Citrus Sinensis ID: 041215
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 136 | ||||||
| 225447856 | 350 | PREDICTED: rae1-like protein At1g80670 [ | 1.0 | 0.388 | 0.926 | 3e-72 | |
| 363806810 | 347 | uncharacterized protein LOC100819240 [Gl | 1.0 | 0.391 | 0.897 | 1e-70 | |
| 255572775 | 349 | plant poly(A)+ RNA export protein, putat | 1.0 | 0.389 | 0.904 | 2e-70 | |
| 109390024 | 347 | RNA export 1 [Nicotiana benthamiana] | 1.0 | 0.391 | 0.904 | 6e-70 | |
| 449447571 | 344 | PREDICTED: rae1-like protein At1g80670-l | 1.0 | 0.395 | 0.911 | 8e-70 | |
| 357445765 | 351 | RNA export [Medicago truncatula] gi|3554 | 1.0 | 0.387 | 0.882 | 9e-70 | |
| 363807134 | 347 | uncharacterized protein LOC100780721 [Gl | 1.0 | 0.391 | 0.882 | 2e-69 | |
| 388514275 | 252 | unknown [Medicago truncatula] | 1.0 | 0.539 | 0.867 | 3e-69 | |
| 356525894 | 347 | PREDICTED: uncharacterized protein LOC10 | 1.0 | 0.391 | 0.882 | 8e-69 | |
| 356558620 | 347 | PREDICTED: rae1-like protein At1g80670-l | 1.0 | 0.391 | 0.882 | 1e-68 |
| >gi|225447856|ref|XP_002271645.1| PREDICTED: rae1-like protein At1g80670 [Vitis vinifera] gi|296081523|emb|CBI20046.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 276 bits (705), Expect = 3e-72, Method: Compositional matrix adjust.
Identities = 126/136 (92%), Positives = 132/136 (97%)
Query: 1 VGSIEGRVGVHHLDDSQQSKNFTFKCHRDGSEIYSVNSLNFHPIHHTFATAGSDGAFNFW 60
VGSIEGRVGVHHLDD+QQSKNFTFKCHR+G+EIYSVNSLNFHP+HHTFATAGSDGAFNFW
Sbjct: 215 VGSIEGRVGVHHLDDAQQSKNFTFKCHREGNEIYSVNSLNFHPVHHTFATAGSDGAFNFW 274
Query: 61 DKDSKQRLKAMSRCGQPIPCSTFNTDGSIFAYSVCYDWSKGAENHNPATAKTYIYLHLPQ 120
DKDSKQRLKAMSRC QPIPCSTFN DGSIFAYSVCYDWSKGAENHNPATAK+YI+LHLPQ
Sbjct: 275 DKDSKQRLKAMSRCSQPIPCSTFNNDGSIFAYSVCYDWSKGAENHNPATAKSYIFLHLPQ 334
Query: 121 ETEVKGKPRAGTSGRK 136
E EVKGKPR GTSGRK
Sbjct: 335 EAEVKGKPRIGTSGRK 350
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|363806810|ref|NP_001242030.1| uncharacterized protein LOC100819240 [Glycine max] gi|255638763|gb|ACU19686.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255572775|ref|XP_002527320.1| plant poly(A)+ RNA export protein, putative [Ricinus communis] gi|223533320|gb|EEF35072.1| plant poly(A)+ RNA export protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|109390024|gb|ABG29731.1| RNA export 1 [Nicotiana benthamiana] | Back alignment and taxonomy information |
|---|
| >gi|449447571|ref|XP_004141541.1| PREDICTED: rae1-like protein At1g80670-like [Cucumis sativus] gi|449481503|ref|XP_004156202.1| PREDICTED: rae1-like protein At1g80670-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357445765|ref|XP_003593160.1| RNA export [Medicago truncatula] gi|355482208|gb|AES63411.1| RNA export [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|363807134|ref|NP_001242596.1| uncharacterized protein LOC100780721 [Glycine max] gi|255641855|gb|ACU21196.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388514275|gb|AFK45199.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356525894|ref|XP_003531556.1| PREDICTED: uncharacterized protein LOC100527204 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356558620|ref|XP_003547602.1| PREDICTED: rae1-like protein At1g80670-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 136 | ||||||
| TAIR|locus:2025732 | 349 | RAE1 "AT1G80670" [Arabidopsis | 1.0 | 0.389 | 0.867 | 2e-65 | |
| POMBASE|SPBC16A3.05c | 352 | rae1 "RNA export factor, nucle | 0.948 | 0.366 | 0.507 | 2e-33 | |
| UNIPROTKB|G4NDD2 | 358 | MGG_00946 "Poly(A)+ RNA export | 0.933 | 0.354 | 0.496 | 5.2e-33 | |
| ZFIN|ZDB-GENE-040426-1029 | 368 | rae1 "RAE1 RNA export 1 homolo | 0.919 | 0.339 | 0.503 | 6.9e-31 | |
| ASPGD|ASPL0000060741 | 362 | sonA [Emericella nidulans (tax | 0.948 | 0.356 | 0.481 | 8.8e-31 | |
| UNIPROTKB|Q7ZZY7 | 368 | Rae1/Gle2 "Rae1/Gle2" [Xenopus | 0.919 | 0.339 | 0.510 | 1.1e-30 | |
| UNIPROTKB|E1C7F8 | 368 | Gga.22300 "Uncharacterized pro | 0.919 | 0.339 | 0.503 | 2.3e-30 | |
| UNIPROTKB|Q5E9A4 | 368 | RAE1 "mRNA export factor" [Bos | 0.919 | 0.339 | 0.503 | 2.3e-30 | |
| UNIPROTKB|E2RSV2 | 368 | RAE1 "Uncharacterized protein" | 0.919 | 0.339 | 0.503 | 2.3e-30 | |
| UNIPROTKB|P78406 | 368 | RAE1 "mRNA export factor" [Hom | 0.919 | 0.339 | 0.503 | 2.3e-30 |
| TAIR|locus:2025732 RAE1 "AT1G80670" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 666 (239.5 bits), Expect = 2.0e-65, P = 2.0e-65
Identities = 118/136 (86%), Positives = 128/136 (94%)
Query: 1 VGSIEGRVGVHHLDDSQQSKNFTFKCHRDGSEIYSVNSLNFHPIHHTFATAGSDGAFNFW 60
VGSIEGRVGVHHLDDSQQSKNFTFKCHRDG++IYSVNSLNFHP+H TFATAGSDGAFNFW
Sbjct: 214 VGSIEGRVGVHHLDDSQQSKNFTFKCHRDGNDIYSVNSLNFHPVHGTFATAGSDGAFNFW 273
Query: 61 DKDSKQRLKAMSRCGQPIPCSTFNTDGSIFAYSVCYDWSKGAENHNPATAKTYIYLHLPQ 120
DKDSKQRLKAMSRC QPIPCS+FN DGSI+AY+ CYDWSKGAENHNPATAK+ I+LHLPQ
Sbjct: 274 DKDSKQRLKAMSRCNQPIPCSSFNHDGSIYAYAACYDWSKGAENHNPATAKSSIFLHLPQ 333
Query: 121 ETEVKGKPRAGTSGRK 136
E+EVK KPR G +GRK
Sbjct: 334 ESEVKAKPRVGATGRK 349
|
|
| POMBASE|SPBC16A3.05c rae1 "RNA export factor, nucleoporin Rae1" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4NDD2 MGG_00946 "Poly(A)+ RNA export protein" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1029 rae1 "RAE1 RNA export 1 homolog (S. pombe)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000060741 sonA [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7ZZY7 Rae1/Gle2 "Rae1/Gle2" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C7F8 Gga.22300 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5E9A4 RAE1 "mRNA export factor" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RSV2 RAE1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P78406 RAE1 "mRNA export factor" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 136 | |||
| COG2319 | 466 | COG2319, COG2319, FOG: WD40 repeat [General functi | 1e-04 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 5e-04 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 0.001 | |
| pfam00400 | 39 | pfam00400, WD40, WD domain, G-beta repeat | 0.002 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 0.004 | |
| smart00320 | 40 | smart00320, WD40, WD40 repeats | 0.004 |
| >gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
Score = 40.1 bits (92), Expect = 1e-04
Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 2/66 (3%)
Query: 34 YSVNSLNFHPIHHTFATAGSDGAFNFWDKDSKQRLKAMSRCG--QPIPCSTFNTDGSIFA 91
SV S+ F P A+ SDG WD ++ + L +++ G P+ +F+ DGS+
Sbjct: 285 SSVLSVAFSPDGKLLASGSSDGTVRLWDLETGKLLSSLTLKGHEGPVSSLSFSPDGSLLV 344
Query: 92 YSVCYD 97
D
Sbjct: 345 SGGSDD 350
|
Length = 466 |
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat | Back alignment and domain information |
|---|
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|197651 smart00320, WD40, WD40 repeats | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| KOG0647 | 347 | consensus mRNA export protein (contains WD40 repea | 99.91 | |
| KOG1036 | 323 | consensus Mitotic spindle checkpoint protein BUB3, | 99.71 | |
| KOG0263 | 707 | consensus Transcription initiation factor TFIID, s | 99.55 | |
| KOG0263 | 707 | consensus Transcription initiation factor TFIID, s | 99.55 | |
