRGTISPALLQLHRLTYLDLSLNNFSGSPIPEFIGSLTKLSYLDLSFAEFEGPIPSHLGNLSALQHLDLSLNHLFSVGNLDWLSHLSSLTYLDLGSNNLSRSTDWLQVVGNLPLLTTLYLYRCHLPPIVPLSLSNLNYSTSLQFLELSENNLTNSIYPYNLVLLGLDSNLLRGSIPVAFKHMVSLSFLGLASNEFEGGVPDFFANMCSLTMLNISDNKLRGHFPELIQNLSSGCTKNSLEMLYLSSNEITGSVPDLGGFSSLKELYLENNRLNGFTNNSIGQMSKLRTLSLN*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIRCIDEEREAVLTFKESLVDESGVLSSWGPEDEKRDCCKWTGVGCSNRTGHVIKLEIQPIDFDSFPLRVFPILLIITMTVGIRLLQQLFLLVILLQLEPRVADSNNMIRCIDEEREALLTFKESLVDESGVLSSWGPEDEKRDRCKWAGVGCSNRTGHVIKLEIQPIDFGSFPLRGTISPALLQLHRLTYLDLSLNNFSGSPIPEFIGSLTKLSYLDLSFAEFEGPIPSHLGNLSALQHLDLSLNHLFSVGNLDWLSHLSSLTYLDLGSNNLSRSTDWLQVVGNLPLLTTLYLYRCHLPPIVPLSLSNLNYSTSLQFLELSENNLTNSIYPYNLVLLGLDSNLLRGSIPVAFKHMVSLSFLGLASNEFEGGVPDFFANMCSLTMLNISDNKLRGHFPELIQNLSSGCTKNSLEMLYLSSNEITGSVPDLGGFSSLKELYLENNRLNGFTNNSIGQMSKLRTLSLNGNSLR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query471 2.2.26 [Sep-21-2011]
Q9LP24 1120 Probable leucine-rich rep no no 0.685 0.288 0.336 7e-31
C0LGT6 1031 LRR receptor-like serine/ no no 0.717 0.327 0.327 1e-30
Q9C9H7 847 Receptor-like protein 12 no no 0.768 0.427 0.317 5e-30
Q9SHI2 1101 Leucine-rich repeat recep no no 0.673 0.287 0.294 2e-29
C0LGW6 966 LRR receptor-like serine/ no no 0.723 0.353 0.318 4e-29
Q9LRT1 1016 Probably inactive leucine no no 0.692 0.320 0.319 5e-29
Q42371 976 LRR receptor-like serine/ no no 0.730 0.352 0.305 2e-28
Q6XAT2 967 LRR receptor-like serine/ no no 0.721 0.351 0.311 2e-28
C0LGP4 1010 Probable LRR receptor-lik no no 0.721 0.336 0.309 3e-28
P93194 1109 Receptor-like protein kin N/A no 0.673 0.285 0.322 2e-27
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function desciption
 Score =  135 bits (340), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 127/377 (33%), Positives = 179/377 (47%), Gaps = 54/377 (14%)

Query: 115 EREALLTFKESLVDESGVLSSWGPEDEKRDR---CKWAGVGCSNRTGHVIKLEIQPIDFG 171
           E  ALL +K +  + S  LSSW  +           W GV C++R        I+ ++  
Sbjct: 33  EANALLKWKSTFTNSSK-LSSWVHDANTNTSFSCTSWYGVSCNSRG------SIEELNLT 85

Query: 172 SFPLRGTISP-ALLQLHRLTYLDLSLNNFSGSPIPEFIGSLTKLSYLDLSFAEFEGPIPS 230
           +  + GT      + L  L Y+DLS+N  SG+  P+F G+L+KL Y DLS     G I  
Sbjct: 86  NTGIEGTFQDFPFISLSNLAYVDLSMNLLSGTIPPQF-GNLSKLIYFDLSTNHLTGEISP 144

Query: 231 HLGNLSALQHLDLSLNHLFSVGNLDWLSHLSSLTYLDLGSNNLSRSTDWLQVVGNLPLLT 290
            LGNL  L  L L  N+L SV   + L ++ S+T L L  N L+ S      +GNL  L 
Sbjct: 145 SLGNLKNLTVLYLHQNYLTSVIPSE-LGNMESMTDLALSQNKLTGSIP--SSLGNLKNLM 201

Query: 291 TLYLYRCHLPPIVPLSLSNLNYSTSLQFLELSENNLTNSI-------------YPYNLVL 337
            LYLY  +L  ++P  L N+    S+  L LS+N LT SI             Y Y   L
Sbjct: 202 VLYLYENYLTGVIPPELGNME---SMTDLALSQNKLTGSIPSTLGNLKNLMVLYLYENYL 258

Query: 338 LG----------------LDSNLLRGSIPVAFKHMVSLSFLGLASNEFEGGVPDFFANMC 381
            G                L  N L GSIP +  ++ +L+ L L  N   GG+P    N+ 
Sbjct: 259 TGVIPPEIGNMESMTNLALSQNKLTGSIPSSLGNLKNLTLLSLFQNYLTGGIPPKLGNIE 318

Query: 382 SLTMLNISDNKLRGHFPELIQNLSSGCTKNSLEMLYLSSNEITGSV-PDLGGFSSLKELY 440
           S+  L +S+NKL G  P  + NL       +L +LYL  N +TG + P+LG   S+ +L 
Sbjct: 319 SMIDLELSNNKLTGSIPSSLGNLK------NLTILYLYENYLTGVIPPELGNMESMIDLQ 372

Query: 441 LENNRLNGFTNNSIGQM 457
           L NN+L G   +S G +
Sbjct: 373 LNNNKLTGSIPSSFGNL 389





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description
>sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 Back     alignment and function description
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query471
225464712 1021 PREDICTED: receptor-like protein 12-like 0.764 0.352 0.451 1e-83
224105895 963 predicted protein [Populus trichocarpa] 0.766 0.374 0.505 4e-82
359490572 975 PREDICTED: probable LRR receptor-like se 0.823 0.397 0.428 8e-78
224125666 938 predicted protein [Populus trichocarpa] 0.785 0.394 0.483 6e-75
147807651 971 hypothetical protein VITISV_018647 [Viti 0.774 0.375 0.417 1e-74
359490576 972 PREDICTED: LRR receptor-like serine/thre 0.732 0.354 0.413 4e-74
224116866 994 predicted protein [Populus trichocarpa] 0.751 0.356 0.464 2e-70
224105891 1036 predicted protein [Populus trichocarpa] 0.751 0.341 0.464 3e-70
225462661 1485 PREDICTED: LRR receptor-like serine/thre 0.723 0.229 0.430 2e-69
359488639 1097 PREDICTED: LRR receptor-like serine/thre 0.957 0.411 0.383 2e-67
>gi|225464712|ref|XP_002276171.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  317 bits (811), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 189/419 (45%), Positives = 246/419 (58%), Gaps = 59/419 (14%)