| KOG0266 | 456 | consensus WD40 repeat-containing protein [General | 99.55 | |
| KOG0286 | 343 | consensus G-protein beta subunit [General function | 99.54 | |
| KOG0295 | 406 | consensus WD40 repeat-containing protein [Function | 99.51 | |
| KOG0272 | 459 | consensus U4/U6 small nuclear ribonucleoprotein Pr | 99.51 | |
| KOG0272 | 459 | consensus U4/U6 small nuclear ribonucleoprotein Pr | 99.51 | |
| PTZ00421 | 493 | coronin; Provisional | 99.48 | |
| KOG0284 | 464 | consensus Polyadenylation factor I complex, subuni | 99.47 | |
| KOG0271 | 480 | consensus Notchless-like WD40 repeat-containing pr | 99.42 | |
| KOG0271 | 480 | consensus Notchless-like WD40 repeat-containing pr | 99.41 | |
| KOG0266 | 456 | consensus WD40 repeat-containing protein [General | 99.41 | |
| KOG0279 | 315 | consensus G protein beta subunit-like protein [Sig | 99.39 | |
| KOG0279 | 315 | consensus G protein beta subunit-like protein [Sig | 99.37 | |
| KOG0302 | 440 | consensus Ribosome Assembly protein [General funct | 99.37 | |
| KOG1407 | 313 | consensus WD40 repeat protein [Function unknown] | 99.36 | |
| KOG0296 | 399 | consensus Angio-associated migratory cell protein | 99.35 | |
| KOG0273 | 524 | consensus Beta-transducin family (WD-40 repeat) pr | 99.34 | |
| KOG1445 | 1012 | consensus Tumor-specific antigen (contains WD repe | 99.34 | |
| KOG0285 | 460 | consensus Pleiotropic regulator 1 [RNA processing | 99.34 | |
| KOG0278 | 334 | consensus Serine/threonine kinase receptor-associa | 99.33 | |
| PTZ00420 | 568 | coronin; Provisional | 99.33 | |
| KOG0286 | 343 | consensus G-protein beta subunit [General function | 99.3 | |
| KOG0643 | 327 | consensus Translation initiation factor 3, subunit | 99.3 | |
| KOG0269 | 839 | consensus WD40 repeat-containing protein [Function | 99.3 | |
| KOG0276 | 794 | consensus Vesicle coat complex COPI, beta' subunit | 99.3 | |
| KOG0283 | 712 | consensus WD40 repeat-containing protein [Function | 99.3 | |
| KOG0319 | 775 | consensus WD40-repeat-containing subunit of the 18 | 99.29 | |
| KOG0285 | 460 | consensus Pleiotropic regulator 1 [RNA processing | 99.28 | |
| KOG0318 | 603 | consensus WD40 repeat stress protein/actin interac | 99.28 | |
| KOG0295 | 406 | consensus WD40 repeat-containing protein [Function | 99.23 | |
| KOG0289 | 506 | consensus mRNA splicing factor [General function p | 99.23 | |
| KOG0291 | 893 | consensus WD40-repeat-containing subunit of the 18 | 99.23 | |
| KOG0277 | 311 | consensus Peroxisomal targeting signal type 2 rece | 99.22 | |
| KOG0318 | 603 | consensus WD40 repeat stress protein/actin interac | 99.21 | |
| KOG0647 | 347 | consensus mRNA export protein (contains WD40 repea | 99.21 | |
| KOG0264 | 422 | consensus Nucleosome remodeling factor, subunit CA | 99.21 | |
| KOG0316 | 307 | consensus Conserved WD40 repeat-containing protein | 99.2 | |
| PTZ00420 | 568 | coronin; Provisional | 99.19 | |
| PTZ00421 | 493 | coronin; Provisional | 99.19 | |
| KOG0294 | 362 | consensus WD40 repeat-containing protein [Function | 99.18 | |
| KOG0273 | 524 | consensus Beta-transducin family (WD-40 repeat) pr | 99.18 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 99.17 | |
| KOG0264 | 422 | consensus Nucleosome remodeling factor, subunit CA | 99.17 | |
| KOG0291 | 893 | consensus WD40-repeat-containing subunit of the 18 | 99.17 | |
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 99.17 | |
| KOG0645 | 312 | consensus WD40 repeat protein [General function pr | 99.16 | |
| KOG0645 | 312 | consensus WD40 repeat protein [General function pr | 99.16 | |
| KOG0284 | 464 | consensus Polyadenylation factor I complex, subuni | 99.16 | |
| KOG0319 | 775 | consensus WD40-repeat-containing subunit of the 18 | 99.15 | |
| KOG1273 | 405 | consensus WD40 repeat protein [General function pr | 99.15 | |
| KOG0277 | 311 | consensus Peroxisomal targeting signal type 2 rece | 99.15 | |
| KOG0292 | 1202 | consensus Vesicle coat complex COPI, alpha subunit | 99.15 | |
| KOG1332 | 299 | consensus Vesicle coat complex COPII, subunit SEC1 | 99.15 | |
| KOG2111 | 346 | consensus Uncharacterized conserved protein, conta | 99.14 | |
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 99.13 | |
| KOG0276 | 794 | consensus Vesicle coat complex COPI, beta' subunit | 99.12 | |
| KOG0282 | 503 | consensus mRNA splicing factor [Function unknown] | 99.12 | |
| KOG2110 | 391 | consensus Uncharacterized conserved protein, conta | 99.1 | |
| KOG0275 | 508 | consensus Conserved WD40 repeat-containing protein | 99.1 | |
| KOG0275 | 508 | consensus Conserved WD40 repeat-containing protein | 99.09 | |
| KOG0315 | 311 | consensus G-protein beta subunit-like protein (con | 99.08 | |
| KOG1034 | 385 | consensus Transcriptional repressor EED/ESC/FIE, r | 99.08 | |
| KOG0282 | 503 | consensus mRNA splicing factor [Function unknown] | 99.07 | |
| KOG1539 | 910 | consensus WD repeat protein [General function pred | 99.07 | |
| KOG0289 | 506 | consensus mRNA splicing factor [General function p | 99.06 | |
| KOG2394 | 636 | consensus WD40 protein DMR-N9 [General function pr | 99.06 | |
| KOG0772 | 641 | consensus Uncharacterized conserved protein, conta | 99.06 | |
| KOG0292 | 1202 | consensus Vesicle coat complex COPI, alpha subunit | 99.05 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 99.04 | |
| KOG0267 | 825 | consensus Microtubule severing protein katanin p80 | 99.04 | |
| KOG0293 | 519 | consensus WD40 repeat-containing protein [Function | 99.03 | |
| KOG0639 | 705 | consensus Transducin-like enhancer of split protei | 99.01 | |
| KOG0308 | 735 | consensus Conserved WD40 repeat-containing protein | 99.01 | |
| KOG0310 | 487 | consensus Conserved WD40 repeat-containing protein | 98.99 | |
| KOG0305 | 484 | consensus Anaphase promoting complex, Cdc20, Cdh1, | 98.98 | |
| KOG0296 | 399 | consensus Angio-associated migratory cell protein | 98.97 | |
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 98.97 | |
| KOG0643 | 327 | consensus Translation initiation factor 3, subunit | 98.97 | |
| KOG0315 | 311 | consensus G-protein beta subunit-like protein (con | 98.97 | |
| KOG1446 | 311 | consensus Histone H3 (Lys4) methyltransferase comp | 98.96 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 98.96 | |
| KOG0265 | 338 | consensus U5 snRNP-specific protein-like factor an | 98.96 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 98.96 | |
| KOG0316 | 307 | consensus Conserved WD40 repeat-containing protein | 98.95 | |
| KOG0640 | 430 | consensus mRNA cleavage stimulating factor complex | 98.95 | |
| KOG0303 | 472 | consensus Actin-binding protein Coronin, contains | 98.94 | |
| KOG0313 | 423 | consensus Microtubule binding protein YTM1 (contai | 98.93 | |
| KOG0267 | 825 | consensus Microtubule severing protein katanin p80 | 98.93 | |
| KOG0641 | 350 | consensus WD40 repeat protein [General function pr | 98.92 | |
| KOG0294 | 362 | consensus WD40 repeat-containing protein [Function | 98.92 | |
| KOG0973 | 942 | consensus Histone transcription regulator HIRA, WD | 98.92 | |
| KOG0269 | 839 | consensus WD40 repeat-containing protein [Function | 98.91 | |