Query: 111 CIDEEREALLTFKESLVDESGVLSSWGPEDEKRDRCKWAGVGCSNRTGHVIKLEIQPIDF 170
           C+++ER+ALL FK+ LVD+ G+LSSWG E+++RD CKW GV CSNRT HVI L++  +  
Sbjct: 52  CVEKERQALLDFKQGLVDDFGILSSWGNEEDRRDCCKWRGVQCSNRTSHVIMLDLHALPT 111

Query: 171 GSF----PLRGTISPALLQLHRLTYLDLSLNNFSGSPIPEFIGSLTKLSYLDLSFAEFEG 226
            +      LRG IS +LL+L  L +LDLSLN+F GS +PEFIG  +KL YL+LS A   G
Sbjct: 112 DTVHKYQSLRGRISSSLLELQHLNHLDLSLNDFQGSYVPEFIGLFSKLRYLNLSEARLAG 171

Query: 227 PIPSHLGNLSALQHLDLSLNHLFSVGNLDWLSHLSSLTYLDLGSNNLSRSTDWLQVVGNL 286
            IPSHLGNLS L  LDLS N+  S   L+WLS LSSL +LDL   NL ++  W  V+  L
Sbjct: 172 MIPSHLGNLSNLHFLDLSRNYGMSSETLEWLSRLSSLRHLDLSGLNLDKAIYWEHVINRL 231

Query: 287 PLLTTLYLYRCHLPPIV-PLSLSNLNYSTSLQFLELSENNLTNSIYPY------------ 333
           P LT L L+   LP I+ P +LS  N S SL  L+LS N L++S+YP+            
Sbjct: 232 PSLTDLLLHDSALPQIITPSALSYTNSSKSLVVLDLSWNFLSSSVYPWLFNLSSSLVHLD 291

Query: 334 -----------------------------------------NLVLLGLDSNLLRGSIPVA 352
                                                    +LV L L  N L GSIP  
Sbjct: 292 LSINQIQGLIPDTFGEMVSLEYLDLFFNQLEGEIPQSLTSTSLVHLDLSVNHLHGSIPDT 351

Query: 353 FKHMVSLSFLGLASNEFEGGVPDFFANMCSLTMLNISDNKLRGHFPELIQNLSSGCTKNS 412
           F HM SLS+L L+ N+ EGG+P  F N+CSL M+ +  N L    PE +QN S  C+K++
Sbjct: 352 FGHMTSLSYLDLSLNQLEGGIPKSFKNLCSLQMVMLLSNSLTAQLPEFVQN-SLSCSKDT 410

Query: 413 LEMLYLSSNEITGSVPDLGGFSSLKELYLENNRLNGFTNNSIGQMSKLRTLSLNGNSLR 471
           LE+L LS N+ TGS P+  GFS L  LY+++NRLNG     IGQ+S+L  L ++GNSL 
Sbjct: 411 LEVLVLSWNQFTGSFPNFTGFSVLGHLYIDHNRLNGTFPEHIGQLSQLEVLEISGNSLH 469




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224105895|ref|XP_002333753.1| predicted protein [Populus trichocarpa] gi|222838401|gb|EEE76766.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359490572|ref|XP_003634116.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224125666|ref|XP_002329688.1| predicted protein [Populus trichocarpa] gi|222870596|gb|EEF07727.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147807651|emb|CAN64389.1| hypothetical protein VITISV_018647 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490576|ref|XP_003634117.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224116866|ref|XP_002331833.1| predicted protein [Populus trichocarpa] gi|222875071|gb|EEF12202.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224105891|ref|XP_002333752.1| predicted protein [Populus trichocarpa] gi|222838400|gb|EEE76765.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225462661|ref|XP_002266475.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488639|ref|XP_003633795.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query471
TAIR|locus:2044767 905 AT2G34930 "AT2G34930" [Arabido 0.751 0.391 0.376 1.1e-51
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.713 0.3 0.341 5.6e-34
TAIR|locus:2005507 976 ER "ERECTA" [Arabidopsis thali 0.719 0.347 0.314 2.6e-31
TAIR|locus:2090754 711 RLP43 "receptor like protein 4 0.607 0.402 0.320 1.1e-30
TAIR|locus:2825384 847 RLP12 "AT1G71400" [Arabidopsis 0.726 0.403 0.310 1.4e-30
TAIR|locus:2091353 1016 AT3G28040 [Arabidopsis thalian 0.717 0.332 0.307 1.6e-30
TAIR|locus:2149922 1031 EFR "EF-TU receptor" [Arabidop 0.717 0.327 0.327 1.2e-29
TAIR|locus:2043540 960 AT2G25790 [Arabidopsis thalian 0.717 0.352 0.324 1.3e-29
TAIR|locus:4515102753 598 AT1G73066 [Arabidopsis thalian 0.721 0.568 0.312 2.1e-29
TAIR|locus:2144392 957 RLP53 "receptor like protein 5 0.732 0.360 0.316 5.8e-29
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 543 (196.2 bits), Expect = 1.1e-51, P = 1.1e-51
 Identities = 145/385 (37%), Positives = 205/385 (53%)

Query:   110 RCIDEEREALLTFKESLVDESGVLSSW-GPEDEKRDRCKWAGVGCSNRTGHVIKLEI--- 165
             +CI  ER+ALLTF+ +L D S  L SW GP     D C W GV C  RT HV+K+++   
Sbjct:    32 KCISTERQALLTFRAALTDLSSRLFSWSGP-----DCCNWPGVLCDARTSHVVKIDLRNP 86

Query:   166 -QPI---DFGSFPLRGTISPALLQLHRLTYLDLSLNNFSGSPIPEFIGSLTKLSYLDLSF 221
              Q +   ++    LRG I P+L QL  L+YLDLS N+F+   IPEFIG +  L YL+LS 
Sbjct:    87 SQDVRSDEYKRGSLRGKIHPSLTQLKFLSYLDLSSNDFNELEIPEFIGQIVSLRYLNLSS 146

Query:   222 AEFEGPIPSHLGNLSALQHLDLSLNHLFSVG-------NLDWLSHLSS-LTYLDLGSNNL 273
             + F G IP+ LGNLS L+ LDL        G       NL WLS LSS L YL++G  NL
Sbjct:   147 SSFSGEIPTSLGNLSKLESLDLYAESFGDSGTLSLRASNLRWLSSLSSSLKYLNMGYVNL 206

Query:   274 SRSTD-WLQVVGNLPLLTTLYLYRCHLPPIVPXXXXXXXXXXXXQFLELSENNLTNSIYP 332
             S + + WLQ    +  L  L+L+   L  + P            + L+LSEN+L + I  
Sbjct:   207 SGAGETWLQDFSRISALKELHLFNSELKNLPPTLSSSADLKLL-EVLDLSENSLNSPIPN 265

Query:   333 Y-----NXXXXXXXXXXXRGSIPVAFKHMVSLSFLGLASN-EFEGGVPDFFANMCSLTML 386
             +     N           +GSIP  FK++  L  L L++N   +G +P    ++  L  L
Sbjct:   266 WLFGLTNLRKLFLRWDFLQGSIPTGFKNLKLLETLDLSNNLALQGEIPSVLGDLPQLKFL 325

Query:   387 NISDNKLRGHFPELIQNLSSGCTKNSLEMLYLSSNEITGSVPD-LGGFSSLKELYLENNR 445
             ++S N+L G     +   S     NSL  L LSSN++ G++P+ LG   +L+ L L +N 
Sbjct:   326 DLSANELNGQIHGFLDAFSRN-KGNSLVFLDLSSNKLAGTLPESLGSLRNLQTLDLSSNS 384

Query:   446 LNGFTNNSIGQMSKLRTLSLNGNSL 470
               G   +SIG M+ L+ L L+ N++
Sbjct:   385 FTGSVPSSIGNMASLKKLDLSNNAM 409


GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0005618 "cell wall" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP;IMP
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005507 ER "ERECTA" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090754 RLP43 "receptor like protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091353 AT3G28040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149922 EFR "EF-TU receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043540 AT2G25790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515102753 AT1G73066 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query471
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-39
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-32
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-25
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-20
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-10
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-09
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-08
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 1e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-06
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 8e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  152 bits (385), Expect = 1e-39
 Identities = 123/365 (33%), Positives = 181/365 (49%), Gaps = 33/365 (9%)

Query: 114 EEREALLTFKESLVDESGVLSSWGPEDEKRDRCKWAGVGCSNRTGHVIKLEIQPIDFGSF 173
           EE E LL+FK S+ D    LS+W       D C W G+ C+N +       +  ID    
Sbjct: 29  EELELLLSFKSSINDPLKYLSNWNSSA---DVCLWQGITCNNSS------RVVSIDLSGK 79

Query: 174 PLRGTISPALLQLHRLTYLDLSLNNFSGSPIPEFIGSLT-KLSYLDLSFAEFEGPIPSHL 232
            + G IS A+ +L  +  ++LS N  SG PIP+ I + +  L YL+LS   F G IP   
Sbjct: 80  NISGKISSAIFRLPYIQTINLSNNQLSG-PIPDDIFTTSSSLRYLNLSNNNFTGSIPR-- 136

Query: 233 GNLSALQHLDLSLNHLFSVGNLDWLSHLSSLTYLDLGSNNLSRSTDWLQVVGNLPLLTTL 292
           G++  L+ LDLS N++ S    + +   SSL  LDLG N L         + NL  L  L
Sbjct: 137 GSIPNLETLDLS-NNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIP--NSLTNLTSLEFL 193

Query: 293 YLYRCHLPPIVPLSLSNLNYSTSLQFLELSENNLTNSIYPY------NLVLLGLDSNLLR 346
            L    L   +P  L  +    SL+++ L  NNL+  I PY      +L  L L  N L 
Sbjct: 194 TLASNQLVGQIPRELGQMK---SLKWIYLGYNNLSGEI-PYEIGGLTSLNHLDLVYNNLT 249

Query: 347 GSIPVAFKHMVSLSFLGLASNEFEGGVPDFFANMCSLTMLNISDNKLRGHFPELIQNLSS 406
           G IP +  ++ +L +L L  N+  G +P    ++  L  L++SDN L G  PEL+  L  
Sbjct: 250 GPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQL-- 307

Query: 407 GCTKNSLEMLYLSSNEITGSVPD-LGGFSSLKELYLENNRLNGFTNNSIGQMSKLRTLSL 465
                +LE+L+L SN  TG +P  L     L+ L L +N+ +G    ++G+ + L  L L
Sbjct: 308 ----QNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDL 363

Query: 466 NGNSL 470
           + N+L
Sbjct: 364 STNNL 368


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 471
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.93
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.9
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.88
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.87
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.86
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.81
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.75
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
PLN03150623 hypothetical protein; Provisional 99.61
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.61
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.58
PLN03150623 hypothetical protein; Provisional 99.41
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 99.29
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.26
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.24
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.22
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.22
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.14
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.06
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.05
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.05
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.03
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.01
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.97
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.9
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.77
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.77
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.72
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.71
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.59
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.58
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.53
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.35
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.24
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.21
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.19
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.16
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.04
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.97
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.96
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.88
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.86
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.85
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.84
PRK15386 426 type III secretion protein GogB; Provisional 97.66
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.62
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.57
PRK15386 426 type III secretion protein GogB; Provisional 97.57
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.51
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.99
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.78
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.3
KOG4341483 consensus F-box protein containing LRR [General fu 96.29
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 95.9
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.81
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.75
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.56
KOG4308478 consensus LRR-containing protein [Function unknown 95.49
KOG4308 478 consensus LRR-containing protein [Function unknown 93.87
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.52
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.14
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.52
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 89.36
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 88.24
KOG1947482 consensus Leucine rich repeat proteins, some prote 88.22
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.36
smart0037026 LRR Leucine-rich repeats, outliers. 87.36
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.72
smart0037026 LRR Leucine-rich repeats, outliers. 84.72
KOG4341483 consensus F-box protein containing LRR [General fu 84.35
KOG1947482 consensus Leucine rich repeat proteins, some prote 83.51
KOG0473 326 consensus Leucine-rich repeat protein [Function un 82.94
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.2e-49  Score=446.10  Aligned_cols=407  Identities=30%  Similarity=0.434  Sum_probs=239.7