| KOG0310 | 487 | consensus Conserved WD40 repeat-containing protein | 98.91 | |
| KOG1007 | 370 | consensus WD repeat protein TSSC1, WD repeat super | 98.91 | |
| KOG2394 | 636 | consensus WD40 protein DMR-N9 [General function pr | 98.91 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 98.91 | |
| KOG0265 | 338 | consensus U5 snRNP-specific protein-like factor an | 98.9 | |
| KOG0306 | 888 | consensus WD40-repeat-containing subunit of the 18 | 98.88 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 98.87 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 98.87 | |
| KOG1407 | 313 | consensus WD40 repeat protein [Function unknown] | 98.87 | |
| KOG0313 | 423 | consensus Microtubule binding protein YTM1 (contai | 98.87 | |
| KOG1273 | 405 | consensus WD40 repeat protein [General function pr | 98.87 | |
| KOG4283 | 397 | consensus Transcription-coupled repair protein CSA | 98.86 | |
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 98.84 | |
| KOG0305 | 484 | consensus Anaphase promoting complex, Cdc20, Cdh1, | 98.82 | |
| KOG1188 | 376 | consensus WD40 repeat protein [General function pr | 98.82 | |
| KOG0973 | 942 | consensus Histone transcription regulator HIRA, WD | 98.81 | |
| KOG0270 | 463 | consensus WD40 repeat-containing protein [Function | 98.81 | |
| KOG1332 | 299 | consensus Vesicle coat complex COPII, subunit SEC1 | 98.81 | |
| KOG0306 | 888 | consensus WD40-repeat-containing subunit of the 18 | 98.8 | |
| KOG0293 | 519 | consensus WD40 repeat-containing protein [Function | 98.79 | |
| KOG0300 | 481 | consensus WD40 repeat-containing protein [Function | 98.77 | |
| KOG0278 | 334 | consensus Serine/threonine kinase receptor-associa | 98.77 | |
| KOG0299 | 479 | consensus U3 snoRNP-associated protein (contains W | 98.76 | |
| KOG0302 | 440 | consensus Ribosome Assembly protein [General funct | 98.76 | |
| KOG0322 | 323 | consensus G-protein beta subunit-like protein GNB1 | 98.76 | |
| KOG0283 | 712 | consensus WD40 repeat-containing protein [Function | 98.76 | |
| KOG0640 | 430 | consensus mRNA cleavage stimulating factor complex | 98.75 | |
| KOG1408 | 1080 | consensus WD40 repeat protein [Function unknown] | 98.75 | |
| KOG1274 | 933 | consensus WD40 repeat protein [General function pr | 98.75 | |
| KOG0301 | 745 | consensus Phospholipase A2-activating protein (con | 98.73 | |
| KOG1539 | 910 | consensus WD repeat protein [General function pred | 98.71 | |
| KOG0772 | 641 | consensus Uncharacterized conserved protein, conta | 98.67 | |
| KOG1009 | 434 | consensus Chromatin assembly complex 1 subunit B/C | 98.66 | |
| KOG1272 | 545 | consensus WD40-repeat-containing subunit of the 18 | 98.66 | |
| KOG4378 | 673 | consensus Nuclear protein COP1 [Signal transductio | 98.65 | |
| KOG1538 | 1081 | consensus Uncharacterized conserved protein WDR10, | 98.65 | |
| KOG1408 | 1080 | consensus WD40 repeat protein [Function unknown] | 98.64 | |
| KOG0639 | 705 | consensus Transducin-like enhancer of split protei | 98.62 | |
| KOG0650 | 733 | consensus WD40 repeat nucleolar protein Bop1, invo | 98.61 | |
| KOG0642 | 577 | consensus Cell-cycle nuclear protein, contains WD- | 98.6 | |
| KOG0270 | 463 | consensus WD40 repeat-containing protein [Function | 98.59 | |
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 98.57 | |
| KOG0268 | 433 | consensus Sof1-like rRNA processing protein (conta | 98.55 | |
| KOG1446 | 311 | consensus Histone H3 (Lys4) methyltransferase comp | 98.55 | |
| KOG0290 | 364 | consensus Conserved WD40 repeat-containing protein | 98.54 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 98.53 | |
| KOG2445 | 361 | consensus Nuclear pore complex component (sc Seh1) | 98.52 | |
| KOG0646 | 476 | consensus WD40 repeat protein [General function pr | 98.52 | |
| KOG0301 | 745 | consensus Phospholipase A2-activating protein (con | 98.48 | |
| KOG2110 | 391 | consensus Uncharacterized conserved protein, conta | 98.47 | |
| KOG1009 | 434 | consensus Chromatin assembly complex 1 subunit B/C | 98.47 | |
| KOG4283 | 397 | consensus Transcription-coupled repair protein CSA | 98.46 | |
| KOG0646 | 476 | consensus WD40 repeat protein [General function pr | 98.46 | |
| KOG1036 | 323 | consensus Mitotic spindle checkpoint protein BUB3, | 98.45 | |
| KOG0308 | 735 | consensus Conserved WD40 repeat-containing protein | 98.45 | |
| KOG2055 | 514 | consensus WD40 repeat protein [General function pr | 98.45 | |
| KOG0268 | 433 | consensus Sof1-like rRNA processing protein (conta | 98.43 | |
| KOG0299 | 479 | consensus U3 snoRNP-associated protein (contains W | 98.43 | |
| KOG2096 | 420 | consensus WD40 repeat protein [General function pr | 98.42 | |
| KOG1274 | 933 | consensus WD40 repeat protein [General function pr | 98.4 | |
| KOG1063 | 764 | consensus RNA polymerase II elongator complex, sub | 98.39 | |
| KOG4547 | 541 | consensus WD40 repeat-containing protein [General | 98.39 | |
| COG2319 | 466 | FOG: WD40 repeat [General function prediction only | 98.38 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 98.37 | |
| KOG2106 | 626 | consensus Uncharacterized conserved protein, conta | 98.36 | |
| KOG2106 | 626 | consensus Uncharacterized conserved protein, conta | 98.36 | |
| KOG2096 | 420 | consensus WD40 repeat protein [General function pr | 98.36 | |
| KOG1524 | 737 | consensus WD40 repeat-containing protein CHE-2 [Ge | 98.35 | |
| KOG2048 | 691 | consensus WD40 repeat protein [General function pr | 98.35 | |
| KOG0300 | 481 | consensus WD40 repeat-containing protein [Function | 98.34 | |
| KOG2919 | 406 | consensus Guanine nucleotide-binding protein [Gene | 98.33 | |
| KOG0771 | 398 | consensus Prolactin regulatory element-binding pro | 98.33 | |
| KOG1445 | 1012 | consensus Tumor-specific antigen (contains WD repe | 98.32 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 98.31 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 98.3 | |
| KOG0771 | 398 | consensus Prolactin regulatory element-binding pro | 98.29 | |
| KOG4328 | 498 | consensus WD40 protein [Function unknown] | 98.28 | |
| KOG1524 | 737 | consensus WD40 repeat-containing protein CHE-2 [Ge | 98.26 | |
| KOG1188 | 376 | consensus WD40 repeat protein [General function pr | 98.26 | |
| KOG1523 | 361 | consensus Actin-related protein Arp2/3 complex, su | 98.24 | |
| KOG3881 | 412 | consensus Uncharacterized conserved protein [Funct | 98.23 | |
| KOG0303 | 472 | consensus Actin-binding protein Coronin, contains | 98.22 | |
| KOG1963 | 792 | consensus WD40 repeat protein [General function pr | 98.22 | |
| KOG1007 | 370 | consensus WD repeat protein TSSC1, WD repeat super | 98.22 | |
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 98.22 | |
| KOG2048 | 691 | consensus WD40 repeat protein [General function pr | 98.16 | |
| KOG0649 | 325 | consensus WD40 repeat protein [General function pr | 98.16 | |
| KOG2055 | 514 | consensus WD40 repeat protein [General function pr | 98.16 | |
| KOG2445 | 361 | consensus Nuclear pore complex component (sc Seh1) | 98.16 | |
| KOG1063 | 764 | consensus RNA polymerase II elongator complex, sub | 98.15 | |
| KOG0321 | 720 | consensus WD40 repeat-containing protein L2DTL [Fu | 98.15 | |
| KOG0974 | 967 | consensus WD-repeat protein WDR6, WD repeat superf | 98.13 | |
| KOG1523 | 361 | consensus Actin-related protein Arp2/3 complex, su | 98.13 | |
| KOG0307 | 1049 | consensus Vesicle coat complex COPII, subunit SEC3 | 98.13 | |
| KOG1538 | 1081 | consensus Uncharacterized conserved protein WDR10, | 98.12 | |
| KOG0322 | 323 | consensus G-protein beta subunit-like protein GNB1 | 98.12 | |
| COG2319 | 466 | FOG: WD40 repeat [General function prediction only | 98.1 | |
| KOG1272 | 545 | consensus WD40-repeat-containing subunit of the 18 | 98.09 | |
| KOG4378 | 673 | consensus Nuclear protein COP1 [Signal transductio | 98.08 | |
| KOG0641 | 350 | consensus WD40 repeat protein [General function pr | 98.07 | |
| KOG0307 | 1049 | consensus Vesicle coat complex COPII, subunit SEC3 | 98.04 | |
| KOG0644 | 1113 | consensus Uncharacterized conserved protein, conta | 98.03 | |
| KOG0650 | 733 | consensus WD40 repeat nucleolar protein Bop1, invo | 98.01 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 98.0 | |
| KOG0642 | 577 | consensus Cell-cycle nuclear protein, contains WD- | 97.98 | |
| smart00320 | 40 | WD40 WD40 repeats. Note that these repeats are per | 97.97 | |
| KOG1034 | 385 | consensus Transcriptional repressor EED/ESC/FIE, r | 97.95 | |
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 97.92 | |
| KOG2139 | 445 | consensus WD40 repeat protein [General function pr | 97.91 | |
| KOG0280 | 339 | consensus Uncharacterized conserved protein [Amino | 97.83 | |
| KOG0290 | 364 | consensus Conserved WD40 repeat-containing protein | 97.81 | |
| KOG0649 | 325 | consensus WD40 repeat protein [General function pr | 97.8 | |
| PRK01742 | 429 | tolB translocation protein TolB; Provisional | 97.79 | |
| PRK05137 | 435 | tolB translocation protein TolB; Provisional | 97.74 | |
| KOG4328 | 498 | consensus WD40 protein [Function unknown] | 97.71 | |
| KOG1409 | 404 | consensus Uncharacterized conserved protein, conta | 97.71 | |
| KOG2139 | 445 | consensus WD40 repeat protein [General function pr | 97.67 | |
| PRK02889 | 427 | tolB translocation protein TolB; Provisional | 97.67 | |
| KOG4547 | 541 | consensus WD40 repeat-containing protein [General | 97.64 | |
| KOG2919 | 406 | consensus Guanine nucleotide-binding protein [Gene | 97.58 | |
| KOG1587 | 555 | consensus Cytoplasmic dynein intermediate chain [C | 97.57 | |
| KOG1963 | 792 | consensus WD40 repeat protein [General function pr | 97.56 | |
| PRK01742 | 429 | tolB translocation protein TolB; Provisional | 97.56 | |
| PF11768 | 545 | DUF3312: Protein of unknown function (DUF3312); In | 97.49 | |
| KOG4714 | 319 | consensus Nucleoporin [Nuclear structure] | 97.48 | |
| KOG1587 | 555 | consensus Cytoplasmic dynein intermediate chain [C | 97.48 | |
| KOG1517 | 1387 | consensus Guanine nucleotide binding protein MIP1 | 97.47 | |
| KOG0321 | 720 | consensus WD40 repeat-containing protein L2DTL [Fu | 97.44 | |
| KOG2111 | 346 | consensus Uncharacterized conserved protein, conta | 97.43 | |
| KOG4497 | 447 | consensus Uncharacterized conserved protein WDR8, | 97.39 | |
| KOG1240 | 1431 | consensus Protein kinase containing WD40 repeats [ | 97.38 | |
| PRK03629 | 429 | tolB translocation protein TolB; Provisional | 97.37 | |
| PRK05137 | 435 | tolB translocation protein TolB; Provisional | 97.36 | |
| KOG0644 | 1113 | consensus Uncharacterized conserved protein, conta | 97.33 | |
| COG4946 | 668 | Uncharacterized protein related to the periplasmic | 97.32 | |
| KOG2315 | 566 | consensus Predicted translation initiation factor | 97.3 | |
| PRK04922 | 433 | tolB translocation protein TolB; Provisional | 97.3 | |
| KOG2321 | 703 | consensus WD40 repeat protein [General function pr | 97.3 | |
| KOG3881 | 412 | consensus Uncharacterized conserved protein [Funct | 97.28 | |
| PRK02889 | 427 | tolB translocation protein TolB; Provisional | 97.28 | |
| PRK03629 | 429 | tolB translocation protein TolB; Provisional | 97.19 | |
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 97.15 | |
| PRK04922 | 433 | tolB translocation protein TolB; Provisional | 97.14 | |
| TIGR02800 | 417 | propeller_TolB tol-pal system beta propeller repea | 97.14 | |
| KOG3914 | 390 | consensus WD repeat protein WDR4 [Function unknown | 97.11 | |
| PRK00178 | 430 | tolB translocation protein TolB; Provisional | 97.11 | |
| KOG1517 | 1387 | consensus Guanine nucleotide binding protein MIP1 | 97.1 | |
| KOG1240 | 1431 | consensus Protein kinase containing WD40 repeats [ | 97.09 | |
| KOG4227 | 609 | consensus WD40 repeat protein [General function pr | 97.08 | |
| PF11768 | 545 | DUF3312: Protein of unknown function (DUF3312); In | 97.06 | |
| KOG0974 | 967 | consensus WD-repeat protein WDR6, WD repeat superf | 97.05 | |
| KOG4227 | 609 | consensus WD40 repeat protein [General function pr | 97.02 | |
| PRK01029 | 428 | tolB translocation protein TolB; Provisional | 97.02 | |
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 96.95 | |
| PRK04792 | 448 | tolB translocation protein TolB; Provisional | 96.95 | |
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 96.9 | |
| PF12894 | 47 | Apc4_WD40: Anaphase-promoting complex subunit 4 WD | 96.87 | |
| KOG4640 | 665 | consensus Anaphase-promoting complex (APC), subuni | 96.79 | |
| TIGR02800 | 417 | propeller_TolB tol-pal system beta propeller repea | 96.76 | |
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 96.75 | |
| KOG1064 | 2439 | consensus RAVE (regulator of V-ATPase assembly) co | 96.71 | |
| PRK00178 | 430 | tolB translocation protein TolB; Provisional | 96.69 | |
| KOG2695 | 425 | consensus WD40 repeat protein [General function pr | 96.65 | |
| KOG2066 | 846 | consensus Vacuolar assembly/sorting protein VPS41 | 96.64 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 96.62 | |
| PF07433 | 305 | DUF1513: Protein of unknown function (DUF1513); In | 96.62 | |
| KOG0280 | 339 | consensus Uncharacterized conserved protein [Amino | 96.6 | |
| KOG3914 | 390 | consensus WD repeat protein WDR4 [Function unknown | 96.58 | |
| KOG4714 | 319 | consensus Nucleoporin [Nuclear structure] | 96.57 | |
| KOG1334 | 559 | consensus WD40 repeat protein [General function pr | 96.56 | |
| PRK04792 | 448 | tolB translocation protein TolB; Provisional | 96.55 | |
| KOG1832 | 1516 | consensus HIV-1 Vpr-binding protein [Cell cycle co | 96.54 | |
| KOG1275 | 1118 | consensus PAB-dependent poly(A) ribonuclease, subu | 96.53 | |
| KOG4532 | 344 | consensus WD40-like repeat containing protein [Gen | 96.49 | |
| KOG4640 | 665 | consensus Anaphase-promoting complex (APC), subuni | 96.43 | |
| KOG2321 | 703 | consensus WD40 repeat protein [General function pr | 96.41 | |
| KOG1064 | 2439 | consensus RAVE (regulator of V-ATPase assembly) co | 96.21 | |
| KOG2695 | 425 | consensus WD40 repeat protein [General function pr | 96.11 | |
| PF08553 | 794 | VID27: VID27 cytoplasmic protein; InterPro: IPR013 | 96.1 | |
| PRK01029 | 428 | tolB translocation protein TolB; Provisional | 96.1 | |