Q ss_pred             cHHhHHHHHHhhhhCCCCCCCCCCCCCCCCCCCCccccceeeCCCCCcEEEEEeCCCCCCCCCccccchhhhhHHhhhHH
Q 041155            5 IDEEREAVLTFKESLVDESGVLSSWGPEDEKRDCCKWTGVGCSNRTGHVIKLEIQPIDFDSFPLRVFPILLIITMTVGIR   84 (471)
Q Consensus         5 ~~~e~~aLl~~k~~~~~~~~~l~sW~~~~~~~~~C~W~GV~C~~~~g~V~~L~L~~~~l~~~~~~~~~~~~~~~~~~~l~   84 (471)
                      .++|++||++||+++.+|.+.+++|..   ..|||.|+||+|++ .++|++|+|+++++.+.   ..+.      +..+.
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~~---~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~~~---~~~~------~~~l~   93 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWNS---SADVCLWQGITCNN-SSRVVSIDLSGKNISGK---ISSA------IFRLP   93 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCCC---CCCCCcCcceecCC-CCcEEEEEecCCCcccc---CChH------HhCCC
Confidence            468999999999999988888999964   35899999999985 57999999998876652   1111      12334


Q ss_pred             HHHHHHHHHHHhhcCccccCCCCccCCCHHHHH-HHHHHHHhCcCCCCCCCCCCCCCCCCCCCCcceeeeCCCCCceEEE
Q 041155           85 LLQQLFLLVILLQLEPRVADSNNMIRCIDEERE-ALLTFKESLVDESGVLSSWGPEDEKRDRCKWAGVGCSNRTGHVIKL  163 (471)
Q Consensus        85 ~l~~l~~~~~~~~~~~~~~~~~~~~g~~p~~~~-~l~~l~~~~~~~~~~l~~~~~~~~~~~~~~~~g~~~~~~~~~l~~L  163 (471)
                      .|+.|++.            +|.+.|.+|.++. .+..++.... ..+.+               .+.......+++++|
T Consensus        94 ~L~~L~Ls------------~n~~~~~ip~~~~~~l~~L~~L~L-s~n~l---------------~~~~p~~~l~~L~~L  145 (968)
T PLN00113         94 YIQTINLS------------NNQLSGPIPDDIFTTSSSLRYLNL-SNNNF---------------TGSIPRGSIPNLETL  145 (968)
T ss_pred             CCCEEECC------------CCccCCcCChHHhccCCCCCEEEC-cCCcc---------------ccccCccccCCCCEE
Confidence            44544432            3666777887654 3333322100 01111               111111123456666


Q ss_pred             EeCCCCCCCCCcccccchhhhCCCCCCEEeCCCCCCCCCCcCccCCCCCCCCeEeCCCCcccCCCCccccCCCCCCEEEc
Q 041155          164 EIQPIDFGSFPLRGTISPALLQLHRLTYLDLSLNNFSGSPIPEFIGSLTKLSYLDLSFAEFEGPIPSHLGNLSALQHLDL  243 (471)
Q Consensus       164 ~L~~~~l~~n~l~g~ip~~l~~l~~L~~L~Ls~n~l~g~~ip~~l~~l~~L~~L~Ls~n~l~g~ip~~l~~l~~L~~L~L  243 (471)
                      ++++     |.+++.+|..++++++|++|++++|.+.+. +|..++++++|++|++++|.+++.+|..++++++|++|++
T Consensus       146 ~Ls~-----n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~-~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L  219 (968)
T PLN00113        146 DLSN-----NMLSGEIPNDIGSFSSLKVLDLGGNVLVGK-IPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYL  219 (968)
T ss_pred             ECcC-----CcccccCChHHhcCCCCCEEECccCccccc-CChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEEC
Confidence            6665     455555666666666666666666666554 5666666666666666666666666666666666666666


Q ss_pred             cCCCCCCCCChhhhcCCCCCcEEEcCCccCCCCCchhhhhCCCCCCCEEEecCCCCCCCCcccccCCCCCCcccEEECCC
Q 041155          244 SLNHLFSVGNLDWLSHLSSLTYLDLGSNNLSRSTDWLQVVGNLPLLTTLYLYRCHLPPIVPLSLSNLNYSTSLQFLELSE  323 (471)
Q Consensus       244 ~~n~~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~l~~n~l~g~~p~~l~~l~~~~~L~~L~Ls~  323 (471)
                      ++|.+... .+..++++++|++|++++|.+++.  +|..++++++|++|++++|.+.+.+|..+.++   ++|+.|++++
T Consensus       220 ~~n~l~~~-~p~~l~~l~~L~~L~L~~n~l~~~--~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l---~~L~~L~Ls~  293 (968)
T PLN00113        220 GYNNLSGE-IPYEIGGLTSLNHLDLVYNNLTGP--IPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSL---QKLISLDLSD  293 (968)
T ss_pred             cCCccCCc-CChhHhcCCCCCEEECcCceeccc--cChhHhCCCCCCEEECcCCeeeccCchhHhhc---cCcCEEECcC
Confidence            66554321 123355555666666666555544  13355555555555555555555555555555   5555555555


Q ss_pred             CcCCCccccc-----cccEEEcccccCccCcCccccCCCCCCEEeCcCCcCcccCChhccCCCCCCEEeCcCCcCcc---
Q 041155          324 NNLTNSIYPY-----NLVLLGLDSNLLRGSIPVAFKHMVSLSFLGLASNEFEGGVPDFFANMCSLTMLNISDNKLRG---  395 (471)
Q Consensus       324 N~l~g~ip~~-----~L~~L~Ls~n~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g---  395 (471)
                      |.+++.+|..     +|++|++++|.+++.+|..+..+++|+.|++++|++++.+|..++.+++|+.|++++|++++   
T Consensus       294 n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p  373 (968)
T PLN00113        294 NSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIP  373 (968)
T ss_pred             CeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCC
Confidence            5555555442     45555555555555555555555555555555555555555555555555555555555544   


Q ss_pred             ---------------------cCcHHhhhccCCCCcCCccEEEcccCcCcccCCC-CCCCCCCCEEECcCCcccccCchh
Q 041155          396 ---------------------HFPELIQNLSSGCTKNSLEMLYLSSNEITGSVPD-LGGFSSLKELYLENNRLNGFTNNS  453 (471)
Q Consensus       396 ---------------------~ip~~l~~l~~~~~~~~L~~L~L~~N~l~g~ip~-~~~l~~L~~L~Ls~N~l~g~ip~~  453 (471)
                                           .+|..++.++      +|+.|++++|+++|.+|. +..++.|+.|++++|+++|.+|..
T Consensus       374 ~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~------~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~  447 (968)
T PLN00113        374 EGLCSSGNLFKLILFSNSLEGEIPKSLGACR------SLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSR  447 (968)
T ss_pred             hhHhCcCCCCEEECcCCEecccCCHHHhCCC------CCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChh
Confidence                                 4444444444      667777777777766666 666777777777777777777766


Q ss_pred             hhcCCCCCEEECcCCCC
Q 041155          454 IGQMSKLRTLSLNGNSL  470 (471)
Q Consensus       454 l~~l~~L~~L~Ls~N~l  470 (471)
                      +..+++|+.|++++|++
T Consensus       448 ~~~l~~L~~L~L~~n~~  464 (968)
T PLN00113        448 KWDMPSLQMLSLARNKF  464 (968)
T ss_pred             hccCCCCcEEECcCcee
Confidence            66677777777777764



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query471
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 4e-14
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-14
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-08
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 3e-04
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 3e-04
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 3e-04
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 4e-04
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 6e-04
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 6e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 64.7 bits (156), Expect = 9e-11, Method: Compositional matrix adjust. Identities = 93/311 (29%), Positives = 133/311 (42%), Gaps = 36/311 (11%) Query: 164 EIQPIDFGSFPLRGTISPALLQLHRLTYLDLSLNNFSGSPIPEFI-GSLTKLSYLDLSFA 222 E++ ++ S G I P L L L YL L+ N F+G IP+F+ G+ L+ LDLS Sbjct: 248 ELKLLNISSNQFVGPIPP--LPLKSLQYLSLAENKFTGE-IPDFLSGACDTLTGLDLSGN 304 Query: 223 EFEGPIPSHLGNLSALQHLDLSLNHLFSVGNLDWLSHLSSLTYLDLGSNNLSRSTDWLQV 282 F G +P G+ S L+ L LS N+ +D L + L LDL N S + + Sbjct: 305 HFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEF--SGELPES 362 Query: 283 VGNLPL-LTTLYLYRCHLP-PIVPXXXXXXXXXXXXQFLELSENNLTNSIYPYNXXXXXX 340 + NL L TL L + PI+P Q L L N T Sbjct: 363 LTNLSASLLTLDLSSNNFSGPILP--NLCQNPKNTLQELYLQNNGFT------------- 407 Query: 341 XXXXXRGSIPVAFKHMVSLSFLGLASNEFEGGVPDFFANMCSLTMLNISDNKLRGHFPEL 400 G IP + L L L+ N G +P ++ L L + N L G P+ Sbjct: 408 ------GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQE 461 Query: 401 IQNLSSGCTKNSLEMLYLSSNEITGSVPD-LGGFSSLKELYLENNRLNGFTNNSIGQMSK 459 + + +LE L L N++TG +P L ++L + L NNRL G IG++ Sbjct: 462 LMYVK------TLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLEN 515 Query: 460 LRTLSLNGNSL 470 L L L+ NS Sbjct: 516 LAILKLSNNSF 526
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query471
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-80
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-59
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-46
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-46
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-43
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-43
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-19
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-55
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-45
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-44
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-43
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-40
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-40
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-39
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-37
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-23
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-45
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-39
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-39
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-37
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-33
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-31
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-43
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-38
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-16
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-41
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-40
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-36
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-34
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-40
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-40
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-39
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-33
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-32
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-31
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-39
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-36
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-37
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-36
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-34
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-33
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-32
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-27
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-17
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-35
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-33
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-23
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-35
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-35
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-28
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-19
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-34
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-30
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-26
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-24
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-33
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-32
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-29
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-28
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-26
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-32
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-20
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-29
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-28
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-30
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-26
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-28
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-27
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-28
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-24
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-13
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-27
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-27
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-10
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-27
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-24
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-12
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 7e-12
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-27
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-27
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-19
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 5e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-26
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-26
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 2e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-26
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-25
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-23
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-21
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-18
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-25
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-25
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-21
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-20
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-24
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-23
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-12
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-12
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 4e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-23
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-23
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-21
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-21
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-22
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-21
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-20
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-18
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-18
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-13
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-19
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-17
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-13
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-15
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-18
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-17
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-10
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-16
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-14
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-12
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-15
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-12
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-10
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-16
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-16
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B 220 SLIT homolog 2 protein N-product; structural prote 4e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-11
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-07
2v70_A 220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 3e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 3e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-06
2wfh_A 193 SLIT homolog 2 protein C-product; developmental pr 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-05
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  264 bits (676), Expect = 2e-80
 Identities = 99/370 (26%), Positives = 163/370 (44%), Gaps = 33/370 (8%)

Query: 111 CIDEEREALLTFKESLVDESGVLSSWGPEDEKRDRCKWAGVGCSNRTGHVIKLEIQPIDF 170
            +  E   L++FK+ L D   +L  W       + C + GV C +    V  +++     
Sbjct: 9   SLYREIHQLISFKDVLPD-KNLLPDWSSNK---NPCTFDGVTCRD--DKVTSIDLS--SK 60

Query: 171 GSFPLRGTISPALLQLHRLTYLDLSLNNFSGSPIPEFIGSLTKLSYLDLSFAEFEGPIPS 230
                   +S +LL L  L  L LS ++ +GS +  F      L+ LDLS     GP+ +
Sbjct: 61  PLNVGFSAVSSSLLSLTGLESLFLSNSHINGS-VSGF-KCSASLTSLDLSRNSLSGPVTT 118

Query: 231 --HLGNLSALQHLDLSLNHLFSVGNLDWLSHLSSLTYLDLGSNNLSRST-DWLQVVGNLP 287
              LG+ S L+ L++S N L   G +     L+SL  LDL +N++S +      +     
Sbjct: 119 LTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCG 178

Query: 288 LLTTLYLYRCHLPPIVPLSLSNLNYSTSLQFLELSENNLTNSIYPY-----NLVLLGLDS 342
            L  L +    +     + +S      +L+FL++S NN +  I P+      L  L +  
Sbjct: 179 ELKHLAISGNKISG--DVDVSRC---VNLEFLDVSSNNFSTGI-PFLGDCSALQHLDISG 232