| KOG4532 | 344 | consensus WD40-like repeat containing protein [Gen | 96.08 | |
| smart00320 | 40 | WD40 WD40 repeats. Note that these repeats are per | 96.07 | |
| KOG4190 | 1034 | consensus Uncharacterized conserved protein [Funct | 96.05 | |
| KOG1334 | 559 | consensus WD40 repeat protein [General function pr | 95.86 | |
| KOG2079 | 1206 | consensus Vacuolar assembly/sorting protein VPS8 [ | 95.85 | |
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 95.77 | |
| COG4946 | 668 | Uncharacterized protein related to the periplasmic | 95.75 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 95.7 | |
| KOG4497 | 447 | consensus Uncharacterized conserved protein WDR8, | 95.65 | |
| PRK04043 | 419 | tolB translocation protein TolB; Provisional | 95.64 | |
| KOG2314 | 698 | consensus Translation initiation factor 3, subunit | 95.51 | |
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 95.4 | |
| COG2706 | 346 | 3-carboxymuconate cyclase [Carbohydrate transport | 95.31 | |
| KOG4190 | 1034 | consensus Uncharacterized conserved protein [Funct | 95.27 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 95.13 | |
| KOG2315 | 566 | consensus Predicted translation initiation factor | 95.04 | |
| PF00930 | 353 | DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin | 94.98 | |
| PF15492 | 282 | Nbas_N: Neuroblastoma-amplified sequence, N termin | 94.98 | |
| KOG2066 | 846 | consensus Vacuolar assembly/sorting protein VPS41 | 94.88 | |
| KOG1275 | 1118 | consensus PAB-dependent poly(A) ribonuclease, subu | 94.71 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 94.62 | |
| PF15492 | 282 | Nbas_N: Neuroblastoma-amplified sequence, N termin | 94.35 | |
| COG2706 | 346 | 3-carboxymuconate cyclase [Carbohydrate transport | 94.26 | |
| TIGR03300 | 377 | assembly_YfgL outer membrane assembly lipoprotein | 94.18 | |
| COG0823 | 425 | TolB Periplasmic component of the Tol biopolymer t | 93.78 | |
| KOG3621 | 726 | consensus WD40 repeat-containing protein [General | 93.75 | |
| PRK04043 | 419 | tolB translocation protein TolB; Provisional | 93.73 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 93.71 | |
| KOG2444 | 238 | consensus WD40 repeat protein [General function pr | 93.5 | |
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 93.35 | |
| PF04762 | 928 | IKI3: IKI3 family; InterPro: IPR006849 Members of | 93.35 | |
| KOG1912 | 1062 | consensus WD40 repeat protein [General function pr | 93.26 | |
| COG3490 | 366 | Uncharacterized protein conserved in bacteria [Fun | 93.11 | |
| KOG4499 | 310 | consensus Ca2+-binding protein Regucalcin/SMP30 [I | 93.02 | |
| KOG1912 | 1062 | consensus WD40 repeat protein [General function pr | 92.97 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 92.9 | |
| KOG3621 | 726 | consensus WD40 repeat-containing protein [General | 92.89 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 92.8 | |
| KOG0309 | 1081 | consensus Conserved WD40 repeat-containing protein | 92.02 | |
| COG5354 | 561 | Uncharacterized protein, contains Trp-Asp (WD) rep | 91.82 | |
| KOG2314 | 698 | consensus Translation initiation factor 3, subunit | 91.68 | |
| PF10313 | 43 | DUF2415: Uncharacterised protein domain (DUF2415); | 91.48 | |
| COG0823 | 425 | TolB Periplasmic component of the Tol biopolymer t | 91.43 | |
| KOG4649 | 354 | consensus PQQ (pyrrolo-quinoline quinone) repeat p | 91.24 | |
| PF04053 | 443 | Coatomer_WDAD: Coatomer WD associated region ; Int | 91.05 | |
| PF07433 | 305 | DUF1513: Protein of unknown function (DUF1513); In | 90.89 | |
| PF07569 | 219 | Hira: TUP1-like enhancer of split; InterPro: IPR01 | 90.87 | |
| COG5354 | 561 | Uncharacterized protein, contains Trp-Asp (WD) rep | 90.6 | |
| PF05096 | 264 | Glu_cyclase_2: Glutamine cyclotransferase; InterPr | 90.47 | |
| KOG1008 | 783 | consensus Uncharacterized conserved protein, conta | 90.46 | |
| KOG2395 | 644 | consensus Protein involved in vacuole import and d | 90.4 | |
| PF13360 | 238 | PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A | 90.36 | |
| PF12894 | 47 | Apc4_WD40: Anaphase-promoting complex subunit 4 WD | 89.99 | |
| KOG1354 | 433 | consensus Serine/threonine protein phosphatase 2A, | 89.91 | |
| PF06433 | 342 | Me-amine-dh_H: Methylamine dehydrogenase heavy cha | 89.86 | |
| KOG1409 | 404 | consensus Uncharacterized conserved protein, conta | 89.24 | |
| PF15390 | 671 | DUF4613: Domain of unknown function (DUF4613) | 89.04 | |
| KOG1354 | 433 | consensus Serine/threonine protein phosphatase 2A, | 89.04 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 88.95 | |
| KOG0882 | 558 | consensus Cyclophilin-related peptidyl-prolyl cis- | 88.03 | |
| KOG1920 | 1265 | consensus IkappaB kinase complex, IKAP component [ | 87.94 | |
| TIGR03300 | 377 | assembly_YfgL outer membrane assembly lipoprotein | 87.72 | |
| PF08553 | 794 | VID27: VID27 cytoplasmic protein; InterPro: IPR013 | 87.37 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 87.04 | |
| PF14761 | 215 | HPS3_N: Hermansky-Pudlak syndrome 3 | 86.7 | |
| PRK02888 | 635 | nitrous-oxide reductase; Validated | 86.47 | |
| PRK02888 | 635 | nitrous-oxide reductase; Validated | 85.79 | |
| TIGR02276 | 42 | beta_rpt_yvtn 40-residue YVTN family beta-propelle | 85.53 | |
| KOG0309 | 1081 | consensus Conserved WD40 repeat-containing protein | 85.32 | |
| KOG1832 | 1516 | consensus HIV-1 Vpr-binding protein [Cell cycle co | 84.13 | |
| PF06433 | 342 | Me-amine-dh_H: Methylamine dehydrogenase heavy cha | 83.94 | |
| PF11715 | 547 | Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 | 83.86 | |
| PF12234 | 631 | Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 | 83.36 | |
| PF06977 | 248 | SdiA-regulated: SdiA-regulated; InterPro: IPR00972 | 83.08 | |
| COG3386 | 307 | Gluconolactonase [Carbohydrate transport and metab | 82.32 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 82.25 | |
| KOG0882 | 558 | consensus Cyclophilin-related peptidyl-prolyl cis- | 82.12 | |
| PF14783 | 111 | BBS2_Mid: Ciliary BBSome complex subunit 2, middle | 82.12 | |
| PF14655 | 415 | RAB3GAP2_N: Rab3 GTPase-activating protein regulat | 82.03 | |
| COG3386 | 307 | Gluconolactonase [Carbohydrate transport and metab | 82.0 | |
| PF02897 | 414 | Peptidase_S9_N: Prolyl oligopeptidase, N-terminal | 81.78 | |
| TIGR03075 | 527 | PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan | 81.63 | |
| PRK13616 | 591 | lipoprotein LpqB; Provisional | 81.51 | |
| PF04841 | 410 | Vps16_N: Vps16, N-terminal region; InterPro: IPR00 | 81.05 | |
| PF00930 | 353 | DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin | 80.4 |
| >KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=99.91 E-value=1.5e-23 Score=154.65 Aligned_cols=129 Identities=53% Similarity=1.018 Sum_probs=120.9
Q ss_pred CCceeceEEEEEeeCCCCcceeEEEeeeC----CCCccceeEEEEeCCCCEEEEEcCCCcEEEEeCCCcceeeecccCCC
Q 041215 1 VGSIEGRVGVHHLDDSQQSKNFTFKCHRD----GSEIYSVNSLNFHPIHHTFATAGSDGAFNFWDKDSKQRLKAMSRCGQ 76 (136)
Q Consensus 1 vgs~dG~v~i~~~d~~~~~~~~~l~~h~~----~~~~~~v~~l~~~p~~~~l~s~~~dg~v~vwd~~~~~~~~~~~~h~~ 76 (136)
+||+||.+.|.++|....+..++|+||+. ...+|+|+.|+|||....|++++.||.+.+||-+....+.+...|..
T Consensus 215 lGsiEGrv~iq~id~~~~~~nFtFkCHR~~~~~~~~VYaVNsi~FhP~hgtlvTaGsDGtf~FWDkdar~kLk~s~~~~q 294 (347)
T KOG0647|consen 215 LGSIEGRVAIQYIDDPNPKDNFTFKCHRSTNSVNDDVYAVNSIAFHPVHGTLVTAGSDGTFSFWDKDARTKLKTSETHPQ 294 (347)
T ss_pred eeeecceEEEEecCCCCccCceeEEEeccCCCCCCceEEecceEeecccceEEEecCCceEEEecchhhhhhhccCcCCC
Confidence 58999999999999977799999999995 44589999999999999999999999999999998888899999999
Q ss_pred ceeEEEEccCCCEEEEEEcccccccccccCCCCCcceEEEEcCCcccccccCCC
Q 041215 77 PIPCSTFNTDGSIFAYSVCYDWSKGAENHNPATAKTYIYLHLPQETEVKGKPRA 130 (136)
Q Consensus 77 ~v~~v~~sp~~~~l~s~~~dd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 130 (136)
+|.|.+|+.+|.++|.+.+|||++|++...|. .+.+|.+|++..+|+|||+||
T Consensus 295 pItcc~fn~~G~ifaYA~gYDWSkGhe~~n~~-~~~~I~l~~~~~~evK~r~~k 347 (347)
T KOG0647|consen 295 PITCCSFNRNGSIFAYALGYDWSKGHEGNNPQ-YKPQIFLHPVSTEEVKPRPKK 347 (347)
T ss_pred ccceeEecCCCCEEEEEeecccccccccCCCC-CCCeEEEeeccccccccCCCC
Confidence 99999999999999999999999999999999 667999999999999999986
|
|
| >KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >KOG0266 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0286 consensus G-protein beta subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0295 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0266 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0302 consensus Ribosome Assembly protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1407 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] | Back alignment and domain information |
|---|
| >KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0286 consensus G-protein beta subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0269 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0283 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0295 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0289 consensus mRNA splicing factor [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0294 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG0645 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0645 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1273 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0282 consensus mRNA splicing factor [Function unknown] | Back alignment and domain information |
|---|
| >KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0282 consensus mRNA splicing factor [Function unknown] | Back alignment and domain information |
|---|
| >KOG1539 consensus WD repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0289 consensus mRNA splicing factor [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] | Back alignment and domain information |
|---|
| >KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0293 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0641 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0294 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >KOG0269 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] | Back alignment and domain information |
|---|
| >KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG1407 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1273 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1188 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >KOG0270 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0293 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0300 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0302 consensus Ribosome Assembly protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0283 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1408 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1274 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1539 consensus WD repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] | Back alignment and domain information |
|---|
| >KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1408 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0270 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0646 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0646 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2055 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2096 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1274 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG4547 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG2319 FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG2096 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2048 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0300 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4328 consensus WD40 protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1188 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3881 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1963 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >KOG2048 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0649 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2055 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] | Back alignment and domain information |
|---|
| >KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] | Back alignment and domain information |
|---|
| >COG2319 FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0641 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >smart00320 WD40 WD40 repeats | Back alignment and domain information |
|---|
| >KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >KOG2139 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] | Back alignment and domain information |
|---|
| >KOG0649 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01742 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK05137 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG4328 consensus WD40 protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG2139 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK02889 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG4547 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1963 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01742 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats | Back alignment and domain information |
|---|
| >KOG4714 consensus Nucleoporin [Nuclear structure] | Back alignment and domain information |
|---|
| >KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] | Back alignment and domain information |
|---|
| >KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK03629 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK05137 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] | Back alignment and domain information |
|---|
| >KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK04922 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG2321 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3881 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK02889 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK03629 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >PRK04922 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB | Back alignment and domain information |
|---|
| >KOG3914 consensus WD repeat protein WDR4 [Function unknown] | Back alignment and domain information |
|---|
| >PRK00178 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4227 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats | Back alignment and domain information |
|---|
| >KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4227 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01029 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >PRK04792 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain | Back alignment and domain information |
|---|
| >KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00178 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG2695 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3914 consensus WD repeat protein WDR4 [Function unknown] | Back alignment and domain information |
|---|
| >KOG4714 consensus Nucleoporin [Nuclear structure] | Back alignment and domain information |
|---|
| >KOG1334 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04792 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4532 consensus WD40-like repeat containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2321 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2695 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins | Back alignment and domain information |
|---|
| >PRK01029 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG4532 consensus WD40-like repeat containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00320 WD40 WD40 repeats | Back alignment and domain information |
|---|
| >KOG4190 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1334 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04043 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4190 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal | Back alignment and domain information |
|---|
| >KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal | Back alignment and domain information |
|---|
| >COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL | Back alignment and domain information |
|---|
| >COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG3621 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04043 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >KOG2444 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] | Back alignment and domain information |
|---|
| >KOG1912 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG3490 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1912 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >KOG3621 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins | Back alignment and domain information |
|---|
| >COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin | Back alignment and domain information |
|---|
| >COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 | Back alignment and domain information |
|---|
| >KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A | Back alignment and domain information |
|---|
| >PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain | Back alignment and domain information |
|---|
| >KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 | Back alignment and domain information |
|---|
| >KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] | Back alignment and domain information |
|---|
| >PF15390 DUF4613: Domain of unknown function (DUF4613) | Back alignment and domain information |
|---|
| >KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] | Back alignment and domain information |
|---|
| >TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL | Back alignment and domain information |
|---|
| >PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 | Back alignment and domain information |
|---|
| >PRK02888 nitrous-oxide reductase; Validated | Back alignment and domain information |
|---|
| >PRK02888 nitrous-oxide reductase; Validated | Back alignment and domain information |
|---|
| >TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat | Back alignment and domain information |
|---|
| >KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 | Back alignment and domain information |
|---|
| >PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates | Back alignment and domain information |
|---|
| >PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length | Back alignment and domain information |
|---|
| >PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] | Back alignment and domain information |
|---|
| >COG3386 Gluconolactonase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region | Back alignment and domain information |
|---|
| >PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus | Back alignment and domain information |
|---|
| >COG3386 Gluconolactonase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family | Back alignment and domain information |
|---|
| >PRK13616 lipoprotein LpqB; Provisional | Back alignment and domain information |
|---|
| >PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex | Back alignment and domain information |
|---|
| >PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 136 | ||||
| 3mmy_A | 368 | Structural And Functional Analysis Of The Interacti | 1e-30 | ||
| 1u4c_A | 349 | Structure Of Spindle Checkpoint Protein Bub3 Length | 2e-10 | ||
| 2i3s_A | 349 | Bub3 Complex With Bub1 Glebs Motif Length = 349 | 2e-10 | ||
| 1yfq_A | 342 | High Resolution S. Cerevisiae Bub3 Mitotic Checkpoi | 2e-10 | ||
| 2i3t_A | 341 | Bub3 Complex With Mad3 (Bubr1) Glebs Motif Length = | 2e-10 |
| >pdb|3MMY|A Chain A, Structural And Functional Analysis Of The Interaction Between The Nucleoporin Nup98 And The Mrna Export Factor Rae1 Length = 368 | Back alignment and structure |
|
| >pdb|1U4C|A Chain A, Structure Of Spindle Checkpoint Protein Bub3 Length = 349 | Back alignment and structure |
| >pdb|2I3S|A Chain A, Bub3 Complex With Bub1 Glebs Motif Length = 349 | Back alignment and structure |
| >pdb|1YFQ|A Chain A, High Resolution S. Cerevisiae Bub3 Mitotic Checkpoint Protein Length = 342 | Back alignment and structure |
| >pdb|2I3T|A Chain A, Bub3 Complex With Mad3 (Bubr1) Glebs Motif Length = 341 | Back alignment and structure |