Query: 343 NLLRGSIPVAFKHMVSLSFLGLASNEFEGGVPDFFANMCSLTMLNISDNKLRGHFPELIQ 402
           N L G    A      L  L ++SN+F G +P     + SL  L++++NK  G  P+ + 
Sbjct: 233 NKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLS 290

Query: 403 NLSSGCTKNSLEMLYLSSNEITGSVPD-LGGFSSLKELYLENNRLNG-FTNNSIGQMSKL 460
                    +L  L LS N   G+VP   G  S L+ L L +N  +G    +++ +M  L
Sbjct: 291 GACD-----TLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGL 345

Query: 461 RTLSLNGNSL 470
           + L L+ N  
Sbjct: 346 KVLDLSFNEF 355


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query471
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.98
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.9
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.87
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.86
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.79
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.76
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.75
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.67
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.65
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.57
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.55
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.54
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.49
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.47
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.44
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.44
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.4
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.32
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.32
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.27
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.21
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.2
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.89
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.87
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.82
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.64
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.56
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.48
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.45
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.44
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.28
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.12
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.11
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.67
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.62
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.56
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.38
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.07
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.54
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.54
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=9.9e-55  Score=474.36  Aligned_cols=432  Identities=28%  Similarity=0.347  Sum_probs=235.3

Q ss_pred             ccHHhHHHHHHhhhhCCCCCCCCCCCCCCCCCCCCccccceeeCCCCCcEEEEEeCCCCCCCCCccccchhhhhHHhhhH
Q 041155            4 CIDEEREAVLTFKESLVDESGVLSSWGPEDEKRDCCKWTGVGCSNRTGHVIKLEIQPIDFDSFPLRVFPILLIITMTVGI   83 (471)
Q Consensus         4 c~~~e~~aLl~~k~~~~~~~~~l~sW~~~~~~~~~C~W~GV~C~~~~g~V~~L~L~~~~l~~~~~~~~~~~~~~~~~~~l   83 (471)
                      +.++||+|||+||+++.||. ++++|+.   ++|||+|+||+|+  +|||++|+|++.++.|....+.+.+         
T Consensus         9 ~~~~~~~all~~k~~~~~~~-~l~~W~~---~~~~C~w~gv~C~--~~~v~~L~L~~~~l~g~~~~l~~~l---------   73 (768)
T 3rgz_A            9 SLYREIHQLISFKDVLPDKN-LLPDWSS---NKNPCTFDGVTCR--DDKVTSIDLSSKPLNVGFSAVSSSL---------   73 (768)
T ss_dssp             CHHHHHHHHHHHHTTCSCTT-SSTTCCT---TSCGGGSTTEEEE--TTEEEEEECTTSCCCEEHHHHHHHT---------
T ss_pred             CCHHHHHHHHHHHhhCCCcc-cccCCCC---CCCCcCCcceEEC--CCcEEEEECCCCCcCCccCccChhH---------
Confidence            56789999999999999998 9999973   4689999999998  6999999999877654100011111         


Q ss_pred             HHHHHHHHHHHHhhcCc--------------cccCCCCccCCCHH--HHHHHHHHHHhCcC--------CC---CCCCCC
Q 041155           84 RLLQQLFLLVILLQLEP--------------RVADSNNMIRCIDE--EREALLTFKESLVD--------ES---GVLSSW  136 (471)
Q Consensus        84 ~~l~~l~~~~~~~~~~~--------------~~~~~~~~~g~~p~--~~~~l~~l~~~~~~--------~~---~~l~~~  136 (471)
                      ..|++|+++++...+..              .....|.+.|.+|.  .++.+..++.....        +.   ..++.+
T Consensus        74 ~~L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L  153 (768)
T 3rgz_A           74 LSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSL  153 (768)
T ss_dssp             TTCTTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTC
T ss_pred             hccCcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCC
Confidence            11122222211111100              00122455555665  55444433321000        00   011111


Q ss_pred             CCCCCCCCCCCc---------------------------ceeeeCCCCCceEEEEeCCCCCCCCCcccccchhhhCCCCC
Q 041155          137 GPEDEKRDRCKW---------------------------AGVGCSNRTGHVIKLEIQPIDFGSFPLRGTISPALLQLHRL  189 (471)
Q Consensus       137 ~~~~~~~~~~~~---------------------------~g~~~~~~~~~l~~L~L~~~~l~~n~l~g~ip~~l~~l~~L  189 (471)
                      ..  .....+..                           .+........++++|++++     |.+++.+|. ++++++|
T Consensus       154 ~~--L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~-----n~l~~~~~~-l~~l~~L  225 (768)
T 3rgz_A          154 EV--LDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSS-----NNFSTGIPF-LGDCSAL  225 (768)
T ss_dssp             SE--EECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBCTTCTTCCEEECCS-----SCCCSCCCB-CTTCCSC
T ss_pred             CE--EECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCCcccCCcCCEEECcC-----CcCCCCCcc-cccCCCC
Confidence            00  00001111                           1111111223455555554     344444444 4445555


Q ss_pred             CEEeCCCCCCCCCCcCccCCCCC----------------------CCCeEeCCCCcccCCCCccccCC-CCCCEEEccCC
Q 041155          190 TYLDLSLNNFSGSPIPEFIGSLT----------------------KLSYLDLSFAEFEGPIPSHLGNL-SALQHLDLSLN  246 (471)
Q Consensus       190 ~~L~Ls~n~l~g~~ip~~l~~l~----------------------~L~~L~Ls~n~l~g~ip~~l~~l-~~L~~L~L~~n  246 (471)
                      ++|++++|.+++. +|..+++++                      +|++|++++|.++|.+|..+... ++|++|++++|
T Consensus       226 ~~L~Ls~n~l~~~-~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n  304 (768)
T 3rgz_A          226 QHLDISGNKLSGD-FSRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGN  304 (768)
T ss_dssp             CEEECCSSCCCSC-HHHHTTTCSSCCEEECCSSCCEESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSS
T ss_pred             CEEECcCCcCCCc-ccHHHhcCCCCCEEECCCCcccCccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCC
Confidence            5555555555443 444444444                      44444444555555555555543 66666666666