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 99.83 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 99.62 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 99.62 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 99.61 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 99.61 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 99.6 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 99.6 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 99.6 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 99.59 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 99.59 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 99.59 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 99.59 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 99.59 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 99.58 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 99.58 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 99.57 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 99.56 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 99.54 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 99.53 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 99.53 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 99.52 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 99.52 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 99.51 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 99.51 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 99.51 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 99.51 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 99.51 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 99.5 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 99.5 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 99.5 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 99.49 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 99.49 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 99.49 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 99.49 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 99.47 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 99.47 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 99.46 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 99.46 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 99.46 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 99.45 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 99.44 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 99.44 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 99.44 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 99.43 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 99.43 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 99.43 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 99.42 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 99.42 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 99.42 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 99.42 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 99.42 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 99.42 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 99.42 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 99.41 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 99.41 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 99.41 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 99.41 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 99.41 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 99.4 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 99.4 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 99.4 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 99.4 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 99.4 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 99.39 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 99.38 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 99.38 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 99.38 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 99.37 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 99.37 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 99.37 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 99.37 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 99.37 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 99.37 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 99.36 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 99.36 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 99.35 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 99.35 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 99.34 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 99.34 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 99.34 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 99.33 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 99.33 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 99.33 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 99.33 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 99.32 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 99.32 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 99.32 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 99.32 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 99.32 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 99.31 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 99.31 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 99.31 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 99.31 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 99.3 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 99.3 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 99.3 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 99.3 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 99.29 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 99.28 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 99.28 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 99.27 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 99.27 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 99.26 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 99.26 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 99.25 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 99.24 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 99.24 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 99.24 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 99.24 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 99.24 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 99.23 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 99.22 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 99.2 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 99.2 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 99.2 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 99.17 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 99.17 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 99.14 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 99.12 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 99.11 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 99.09 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 99.06 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 99.05 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 99.05 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 98.99 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 98.93 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 98.91 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 98.89 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 98.84 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 98.79 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 98.74 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 98.7 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 98.7 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 98.63 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 98.56 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 98.55 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 98.55 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 98.55 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 98.53 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 98.49 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 98.44 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 98.44 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 98.43 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 98.43 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 98.42 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 98.4 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 98.35 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 98.33 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 98.3 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 98.25 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 98.25 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 98.24 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 98.23 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 98.18 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 98.18 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 98.16 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 98.16 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 98.14 | |
| 1xip_A | 388 | Nucleoporin NUP159; beta-propeller, transport prot | 98.12 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 98.1 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 98.06 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 98.05 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 98.04 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 98.0 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 98.0 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 97.99 | |
| 1xip_A | 388 | Nucleoporin NUP159; beta-propeller, transport prot | 97.98 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 97.95 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 97.93 | |
| 3pe7_A | 388 | Oligogalacturonate lyase; seven-bladed beta-propel | 97.92 | |
| 2gop_A | 347 | Trilobed protease; beta propeller, open velcro, hy | 97.88 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 97.85 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 97.84 | |
| 3pe7_A | 388 | Oligogalacturonate lyase; seven-bladed beta-propel | 97.84 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 97.75 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 97.74 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 97.72 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 97.65 | |
| 2gop_A | 347 | Trilobed protease; beta propeller, open velcro, hy | 97.63 | |
| 1mda_H | 368 | Methylamine dehydrogenase (heavy subunit); electro | 97.63 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 97.62 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 97.61 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 97.6 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 97.58 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 97.58 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 97.54 | |
| 3sjl_D | 386 | Methylamine dehydrogenase heavy chain; MAUG, C-hem | 97.49 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 97.47 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 97.43 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 97.41 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 97.4 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 97.39 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 97.37 | |
| 3c5m_A | 396 | Oligogalacturonate lyase; blade-shaped beta-propel | 97.35 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 97.32 | |
| 3c5m_A | 396 | Oligogalacturonate lyase; blade-shaped beta-propel | 97.26 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 97.23 | |
| 3c75_H | 426 | MADH, methylamine dehydrogenase heavy chain; coppe | 97.15 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 97.02 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 97.0 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 96.89 | |
| 1yiq_A | 689 | Quinohemoprotein alcohol dehydrogenase; electron t | 96.75 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 96.71 | |
| 2ghs_A | 326 | AGR_C_1268P; regucalcin, structural genomics, join | 96.65 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 96.63 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 96.56 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 96.51 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 96.34 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 96.26 | |
| 3mbr_X | 243 | Glutamine cyclotransferase; beta-propeller; 1.44A | 96.25 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 96.2 | |
| 3nok_A | 268 | Glutaminyl cyclase; beta-propeller, cyclotransfera | 96.2 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 96.2 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 96.11 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 96.11 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 96.11 | |
| 1kb0_A | 677 | Quinohemoprotein alcohol dehydrogenase; beta-prope | 95.99 | |
| 3sjl_D | 386 | Methylamine dehydrogenase heavy chain; MAUG, C-hem | 95.97 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 95.8 | |
| 2hz6_A | 369 | Endoplasmic reticulum to nucleus signalling 1 isof | 95.75 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 95.65 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 95.54 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 95.54 | |
| 2ghs_A | 326 | AGR_C_1268P; regucalcin, structural genomics, join | 95.53 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 95.44 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 95.43 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 95.3 | |
| 1mda_H | 368 | Methylamine dehydrogenase (heavy subunit); electro | 95.3 | |
| 3c75_H | 426 | MADH, methylamine dehydrogenase heavy chain; coppe | 95.07 | |
| 1kv9_A | 668 | Type II quinohemoprotein alcohol dehydrogenase; el | 95.06 | |
| 3hxj_A | 330 | Pyrrolo-quinoline quinone; all beta protein. incom | 94.88 | |
| 1flg_A | 582 | Protein (quinoprotein ethanol dehydrogenase); supe | 94.77 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 94.76 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 94.7 | |
| 3hxj_A | 330 | Pyrrolo-quinoline quinone; all beta protein. incom | 94.6 | |
| 2hz6_A | 369 | Endoplasmic reticulum to nucleus signalling 1 isof | 94.59 | |
| 2ece_A | 462 | 462AA long hypothetical selenium-binding protein; | 94.17 | |
| 2ad6_A | 571 | Methanol dehydrogenase subunit 1; PQQ configuratio | 93.82 | |
| 1kb0_A | 677 | Quinohemoprotein alcohol dehydrogenase; beta-prope | 93.6 | |
| 1yiq_A | 689 | Quinohemoprotein alcohol dehydrogenase; electron t | 92.82 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 92.14 | |
| 2p4o_A | 306 | Hypothetical protein; putative lactonase, structur | 91.64 | |
| 1fwx_A | 595 | Nitrous oxide reductase; beta-propeller domain, cu | 91.58 | |
| 2xe4_A | 751 | Oligopeptidase B; hydrolase-inhibitor complex, hyd | 91.47 | |
| 1w6s_A | 599 | Methanol dehydrogenase subunit 1; anisotropic, ele | 91.38 | |
| 3nok_A | 268 | Glutaminyl cyclase; beta-propeller, cyclotransfera | 91.36 | |
| 2ece_A | 462 | 462AA long hypothetical selenium-binding protein; | 91.06 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 90.49 | |
| 3q7m_A | 376 | Lipoprotein YFGL, BAMB; beta-propeller, BAM comple | 90.16 | |
| 2p4o_A | 306 | Hypothetical protein; putative lactonase, structur | 90.08 | |
| 3q7m_A | 376 | Lipoprotein YFGL, BAMB; beta-propeller, BAM comple | 89.93 | |
| 2xe4_A | 751 | Oligopeptidase B; hydrolase-inhibitor complex, hyd | 89.71 | |
| 1fwx_A | 595 | Nitrous oxide reductase; beta-propeller domain, cu | 89.67 | |
| 3mbr_X | 243 | Glutamine cyclotransferase; beta-propeller; 1.44A | 89.44 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 88.45 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 86.6 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 86.21 | |
| 3pbp_A | 452 | Nucleoporin NUP82; beta-propeller, mRNA export, mR | 86.13 | |
| 1k3i_A | 656 | Galactose oxidase precursor; blade beta propeller, | 85.26 | |
| 2fp8_A | 322 | Strictosidine synthase; six bladed beta propeller | 84.35 | |
| 4gq2_M | 950 | Nucleoporin NUP120; beta propeller alpha helical, | 82.36 | |
| 1tl2_A | 236 | L10, protein (tachylectin-2); animal lectin, horse | 82.07 | |
| 3qqz_A | 255 | Putative uncharacterized protein YJIK; MCSG, PSI-2 | 81.61 | |
| 3sre_A | 355 | PON1, serum paraoxonase; directed evolution, 6-bla | 80.99 |
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.83 E-value=4.3e-20 Score=136.76 Aligned_cols=127 Identities=51% Similarity=0.964 Sum_probs=106.0
Q ss_pred CceeceEEEEEeeCCCC-cceeEEEeeeC-------CCCccceeEEEEeCCCCEEEEEcCCCcEEEEeCCCcceeeeccc
Q 041215 2 GSIEGRVGVHHLDDSQQ-SKNFTFKCHRD-------GSEIYSVNSLNFHPIHHTFATAGSDGAFNFWDKDSKQRLKAMSR 73 (136)
Q Consensus 2 gs~dG~v~i~~~d~~~~-~~~~~l~~h~~-------~~~~~~v~~l~~~p~~~~l~s~~~dg~v~vwd~~~~~~~~~~~~ 73 (136)
|+.||.+.+|.++.... .....+.+|.. ..+.+.|.+++|+|++.+|++++.|+.|++||+.++..+..+..
T Consensus 234 ~~~dg~i~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~sp~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~ 313 (368)
T 3mmy_A 234 GSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQ 313 (368)
T ss_dssp EETTSEEEEEESSCSCHHHHSEEEECSEEC----CCCEEECCEEEEEECTTTCCEEEEETTSCEEEEETTTTEEEEECCC
T ss_pred ecCCCcEEEEecCCCCccccceeeeeeecccccccccccccceEEEEEecCCCEEEEEccCCeEEEEECCCCcEEEEecC
Confidence 67789998855544332 56777777764 11122599999999999999999999999999999999999999
Q ss_pred CCCceeEEEEccCCCEEEEEEcccccccccccCCCCCcceEEEEcCCcccccccCCC
Q 041215 74 CGQPIPCSTFNTDGSIFAYSVCYDWSKGAENHNPATAKTYIYLHLPQETEVKGKPRA 130 (136)
Q Consensus 74 h~~~v~~v~~sp~~~~l~s~~~dd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 130 (136)
|..+|.+++|+|++.+|++++.|+|.+......++ ++..+.++++.+ +++||+||
T Consensus 314 ~~~~v~~~~~s~~g~~l~~~s~d~~~~~~~~~~~~-~~~~i~~~~~~~-~~~p~~~~ 368 (368)
T 3mmy_A 314 LDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQ-KKNYIFLRNAAE-ELKPRNKK 368 (368)
T ss_dssp CSSCEEEEEECTTSSCEEEEECCCSTTCGGGCCTT-SCCEEEEECCTT-TTSBC---
T ss_pred CCCCceEEEECCCCCeEEEEecccccccccccCCC-ccceeeehhcCc-ccCcccCC
Confidence 99999999999999999999999999999888777 788999999987 99999987
|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 | Back alignment and structure |
|---|
| >3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 | Back alignment and structure |
|---|
| >3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} | Back alignment and structure |
|---|
| >1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 | Back alignment and structure |
|---|
| >3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* | Back alignment and structure |
|---|
| >1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 | Back alignment and structure |
|---|
| >1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 | Back alignment and structure |
|---|
| >1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A | Back alignment and structure |
|---|
| >2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} | Back alignment and structure |
|---|
| >1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* | Back alignment and structure |
|---|
| >3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A | Back alignment and structure |
|---|
| >2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 | Back alignment and structure |
|---|
| >3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A | Back alignment and structure |
|---|
| >2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} | Back alignment and structure |
|---|
| >1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A | Back alignment and structure |
|---|
| >3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 | Back alignment and structure |
|---|
| >3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A | Back alignment and structure |
|---|
| >1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A | Back alignment and structure |
|---|
| >2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* | Back alignment and structure |
|---|
| >4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B | Back alignment and structure |
|---|
| >1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* | Back alignment and structure |
|---|
| >3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 136 | ||||
| d1yfqa_ | 342 | b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake | 5e-13 | |
| d1yfqa_ | 342 | b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake | 2e-04 | |
| d1tbga_ | 340 | b.69.4.1 (A:) beta1-subunit of the signal-transduc | 5e-07 | |
| d1tbga_ | 340 | b.69.4.1 (A:) beta1-subunit of the signal-transduc | 2e-04 | |
| d1tbga_ | 340 | b.69.4.1 (A:) beta1-subunit of the signal-transduc | 0.001 | |
| d1vyhc1 | 317 | b.69.4.1 (C:92-408) Platelet-activating factor ace | 4e-05 | |
| d1vyhc1 | 317 | b.69.4.1 (C:92-408) Platelet-activating factor ace | 7e-04 | |
| d1erja_ | 388 | b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea | 3e-04 | |
| d1erja_ | 388 | b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea | 0.002 | |
| d1k8kc_ | 371 | b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 | 0.001 | |
| d1gxra_ | 337 | b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum | 0.003 |
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: WD40 repeat-like family: Cell cycle arrest protein BUB3 domain: Cell cycle arrest protein BUB3 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 62.2 bits (149), Expect = 5e-13
Identities = 37/125 (29%), Positives = 54/125 (43%), Gaps = 11/125 (8%)
Query: 1 VGSIEGRVGVHHLDDS----QQSKNFTFKCHR----DGSEIYSVNSLNFHPIHHTFATAG 52
SI+GRV V DD SK F F+CHR D + Y VNS+ F P H TAG
Sbjct: 211 CSSIDGRVAVEFFDDQGDDYNSSKRFAFRCHRLNLKDTNLAYPVNSIEFSPRHKFLYTAG 270
Query: 53 SDGAFNFWDKDSKQRLKAMSRCGQPIPCSTFNTDGSIFAYSVCYDWSK--GAENHNPATA 110
SDG + W+ +++++K ++ +I + D K A +
Sbjct: 271 SDGIISCWNLQTRKKIKNFAK-FNEDSVVKIACSDNILCLATSDDTFKTNAAIDQTIELN 329
Query: 111 KTYIY 115
+ IY
Sbjct: 330 ASSIY 334
|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 99.65 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 99.57 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 99.54 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 99.51 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 99.5 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 99.48 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.46 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 99.45 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.42 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 99.41 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.38 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 99.37 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 99.34 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.32 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 99.29 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 99.28 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.27 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 99.25 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 99.25 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 99.23 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 99.23 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.22 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 99.19 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 99.14 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 99.14 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 99.11 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.07 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 99.03 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 98.99 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.99 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 98.97 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 98.96 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 98.93 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 98.86 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 98.84 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 98.83 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 98.51 | |
| d2bgra1 | 470 | Dipeptidyl peptidase IV/CD26, N-terminal domain {P | 98.34 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 98.31 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 98.26 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 98.26 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 98.25 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 98.21 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 98.2 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 98.19 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 98.16 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 98.13 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 97.78 | |
| d2bgra1 | 470 | Dipeptidyl peptidase IV/CD26, N-terminal domain {P | 97.66 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 97.55 | |
| d2hqsa1 | 269 | TolB, C-terminal domain {Escherichia coli [TaxId: | 96.8 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 96.58 | |
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 96.34 | |
| d1qnia2 | 441 | Nitrous oxide reductase, N-terminal domain {Pseudo | 95.95 | |
| d1k32a2 | 281 | Tricorn protease N-terminal domain {Archaeon Therm | 95.82 | |
| d2dg1a1 | 319 | Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 | 95.63 | |
| d2hqsa1 | 269 | TolB, C-terminal domain {Escherichia coli [TaxId: | 95.59 | |
| d1xfda1 | 465 | Dipeptidyl aminopeptidase-like protein 6, DPP6, N- | 95.23 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 95.03 | |
| d1jofa_ | 365 | 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu | 94.95 | |
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 94.87 | |
| d1qnia2 | 441 | Nitrous oxide reductase, N-terminal domain {Pseudo | 94.79 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 94.01 | |
| d1kv9a2 | 560 | Quinoprotein alcohol dehydrogenase, N-terminal dom | 93.92 | |
| d1k32a2 | 281 | Tricorn protease N-terminal domain {Archaeon Therm | 93.87 | |
| d1flga_ | 582 | Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax | 93.83 | |
| d1kb0a2 | 573 | Quinoprotein alcohol dehydrogenase, N-terminal dom | 93.71 | |
| d1xfda1 | 465 | Dipeptidyl aminopeptidase-like protein 6, DPP6, N- | 93.3 | |
| d1jofa_ | 365 | 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu | 93.13 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 93.06 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 92.16 | |
| d2dg1a1 | 319 | Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 | 92.04 | |
| d1w6sa_ | 596 | Methanol dehydrogenase, heavy chain {Methylobacter | 91.29 | |
| d2ghsa1 | 295 | Regucalcin {Agrobacterium tumefaciens [TaxId: 358] | 91.05 | |
| d2ad6a1 | 571 | Methanol dehydrogenase, heavy chain {Methylophilus | 90.72 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 86.03 | |
| d2ghsa1 | 295 | Regucalcin {Agrobacterium tumefaciens [TaxId: 358] | 82.76 | |
| d1qfma1 | 430 | Prolyl oligopeptidase, N-terminal domain {Pig (Sus | 82.39 | |
| d1k3ia3 | 387 | Galactose oxidase, central domain {Fungi (Fusarium | 81.24 |
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: WD40 repeat-like family: WD40-repeat domain: Platelet-activating factor acetylhydrolase IB subunit alpha species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.65 E-value=2.9e-16 Score=110.74 Aligned_cols=91 Identities=16% Similarity=0.216 Sum_probs=83.8
Q ss_pred CceeceEEEEEeeCCCCcceeEEEeeeCCCCccceeEEEEeCCCCEEEEEcCCCcEEEEeCCCcceeeecccCCCceeEE
Q 041215 2 GSIEGRVGVHHLDDSQQSKNFTFKCHRDGSEIYSVNSLNFHPIHHTFATAGSDGAFNFWDKDSKQRLKAMSRCGQPIPCS 81 (136)
Q Consensus 2 gs~dG~v~i~~~d~~~~~~~~~l~~h~~~~~~~~v~~l~~~p~~~~l~s~~~dg~v~vwd~~~~~~~~~~~~h~~~v~~v 81 (136)
|+.||.|.+ ||.++++...++.+|.. .|.+++|+|++.+|++++.||.|++||+.+++.+.++.+|.+.|+++
T Consensus 223 ~~~d~~i~~--~~~~~~~~~~~~~~~~~-----~v~~~~~~~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~h~~~V~~~ 295 (317)
T d1vyhc1 223 GSRDKTIKM--WDVSTGMCLMTLVGHDN-----WVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSL 295 (317)
T ss_dssp EETTSEEEE--EETTTTEEEEEEECCSS-----CEEEEEECSSSSCEEEEETTTEEEEECCTTSCCCEEEECCSSCEEEE
T ss_pred ccCCCEEEE--EECCCCcEEEEEeCCCC-----CEEEEEECCCCCEEEEEECCCeEEEEECCCCcEEEEEcCCCCCEEEE
Confidence 567888877 78888999999999999 99999999999999999999999999999999999999999999999
Q ss_pred EEccCCCEEEEEEccccc
Q 041215 82 TFNTDGSIFAYSVCYDWS 99 (136)
Q Consensus 82 ~~sp~~~~l~s~~~dd~~ 99 (136)
+|+|++++|++|+.|...
T Consensus 296 ~~s~~~~~l~s~s~Dg~i 313 (317)
T d1vyhc1 296 DFHKTAPYVVTGSVDQTV 313 (317)
T ss_dssp EECSSSSCEEEEETTSEE
T ss_pred EEcCCCCEEEEEeCCCeE
Confidence 999999999999887643
|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|
| >d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} | Back information, alignment and structure |
|---|
| >d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|
| >d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} | Back information, alignment and structure |
|---|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} | Back information, alignment and structure |
|---|