Q ss_pred             CCCCCCChhhhcCCCCCcEEEcCCccCCCCCchhhhhCCCCCCCEEEecCCCCCCCCcccccCCCCCC-cccEEECCCCc
Q 041155          247 HLFSVGNLDWLSHLSSLTYLDLGSNNLSRSTDWLQVVGNLPLLTTLYLYRCHLPPIVPLSLSNLNYST-SLQFLELSENN  325 (471)
Q Consensus       247 ~~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~l~~n~l~g~~p~~l~~l~~~~-~L~~L~Ls~N~  325 (471)
                      .+... .+..++++++|++|++++|.+.|..+ ...++++++|++|++++|.+++.+|..+.++   + +|++|++++|.
T Consensus       305 ~l~~~-~p~~~~~l~~L~~L~L~~n~l~~~ip-~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l---~~~L~~L~Ls~N~  379 (768)
T 3rgz_A          305 HFYGA-VPPFFGSCSLLESLALSSNNFSGELP-MDTLLKMRGLKVLDLSFNEFSGELPESLTNL---SASLLTLDLSSNN  379 (768)
T ss_dssp             EEEEC-CCGGGGGCTTCCEEECCSSEEEEECC-HHHHTTCTTCCEEECCSSEEEECCCTTHHHH---TTTCSEEECCSSE
T ss_pred             cCCCc-cchHHhcCCCccEEECCCCcccCcCC-HHHHhcCCCCCEEeCcCCccCccccHHHHhh---hcCCcEEEccCCC
Confidence            64322 22456777778888888777775521 2347777888888888887777777666655   3 55555555555


Q ss_pred             CCCcccc--------------------------c-----cccEEEcccccCccCcCccccCCCCCCEEeCcCCcCcccCC
Q 041155          326 LTNSIYP--------------------------Y-----NLVLLGLDSNLLRGSIPVAFKHMVSLSFLGLASNEFEGGVP  374 (471)
Q Consensus       326 l~g~ip~--------------------------~-----~L~~L~Ls~n~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip  374 (471)
                      ++|.+|.                          .     +|++|++++|.+++.+|..++.+++|++|++++|+++|.+|
T Consensus       380 l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p  459 (768)
T 3rgz_A          380 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP  459 (768)
T ss_dssp             EEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCC
T ss_pred             cCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCC
Confidence            5544433                          2     44455555555555555555555555555555555555555


Q ss_pred             hhccCCCCCCEEeCcCCcCcccCcHHhhhccCCCCcCCccEEEcccCcCcccCCC-CCCCCCCCEEECcCCcccccCchh
Q 041155          375 DFFANMCSLTMLNISDNKLRGHFPELIQNLSSGCTKNSLEMLYLSSNEITGSVPD-LGGFSSLKELYLENNRLNGFTNNS  453 (471)
Q Consensus       375 ~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~l~~~~~~~~L~~L~L~~N~l~g~ip~-~~~l~~L~~L~Ls~N~l~g~ip~~  453 (471)
                      ..++.+++|++|++++|+++|.+|..+..++      +|++|++++|+++|.+|. ++.+++|++|++++|+++|.+|..
T Consensus       460 ~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~------~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~  533 (768)
T 3rgz_A          460 QELMYVKTLETLILDFNDLTGEIPSGLSNCT------NLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAE  533 (768)
T ss_dssp             GGGGGCTTCCEEECCSSCCCSCCCGGGGGCT------TCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGG
T ss_pred             HHHcCCCCceEEEecCCcccCcCCHHHhcCC------CCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHH
Confidence            5555555555555555555555555555554      566666666666666665 666666666666666666666666


Q ss_pred             hhcCCCCCEEECcCCCC
Q 041155          454 IGQMSKLRTLSLNGNSL  470 (471)
Q Consensus       454 l~~l~~L~~L~Ls~N~l  470 (471)
                      ++.+++|++|++++|++
T Consensus       534 l~~l~~L~~L~Ls~N~l  550 (768)
T 3rgz_A          534 LGDCRSLIWLDLNTNLF  550 (768)
T ss_dssp             GGGCTTCCEEECCSSEE
T ss_pred             HcCCCCCCEEECCCCcc
Confidence            66666666666666654



>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 471
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-21
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-10
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-08
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-08
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-09
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-07
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-06
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.002
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 93.3 bits (230), Expect = 1e-21
 Identities = 65/343 (18%), Positives = 113/343 (32%), Gaps = 49/343 (14%)

Query: 111 CIDEEREALLTFKESLVDESGVLSSWGPEDEKRDRC--KWAGVGCSNRTGHVIKLEIQPI 168
           C  ++++ALL  K+ L +    LSSW P     D C   W GV C   T           
Sbjct: 3   CNPQDKQALLQIKKDLGN-PTTLSSWLPTT---DCCNRTWLGVLCDTDTQT--------- 49

Query: 169 DFGSFPLRGTISPALLQLHRLTYLDLSLNNFSGS-PIPEFIGSLTKLSYLDLSFAE-FEG 226
                             +R+  LDLS  N     PIP  + +L  L++L +       G
Sbjct: 50  ------------------YRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVG 91

Query: 227 PIPSHLGNLSALQHLDLSLNHLFSVGNLDWLSHLSSLTYLDLGSNNLSRSTDWLQVVGNL 286
           PIP  +  L+ L +L ++  ++            + +T     +         +    +L
Sbjct: 92  PIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSIS---SL 148

Query: 287 PLLTTLYLYRCHLPPIVPLSLSNLNYSTSLQFLELSENNLTNSIYP---YNLVLLGLDSN 343
           P L  +      +     +  S  ++S     + +S N LT  I P      +     S 
Sbjct: 149 PNLVGITFDGNRISGA--IPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSR 206

Query: 344 LLRGSIPVAFKHMVSLSFLGLASNEFEGGVPDFFANMCSLTMLNISDNKLRGHFPELIQN 403
            +              +     +               +L  L++ +N++ G  P+ +  
Sbjct: 207 NMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQ 266

Query: 404 LSSGCTKNSLEMLYLSSNEITGSVPDLGGFSSLKELYLENNRL 446
           L        L  L +S N + G +P  G           NN+ 
Sbjct: 267 LKF------LHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKC 303


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query471
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.7
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.67
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.67
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.56
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.53
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.44
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.44
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.26
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.18
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.04
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.22
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.16
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.87
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.65
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.25
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.06
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=5.5e-46  Score=360.59  Aligned_cols=301  Identities=29%  Similarity=0.467  Sum_probs=206.0

Q ss_pred             cccHHhHHHHHHhhhhCCCCCCCCCCCCCCCCCCCCcc--ccceeeCCCC--CcEEEEEeCCCCCCCCCccccchhhhhH
Q 041155            3 RCIDEEREAVLTFKESLVDESGVLSSWGPEDEKRDCCK--WTGVGCSNRT--GHVIKLEIQPIDFDSFPLRVFPILLIIT   78 (471)
Q Consensus         3 ~c~~~e~~aLl~~k~~~~~~~~~l~sW~~~~~~~~~C~--W~GV~C~~~~--g~V~~L~L~~~~l~~~~~~~~~~~~~~~   78 (471)
                      -|.++||+||++||+++.||. .+++|..   ++|||.  |+||+|++.+  +|||+|+|++.++.+             
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-~l~sW~~---~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g-------------   64 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-TLSSWLP---TTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPK-------------   64 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCCT---TSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSS-------------
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-cCCCCCC---CCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCC-------------
Confidence            499999999999999999875 6999974   369994  9999998643  488888887543321             


Q ss_pred             HhhhHHHHHHHHHHHHHhhcCccccCCCCccCCCHHHHHHHHHHHHhCcCCCCCCCCCCCCCCCCCCCCcceeeeCCCCC
Q 041155           79 MTVGIRLLQQLFLLVILLQLEPRVADSNNMIRCIDEEREALLTFKESLVDESGVLSSWGPEDEKRDRCKWAGVGCSNRTG  158 (471)
Q Consensus        79 ~~~~l~~l~~l~~~~~~~~~~~~~~~~~~~~g~~p~~~~~l~~l~~~~~~~~~~l~~~~~~~~~~~~~~~~g~~~~~~~~  158 (471)
                                                                                                      
T Consensus        65 --------------------------------------------------------------------------------   64 (313)
T d1ogqa_          65 --------------------------------------------------------------------------------   64 (313)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             ceEEEEeCCCCCCCCCcccccchhhhCCCCCCEEeCCC-CCCCCCCcCccCCCCCCCCeEeCCCCcccCCCCccccCCCC
Q 041155          159 HVIKLEIQPIDFGSFPLRGTISPALLQLHRLTYLDLSL-NNFSGSPIPEFIGSLTKLSYLDLSFAEFEGPIPSHLGNLSA  237 (471)
Q Consensus       159 ~l~~L~L~~~~l~~n~l~g~ip~~l~~l~~L~~L~Ls~-n~l~g~~ip~~l~~l~~L~~L~Ls~n~l~g~ip~~l~~l~~  237 (471)
                                       .+++|++++++++|++|+|++ |+++|. +|..++++++|++|+|++|++.+..|..+..+.+
T Consensus        65 -----------------~~~lp~~l~~L~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~  126 (313)
T d1ogqa_          65 -----------------PYPIPSSLANLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKT  126 (313)
T ss_dssp             -----------------CEECCGGGGGCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTT
T ss_pred             -----------------CCCCChHHhcCccccccccccccccccc-cccccccccccchhhhccccccccccccccchhh
Confidence                             013455555566666666654 555554 5655666666666666666655555555555555


Q ss_pred             CCEEEccCCCCCCCCChhhhcCCCCCcEEEcCCccCCCCCchhhhhCCCCCC-CEEEecCCCCCCCCcccccCCCCCCcc
Q 041155          238 LQHLDLSLNHLFSVGNLDWLSHLSSLTYLDLGSNNLSRSTDWLQVVGNLPLL-TTLYLYRCHLPPIVPLSLSNLNYSTSL  316 (471)
Q Consensus       238 L~~L~L~~n~~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L-~~L~l~~n~l~g~~p~~l~~l~~~~~L  316 (471)
                      |++++++.|..... .+..+.++++|+++++++|.+.+.  +|..+..+..+ +.+++++|++++..|..+.++      
T Consensus       127 L~~l~l~~N~~~~~-~p~~l~~l~~L~~l~l~~n~l~~~--ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l------  197 (313)
T d1ogqa_         127 LVTLDFSYNALSGT-LPPSISSLPNLVGITFDGNRISGA--IPDSYGSFSKLFTSMTISRNRLTGKIPPTFANL------  197 (313)
T ss_dssp             CCEEECCSSEEESC-CCGGGGGCTTCCEEECCSSCCEEE--CCGGGGCCCTTCCEEECCSSEEEEECCGGGGGC------
T ss_pred             hccccccccccccc-CchhhccCcccceeeccccccccc--ccccccccccccccccccccccccccccccccc------
Confidence            55555554442111 112233333344444444433332  12233333333 455555555555555444443      


Q ss_pred             cEEECCCCcCCCccccccccEEEcccccCccCcCccccCCCCCCEEeCcCCcCcccCChhccCCCCCCEEeCcCCcCccc
Q 041155          317 QFLELSENNLTNSIYPYNLVLLGLDSNLLRGSIPVAFKHMVSLSFLGLASNEFEGGVPDFFANMCSLTMLNISDNKLRGH  396 (471)
Q Consensus       317 ~~L~Ls~N~l~g~ip~~~L~~L~Ls~n~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~  396 (471)
                                       ....++++.+.+.|.+|..++.+++++.+++++|.+++.+| .++.+++|+.|+|++|+++|.
T Consensus       198 -----------------~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~  259 (313)
T d1ogqa_         198 -----------------NLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGT  259 (313)
T ss_dssp             -----------------CCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEEC
T ss_pred             -----------------ccccccccccccccccccccccccccccccccccccccccc-ccccccccccccCccCeeccc
Confidence                             33456666666777888889999999999999999998766 578899999999999999999


Q ss_pred             CcHHhhhccCCCCcCCccEEEcccCcCcccCCCCCCCCCCCEEECcCCc-cccc-Cc
Q 041155          397 FPELIQNLSSGCTKNSLEMLYLSSNEITGSVPDLGGFSSLKELYLENNR-LNGF-TN  451 (471)
Q Consensus       397 ip~~l~~l~~~~~~~~L~~L~L~~N~l~g~ip~~~~l~~L~~L~Ls~N~-l~g~-ip  451 (471)
                      +|+.+++++      +|++|+|++|+++|.+|.++++++|+.+++++|+ +.|. +|
T Consensus       260 iP~~l~~L~------~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~~l~g~plp  310 (313)
T d1ogqa_         260 LPQGLTQLK------FLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLP  310 (313)
T ss_dssp             CCGGGGGCT------TCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSEEESTTSS
T ss_pred             CChHHhCCC------CCCEEECcCCcccccCCCcccCCCCCHHHhCCCccccCCCCC
Confidence            999999998      8999999999999999999999999999999997 5664 44



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure