Citrus Sinensis ID: 041235

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360--
MTGYRELSHDLLVETLSRLPVKSLMRFRCVSKSWFSLLKDPNFIYKHLNRDDNMRLMVRVTYENYDVKDPFNDLITCFFLIPDKTLTDLHFQDLEAEMKDHNPLGPCDGIFCFFENENIYLWNVSMNEYRIVTKRKARLPCNTSIYCYNFGLGLDPTTNDFKLVLILTLYDGKRLSVHDLLPVAIYNFSTNSWRDLEGLFQMGHYYGSDSTDNVYLNGYCYWVASGHNSYNASILSFSMSDEVFEEIKGPNFPQITTYDESEMTSWRIGIYDGSLSLLYSEESGHSFSLWMMKGGFWTKHLSFGPFMEAYQPLGFWRNGEFFLESSDNRLVLYDSRYEEIRDLEITGIWFSVNILKESLIRL
ccccccccHHHHHHHHHcccHHHHHHHccccccHHHHcccHHHHHHHHcccccccEEEEEEEcccccccccccccEEEEcccccccccccccccccccccEEEEEccccEEEEEEccEEEEEEcccccEEEcccccccccccccccEEEEEEEEccccccEEEEEEEEEEcccccccccccEEEEEEcccccEEEEcccccccccccccccccEEEccEEEEEEEEcccccEEEEEEEccccEEEEEccccccccccccccccEEEEEEEEccEEEEEEEEccccEEEEEEEcccEEEEEEEEcccccccEEEEEEEcccEEEEEEccEEEEEEccccEEEEEEEEcEEEEEEEEEcccccc
ccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccEEEEEEEEccccccccccccccccccccccccccccccccccEEEEEEEcccEEEEEEccccEEEEccccccEEEEcccccccccccccEEEEEEEccccccccEEEEEEEEEcccccccccccEEEEEEEcccccEEEEEccccccccccccccccEEEEEEEEEEEEEcccccEEEEEEEccccccccccccccccccccccccccEEEEEEEccEEEEEEEcccccEEEEEEEEcEEEEEEEEEcccccccEEEEEEEccEEEEEccccEEEEEEcccccEEEEEEcccEEEEEEEccccccc
MTGYRELSHDLLVETlsrlpvkslmRFRCVSkswfsllkdpnfiykhlnrddnMRLMVRVTyenydvkdpfndlitcfflipdktltdlHFQDLEAemkdhnplgpcdgifcffeneNIYLWNVSMNEYRIVTKrkarlpcntsiycynfglgldpttndFKLVLILTLydgkrlsvhdllPVAIYNFSTNSWRDLEGLFqmghyygsdstdnvyLNGYCYWVASGHNSYNASILSFSMSDEvfeeikgpnfpqittydesemtswrigiYDGSLSLLYSEESGHSFSLWMMkggfwtkhlsfgpfmeayqplgfwrngefflessDNRLVLYDSRYEEIRDLEITGIWFSVNILKESLIRL
mtgyrelshdllvetlsrlpvkslMRFRCVSkswfsllkdpnfiykhlnrddnmRLMVRVTYENYDVKDPFNDLITCFFLIPDKTLTDLHFQDLEAEMKDHNPLGPCDGIFCFFENENIYLWNVSMNEYRIVTKRKARLPCNTSIYCYNFGLGLDPTTNDFKLVLILTLYDGKRLSVHDLLPVAIYNFSTNSWRDLEGLFQMGHYYGSDSTDNVYLNGYCYWVASGHNSYNASILSFSMSDEVFEEIKGPNFPQITTYDESEMTSWRIGIYDGSLSLLYSEESGHSFSLWMMKGGFWTKHLSFGPFMEAYQPLGFWRNGEFFLESSDNRLVLYDSRYEEIRdleitgiwfsvnilkeslirl
MTGYRELSHDLLVETLSRLPVKSLMRFRCVSKSWFSLLKDPNFIYKHLNRDDNMRLMVRVTYENYDVKDPFNDLITCFFLIPDKTLTDLHFQDLEAEMKDHNPLGPCDGIFCFFENENIYLWNVSMNEYRIVTKRKARLPCNTSIYCYNFGLGLDPTTNDFKLVLILTLYDGKRLSVHDLLPVAIYNFSTNSWRDLEGLFQMGHYYGSDSTDNVYLNGYCYWVASGHNSYNASILSFSMSDEVFEEIKGPNFPQITTYDESEMTSWRIGIYDgslsllyseesghsFSLWMMKGGFWTKHLSFGPFMEAYQPLGFWRNGEFFLESSDNRLVLYDSRYEEIRDLEITGIWFSVNILKESLIRL
********HDLLVETLSRLPVKSLMRFRCVSKSWFSLLKDPNFIYKHLNRDDNMRLMVRVTYENYDVKDPFNDLITCFFLIPDKTLTDLHFQDLEAEMKDHNPLGPCDGIFCFFENENIYLWNVSMNEYRIVTKRKARLPCNTSIYCYNFGLGLDPTTNDFKLVLILTLYDGKRLSVHDLLPVAIYNFSTNSWRDLEGLFQMGHYYGSDSTDNVYLNGYCYWVASGHNSYNASILSFSMSDEVFEEIKGPNFPQITTYDESEMTSWRIGIYDGSLSLLYSEESGHSFSLWMMKGGFWTKHLSFGPFMEAYQPLGFWRNGEFFLESSDNRLVLYDSRYEEIRDLEITGIWFSVNILKES****
*****ELSHDLLVETLSRLPVKSLMRFRCVSKSWFSLLKDPNFIYKHLNRDDNMRLMVRVTYENYDVKDPFNDLITCFFLIPDKTLTDLHFQDLEAEMKDHNPLGPCDGIFCFFENENIYLWNVSMNEYRIVTKRKARLPCNTSIYCYNFGLGLDPTTNDFKLVLILTLYDGKRLSVHDLLPVAIYNFSTNSWRDLEGLFQMGHYYGSDSTDNVYLNGYCYWVASGHNSYNASILSFSMSDEVFEEIKGPNFPQITTYDESEMTSWRIGIYDGSLSLLYSEESGHSFSLWMMKGGFWTKHLSFGPFMEAYQPLGFWRNGEFFLESSDNRLVLYDSRYEEIRDLEITGIWFSVNILKESLIRL
********HDLLVETLSRLPVKSLMRFRCVSKSWFSLLKDPNFIYKHLNRDDNMRLMVRVTYENYDVKDPFNDLITCFFLIPDKTLTDLHFQDLEAEMKDHNPLGPCDGIFCFFENENIYLWNVSMNEYRIVTKRKARLPCNTSIYCYNFGLGLDPTTNDFKLVLILTLYDGKRLSVHDLLPVAIYNFSTNSWRDLEGLFQMGHYYGSDSTDNVYLNGYCYWVASGHNSYNASILSFSMSDEVFEEIKGPNFPQITTYDESEMTSWRIGIYDGSLSLLYSEESGHSFSLWMMKGGFWTKHLSFGPFMEAYQPLGFWRNGEFFLESSDNRLVLYDSRYEEIRDLEITGIWFSVNILKESLIRL
****RELSHDLLVETLSRLPVKSLMRFRCVSKSWFSLLKDPNFIYKHLNRDDNMRLMVRVTYENYDVKDPFNDLITCFFLIPDKTLTDLHFQDLEAEMKDHNPLGPCDGIFCFFENENIYLWNVSMNEYRIVTKRKARLPCNTSIYCYNFGLGLDPTTNDFKLVLILTLYDGKRLSVHDLLPVAIYNFSTNSWRDLEGLFQMGHYYGSDSTDNVYLNGYCYWVASGHNSYNASILSFSMSDEVFEEIKGPNFPQITTYDESEMTSWRIGIYDGSLSLLYSEESGHSFSLWMMKGGFWTKHLSFGPFMEAYQPLGFWRNGEFFLESSDNRLVLYDSRYEEIRDLEITGIWFSVNILKESLIRL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTGYRELSHDLLVETLSRLPVKSLMRFRCVSKSWFSLLKDPNFIYKHLNRDDNMRLMVRVTYENYDVKDPFNDLITCFFLIPDKTLTDLHFQDLEAEMKDHNPLGPCDGIFCFFENENIYLWNVSMNEYRIVTKRKARLPCNTSIYCYNFGLGLDPTTNDFKLVLILTLYDGKRLSVHDLLPVAIYNFSTNSWRDLEGLFQMGHYYGSDSTDNVYLNGYCYWVASGHNSYNASILSFSMSDEVFEEIKGPNFPQITTYDESEMTSWRIGIYDGSLSLLYSEESGHSFSLWMMKGGFWTKHLSFGPFMEAYQPLGFWRNGEFFLESSDNRLVLYDSRYEEIRDLEITGIWFSVNILKESLIRL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query362 2.2.26 [Sep-21-2011]
Q8GXC7427 F-box/kelch-repeat protei yes no 0.906 0.768 0.254 6e-17
Q9LUP5388 F-box/kelch-repeat protei no no 0.787 0.734 0.270 5e-14
Q9LU24360 Putative F-box protein At no no 0.712 0.716 0.267 1e-13
Q4PSN6410 F-box/WD-40 repeat-contai no no 0.848 0.748 0.25 3e-13
Q9C9Y4369 F-box protein At3g08750 O no no 0.737 0.723 0.252 3e-13
Q9LIR8364 F-box/kelch-repeat protei no no 0.773 0.769 0.257 2e-12
Q9CAE7370 Putative F-box protein At no no 0.662 0.648 0.282 5e-12
Q9SAB5363 Putative F-box/LRR-repeat no no 0.756 0.754 0.258 6e-12
Q9FZF8389 Putative F-box protein At no no 0.577 0.537 0.267 2e-11
Q9LUU3386 Putative F-box/kelch-repe no no 0.638 0.598 0.266 3e-11
>sp|Q8GXC7|FBK50_ARATH F-box/kelch-repeat protein At3g06240 OS=Arabidopsis thaliana GN=At3g06240 PE=2 SV=1 Back     alignment and function desciption
 Score = 89.0 bits (219), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 104/409 (25%), Positives = 168/409 (41%), Gaps = 81/409 (19%)

Query: 7   LSHDLLVETLSRLPVKSLMRFRCVSKSWFSLLKDPNFIYKHLN---RDDNMRLMVR---V 60
           L  +++ E L RLP KS+ RFRCVSK + +L  DP F   HL+   R++++R + R   V
Sbjct: 36  LPPEIITEILLRLPAKSIGRFRCVSKLFCTLSSDPGFAKIHLDLILRNESVRSLHRKLIV 95

Query: 61  TYENY------DVKDPFNDLITCFFLIPDKTLTDLHFQDLEAEMKDH------------- 101
           +  N        + D   DL       P K    +  + +   + DH             
Sbjct: 96  SSHNLYSLDFNSIGDGIRDLAAVEHNYPLKDDPSIFSEMIRNYVGDHLYDDRRVMLKLNA 155

Query: 102 --------NPLGPCDGIFCFFENEN-IYLWNVSMNEYRIVTKRKARLPCNTSIYCY---- 148
                     +G  +G+ C    E  ++L+N +  + +       RLP N          
Sbjct: 156 KSYRRNWVEIVGSSNGLVCISPGEGAVFLYNPTTGDSK-------RLPENFRPKSVEYER 208

Query: 149 ----NFGLGLDPTTNDFKLVLILTLYDGKRLSVHDLLPVAIYNFSTNSWRDLEGLFQMGH 204
                +G G D  T+D+KLV ++        +  D+L  ++Y+   +SWR +  L    H
Sbjct: 209 DNFQTYGFGFDGLTDDYKLVKLVA-------TSEDILDASVYSLKADSWRRICNL-NYEH 260

Query: 205 YYGSDSTDNVYLNGYCYWVASGHNSYNASILSFSMSDEVFEEIKGPNFPQITTYDESEMT 264
             GS  T  V+ NG  +WV +        +++F +  E F E+  P        DE+E  
Sbjct: 261 NDGS-YTSGVHFNGAIHWVFTESRHNQRVVVAFDIQTEEFREMPVP--------DEAEDC 311

Query: 265 SWR-----IGIYDGSLSLLYSEESGHSFSLWMM----KGGFWTKHLSFGPFMEAYQPLGF 315
           S R     +G  +G L ++ S    H   +W+M    +   W++ +       + +PL  
Sbjct: 312 SHRFSNFVVGSLNGRLCVVNSCYDVHD-DIWVMSEYGEAKSWSR-IRINLLYRSMKPLCS 369

Query: 316 WRNGEFFLESSDNRLVLYDSRYEEIRDLEITGI----WFSVNILKESLI 360
            +N E  L   D  LVLY+       +L I G+     F  N   ESLI
Sbjct: 370 TKNDEEVLLELDGDLVLYNFETNASSNLGICGVKLSDGFEANTYVESLI 418

Arabidopsis thaliana (taxid: 3702)
>sp|Q9LUP5|FBK59_ARATH F-box/kelch-repeat protein At3g17530 OS=Arabidopsis thaliana GN=At3g17530 PE=2 SV=2 Back     alignment and function description
>sp|Q9LU24|FB145_ARATH Putative F-box protein At3g16210 OS=Arabidopsis thaliana GN=At3g16210 PE=4 SV=1 Back     alignment and function description
>sp|Q4PSN6|FBW1_ARATH F-box/WD-40 repeat-containing protein 1 OS=Arabidopsis thaliana GN=FBW1 PE=2 SV=1 Back     alignment and function description
>sp|Q9C9Y4|FB136_ARATH F-box protein At3g08750 OS=Arabidopsis thaliana GN=At3g08750 PE=2 SV=1 Back     alignment and function description
>sp|Q9LIR8|FBK67_ARATH F-box/kelch-repeat protein At3g23880 OS=Arabidopsis thaliana GN=At3g23880 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAE7|FB138_ARATH Putative F-box protein At3g10430 OS=Arabidopsis thaliana GN=At3g10430 PE=4 SV=1 Back     alignment and function description
>sp|Q9SAB5|FBLK2_ARATH Putative F-box/LRR-repeat/kelch-repeat protein At1g11620 OS=Arabidopsis thaliana GN=At1g11620 PE=4 SV=1 Back     alignment and function description
>sp|Q9FZF8|FB44_ARATH Putative F-box protein At1g47790 OS=Arabidopsis thaliana GN=At1g47790 PE=4 SV=1 Back     alignment and function description
>sp|Q9LUU3|FBK58_ARATH Putative F-box/kelch-repeat protein At3g17280 OS=Arabidopsis thaliana GN=At3g17280 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query362
224119696367 predicted protein [Populus trichocarpa] 0.908 0.896 0.306 2e-37
197253339395 SFBB26-beta [Pyrus x bretschneideri] 0.914 0.837 0.315 1e-33
197253329395 SFBB12-beta [Pyrus pyrifolia] 0.914 0.837 0.310 2e-33
197253331395 SFBB13-beta [Pyrus x bretschneideri] 0.878 0.805 0.316 4e-33
197253337395 SFBB19-beta [Pyrus x bretschneideri] 0.914 0.837 0.318 6e-33
293337879387 SFBBbeta protein, partial [Pyrus pyrifol 0.895 0.837 0.311 5e-32
301069172393 MdFBX17 [Malus x domestica] 0.936 0.862 0.305 2e-30
293337845387 SFBBbeta protein [Pyrus communis] 0.895 0.837 0.306 2e-30
198400307393 F-box protein FB1 [Malus x domestica] 0.936 0.862 0.305 3e-30
197253309402 SFBB16-alpha [Pyrus x bretschneideri] 0.914 0.823 0.317 1e-29
>gi|224119696|ref|XP_002318137.1| predicted protein [Populus trichocarpa] gi|222858810|gb|EEE96357.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  162 bits (411), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 113/369 (30%), Positives = 188/369 (50%), Gaps = 40/369 (10%)

Query: 7   LSHDLLVETLSRLPVKSLMRFRCVSKSWFSLLKDPNFIYKHLNRDDNMRLMVRVTYENYD 66
           L  D+++E LS LPVK+L++F+CV KSW+ ++   NFI  HLN            Y N  
Sbjct: 9   LPEDVIIEILSLLPVKTLLQFKCVCKSWYGIITSSNFISLHLNNH----------YNNIK 58

Query: 67  VKDPFNDLIT--CFFLIPDKTLTDLHFQDLEAEMKDHNPLGPCDGIFCFFENENIY---L 121
                   +      L  D++LTDL  Q L+  ++     GPC+GIF + ++E+     L
Sbjct: 59  SGHLLAHFVCPQLLELFQDESLTDLSHQGLDPPIRGR-LCGPCNGIF-YVDSEDSSGSGL 116

Query: 122 WNVSMNEYRIVTKR---KARLPCNTSIYCYNFGLGLDPTTNDFKLVLILTLYDGKRLSVH 178
           WN +  E++++ ++   K+ LP     Y  ++G G DP TND+K+V+I   Y   R    
Sbjct: 117 WNPATKEFKLLPEKIRNKSSLPL---YYEDSYGFGFDPVTNDYKVVVIRESY--TREYYL 171

Query: 179 DLLP---VAIYNFSTNSWRDLEGLFQMGHYYGSDSTDNVYLNGYCYWVASGHNSYNASIL 235
           +  P   V +Y   T+SWR    L Q     G+    NV  +G  YW A GH  +   IL
Sbjct: 172 EKFPSSLVIVYTLRTDSWRCWGSLDQGYTLLGNYCYTNV--DGVYYWQA-GHGVHMNVIL 228

Query: 236 SFSMSDEVFEEIKGPNFPQITTYDESEMTSWRIGIYDGSLSLLYSEESGHSFSLWMMKGG 295
           SF+M+ + F+EI+ P++       +    S R+ +Y  S++            +W++  G
Sbjct: 229 SFNMATDAFQEIQEPDY-------DKPAYSTRLILYHDSIAFSTVHNVEKFLDIWVLNEG 281

Query: 296 FWTKHLSFGPFMEAYQPLGFWRNGEFFLESSDNRLVLYDSRYEEIRDLEI--TGIWFSVN 353
            W +     P +E   P+  W+NG   L+S +++L+LYD+  +E++DL    TG+ + + 
Sbjct: 282 CWIRQFKSRPLLELRNPVAHWKNGNVILDSDNDQLMLYDTNKQELKDLRFKGTGVCYEIL 341

Query: 354 ILKESLIRL 362
           + +ESL+ +
Sbjct: 342 VYRESLVSI 350

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|197253339|gb|ACH54104.1| SFBB26-beta [Pyrus x bretschneideri] Back     alignment and taxonomy information
>gi|197253329|gb|ACH54099.1| SFBB12-beta [Pyrus pyrifolia] Back     alignment and taxonomy information
>gi|197253331|gb|ACH54100.1| SFBB13-beta [Pyrus x bretschneideri] Back     alignment and taxonomy information
>gi|197253337|gb|ACH54103.1| SFBB19-beta [Pyrus x bretschneideri] Back     alignment and taxonomy information
>gi|293337879|gb|ADE43183.1| SFBBbeta protein, partial [Pyrus pyrifolia] Back     alignment and taxonomy information
>gi|301069172|dbj|BAJ11965.1| MdFBX17 [Malus x domestica] Back     alignment and taxonomy information
>gi|293337845|gb|ADE43166.1| SFBBbeta protein [Pyrus communis] Back     alignment and taxonomy information
>gi|198400307|gb|ACH87163.1| F-box protein FB1 [Malus x domestica] Back     alignment and taxonomy information
>gi|197253309|gb|ACH54089.1| SFBB16-alpha [Pyrus x bretschneideri] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query362
TAIR|locus:2076196364 AT3G23880 "AT3G23880" [Arabido 0.618 0.615 0.265 4.4e-17
TAIR|locus:2090567388 AT3G17530 "AT3G17530" [Arabido 0.646 0.603 0.283 1.5e-16
TAIR|locus:2075790370 AT3G10430 "AT3G10430" [Arabido 0.599 0.586 0.305 3.7e-15
TAIR|locus:2090577396 AT3G17540 "AT3G17540" [Arabido 0.914 0.835 0.243 1.6e-12
TAIR|locus:2088985386 AT3G17280 "AT3G17280" [Arabido 0.643 0.603 0.275 3.6e-12
TAIR|locus:2090507388 AT3G17490 "AT3G17490" [Arabido 0.848 0.791 0.232 7.3e-12
TAIR|locus:2027397363 AT1G11620 "AT1G11620" [Arabido 0.886 0.884 0.241 5.2e-11
TAIR|locus:2202023364 AT1G12170 "AT1G12170" [Arabido 0.610 0.607 0.270 5.3e-11
TAIR|locus:2094409372 AT3G22730 "AT3G22730" [Arabido 0.627 0.610 0.286 5.5e-11
TAIR|locus:2202002375 AT1G12190 "AT1G12190" [Arabido 0.588 0.568 0.296 5.7e-11
TAIR|locus:2076196 AT3G23880 "AT3G23880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 227 (85.0 bits), Expect = 4.4e-17, P = 4.4e-17
 Identities = 67/252 (26%), Positives = 119/252 (47%)

Query:    10 DLLVETLSRLPVKSLMRFRCVSKSWFSLLKDPNFIYKHLNRDDNMRLMVRVTYENYDVKD 69
             +++ E L RLPVKSL RF+CV  SW SL+ +  F  KH        L++  +      K 
Sbjct:    17 EMMEEILLRLPVKSLTRFKCVCSSWRSLISETLFALKHA-------LILETSKATTSTKS 69

Query:    70 PFNDLITCFFLIPDKTLTDLH------FQDLEAEM--KDH-NPLGPCDGIFCFFEN--EN 118
             P+  + T  + +    +  L+        + + E+  +D+   +G C G+ CF  +  ++
Sbjct:    70 PYGVITTSRYHLKSCCIHSLYNASTVYVSEHDGELLGRDYYQVVGTCHGLVCFHVDYDKS 129

Query:   119 IYLWNVSMNEYRIVTKRKARLPCNTSIYCYNFGLGLDPTTNDFKLVLILTLYDGKRLSVH 178
             +YLWN ++   + ++        +  +  Y FG   D + +D+K+V +L     +R  V 
Sbjct:   130 LYLWNPTIKLQQRLSSSDLETSDDECVVTYGFGY--DESEDDYKVVALLQ----QRHQVK 183

Query:   179 DLLPVAIYNFSTNSWRDLEGLFQMGHYYGSDSTDNVYLNGYCYWVASGHNSYNASILSFS 238
               +   IY+     WR     F  G      S   +Y+NG   W A+  +S + +I+S+ 
Sbjct:   184 --IETKIYSTRQKLWRSNTS-FPSGVVVADKSRSGIYINGTLNWAATSSSS-SWTIISYD 239

Query:   239 MSDEVFEEIKGP 250
             MS + F+E+ GP
Sbjct:   240 MSRDEFKELPGP 251
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0005634 "nucleus" evidence=IDA
TAIR|locus:2090567 AT3G17530 "AT3G17530" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075790 AT3G10430 "AT3G10430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090577 AT3G17540 "AT3G17540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2088985 AT3G17280 "AT3G17280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090507 AT3G17490 "AT3G17490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027397 AT1G11620 "AT1G11620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202023 AT1G12170 "AT1G12170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094409 AT3G22730 "AT3G22730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202002 AT1G12190 "AT1G12190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query362
TIGR01640230 TIGR01640, F_box_assoc_1, F-box protein interactio 2e-17
pfam0064648 pfam00646, F-box, F-box domain 9e-07
smart0025641 smart00256, FBOX, A Receptor for Ubiquitination Ta 5e-06
pfam1293747 pfam12937, F-box-like, F-box-like 0.002
>gnl|CDD|233502 TIGR01640, F_box_assoc_1, F-box protein interaction domain Back     alignment and domain information 
 Score = 80.1 bits (198), Expect = 2e-17
 Identities = 56/235 (23%), Positives = 98/235 (41%), Gaps = 26/235 (11%)

Query: 104 LGPCDGIFCFFENENIYLWNVSMNEYRIVTKRKARLPCNTSIYCYNFGLGLDPTTNDFKL 163
           + PCDG+ CF   + + +WN S  + R +   K+R     S   +   LG DP    +K+
Sbjct: 1   VVPCDGLICFSYGKRLVVWNPSTGQSRWLPTPKSRRSNKESDTYF---LGYDPIEKQYKV 57

Query: 164 VLILTLYDGKRLSVHDLLPVAIYNFSTNSWRDLEGLFQMGHYYGSDSTDNVYLNGYCYWV 223
           +        +  S H      +Y   +NSWR +E      H+     +  V +NG  Y++
Sbjct: 58  LCFSDRSGNRNQSEHQ-----VYTLGSNSWRTIE--CSPPHH--PLKSRGVCINGVLYYL 108

Query: 224 A-SGHNSYNASILSFSMSDEVFEEIKGPNFPQITTYDESEMTSWRIGIYDGSLSLLYSEE 282
           A +   + +  I+SF +S E F+E      P   +     ++   +  Y G L++L  ++
Sbjct: 109 AYTLKTNPDYFIVSFDVSSERFKEFI--PLPCGNSDSVDYLS---LINYKGKLAVLKQKK 163

Query: 283 SGHSFSLWMMK---GGFWTKHLSF----GPFMEAY-QPLGFWRNGEFFLESSDNR 329
             ++F LW++       W+K  +      P +       GF   GE  L   D  
Sbjct: 164 DTNNFDLWVLNDAGKQEWSKLFTVPIPPLPDLVDDNFLSGFTDKGEIVLCCEDEN 218

This model describes a large family of plant domains, with several hundred members in Arabidopsis thaliana. Most examples are found C-terminal to an F-box (pfam00646), a 60 amino acid motif involved in ubiquitination of target proteins to mark them for degradation. Two-hybid experiments support the idea that most members are interchangeable F-box subunits of SCF E3 complexes. Some members have two copies of this domain. Length = 230
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information
>gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets Back     alignment and domain information
>gnl|CDD|221867 pfam12937, F-box-like, F-box-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 362
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 100.0
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 99.64
PF07734164 FBA_1: F-box associated; InterPro: IPR006527 This 99.64
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 99.61
PHA02713557 hypothetical protein; Provisional 99.28
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.24
PLN02153341 epithiospecifier protein 99.17
PHA02713557 hypothetical protein; Provisional 99.15
PHA03098534 kelch-like protein; Provisional 99.14
PLN02193470 nitrile-specifier protein 99.12
PHA02790480 Kelch-like protein; Provisional 99.09
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.07
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.95
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 98.87
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 98.86
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.82
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 98.82
PLN02153341 epithiospecifier protein 98.77
PLN02193470 nitrile-specifier protein 98.72
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.71
PHA03098534 kelch-like protein; Provisional 98.69
PHA02790480 Kelch-like protein; Provisional 98.59
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 98.53
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 98.52
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 98.34
KOG4693392 consensus Uncharacterized conserved protein, conta 98.24
KOG1230 521 consensus Protein containing repeated kelch motifs 98.21
KOG4693392 consensus Uncharacterized conserved protein, conta 98.12
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 97.63
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.63
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 97.54
KOG1230 521 consensus Protein containing repeated kelch motifs 96.67
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 96.34
KOG0281499 consensus Beta-TrCP (transducin repeats containing 96.13
KOG2997366 consensus F-box protein FBX9 [General function pre 96.12
smart00284255 OLF Olfactomedin-like domains. 95.71
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 95.71
PF1396450 Kelch_6: Kelch motif 95.63
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 95.22
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 94.64
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 94.28
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 94.08
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 93.56
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 93.13
PF1396450 Kelch_6: Kelch motif 92.17
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 91.45
COG3055381 Uncharacterized protein conserved in bacteria [Fun 91.36
KOG1963 792 consensus WD40 repeat protein [General function pr 91.24
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 90.9
KOG4341483 consensus F-box protein containing LRR [General fu 89.62
KOG3545249 consensus Olfactomedin and related extracellular m 89.24
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 88.84
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 88.56
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 88.08
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 87.96
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 86.48
PF07762131 DUF1618: Protein of unknown function (DUF1618); In 86.02
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 85.91
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 85.59
KOG0293519 consensus WD40 repeat-containing protein [Function 84.89
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 84.69
COG1520 370 FOG: WD40-like repeat [Function unknown] 84.47
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 84.28
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 83.84
COG3055381 Uncharacterized protein conserved in bacteria [Fun 83.16
smart0061247 Kelch Kelch domain. 83.07
KOG0310 487 consensus Conserved WD40 repeat-containing protein 82.53
PRK11138 394 outer membrane biogenesis protein BamB; Provisiona 82.29
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 81.31
smart0056433 PQQ beta-propeller repeat. Beta-propeller repeat o 80.17
PF1341549 Kelch_3: Galactose oxidase, central domain 80.07
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information 
Probab=100.00  E-value=6.1e-34  Score=246.48  Aligned_cols=217  Identities=24%  Similarity=0.404  Sum_probs=163.2

Q ss_pred             eecccccEEEeecCcEEEEeccccceecccCCCCCCCCCCccceeeeEEeecCCCCCeEEEEEEEEecCCcccccCCccE
Q 041235          104 LGPCDGIFCFFENENIYLWNVSMNEYRIVTKRKARLPCNTSIYCYNFGLGLDPTTNDFKLVLILTLYDGKRLSVHDLLPV  183 (362)
Q Consensus       104 ~~s~~GLl~~~~~~~~~v~NP~T~~~~~LP~~~~~~~~~~~~~~~~~~l~~d~~~~~ykvv~~~~~~~~~~~~~~~~~~~  183 (362)
                      ++|||||||+.....++||||+||+++.||+++......   ....++||||+.+++||||++.......     ....+
T Consensus         1 ~~sCnGLlc~~~~~~~~V~NP~T~~~~~LP~~~~~~~~~---~~~~~~~G~d~~~~~YKVv~~~~~~~~~-----~~~~~   72 (230)
T TIGR01640         1 VVPCDGLICFSYGKRLVVWNPSTGQSRWLPTPKSRRSNK---ESDTYFLGYDPIEKQYKVLCFSDRSGNR-----NQSEH   72 (230)
T ss_pred             CcccceEEEEecCCcEEEECCCCCCEEecCCCCCccccc---ccceEEEeecccCCcEEEEEEEeecCCC-----CCccE
Confidence            479999999988788999999999999999865421111   0115899999999999999996432111     11689


Q ss_pred             EEEEcCCCCceecccCcccceeecCCCCccEEECceEEEEeecCCCCc-cEEEEEECCCceee-EecCCCCCCCCCCCCC
Q 041235          184 AIYNFSTNSWRDLEGLFQMGHYYGSDSTDNVYLNGYCYWVASGHNSYN-ASILSFSMSDEVFE-EIKGPNFPQITTYDES  261 (362)
Q Consensus       184 ~vyss~~~~W~~~~~~~~~~~~~~~~~~~~v~~~G~lywl~~~~~~~~-~~il~fD~~~~~~~-~i~~P~~~~~~~~~~~  261 (362)
                      +||++++++||.++......  .  ....+|++||++||++....+.. ..|++||+.+|+|+ .+++|....      .
T Consensus        73 ~Vys~~~~~Wr~~~~~~~~~--~--~~~~~v~~~G~lyw~~~~~~~~~~~~IvsFDl~~E~f~~~i~~P~~~~------~  142 (230)
T TIGR01640        73 QVYTLGSNSWRTIECSPPHH--P--LKSRGVCINGVLYYLAYTLKTNPDYFIVSFDVSSERFKEFIPLPCGNS------D  142 (230)
T ss_pred             EEEEeCCCCccccccCCCCc--c--ccCCeEEECCEEEEEEEECCCCCcEEEEEEEcccceEeeeeecCcccc------c
Confidence            99999999999988522211  1  12349999999999997652222 37999999999999 589997651      1


Q ss_pred             CCceeEEEEEcCeEEEEEecCCCCEEEEEEEcC---CeeeEEEEecCC--Ccc---eeeEEEeeCCeEEEEEeC--Ce-E
Q 041235          262 EMTSWRIGIYDGSLSLLYSEESGHSFSLWMMKG---GFWTKHLSFGPF--MEA---YQPLGFWRNGEFFLESSD--NR-L  330 (362)
Q Consensus       262 ~~~~~~l~~~~g~L~l~~~~~~~~~~~iW~l~~---~~W~~~~~i~~~--~~~---~~~~~~~~~~~i~~~~~~--~~-l  330 (362)
                      ......|++++|+|+++.......+++||+|++   .+|++.++|+..  ...   ..++++..+|+|++....  .. +
T Consensus       143 ~~~~~~L~~~~G~L~~v~~~~~~~~~~IWvl~d~~~~~W~k~~~i~~~~~~~~~~~~~~~~~~~~g~I~~~~~~~~~~~~  222 (230)
T TIGR01640       143 SVDYLSLINYKGKLAVLKQKKDTNNFDLWVLNDAGKQEWSKLFTVPIPPLPDLVDDNFLSGFTDKGEIVLCCEDENPFYI  222 (230)
T ss_pred             cccceEEEEECCEEEEEEecCCCCcEEEEEECCCCCCceeEEEEEcCcchhhhhhheeEeEEeeCCEEEEEeCCCCceEE
Confidence            122457999999999999865446799999997   679999999842  122   347888889999887653  44 9


Q ss_pred             EEEECCCC
Q 041235          331 VLYDSRYE  338 (362)
Q Consensus       331 ~~yd~~t~  338 (362)
                      +.||++++
T Consensus       223 ~~y~~~~~  230 (230)
T TIGR01640       223 FYYNVGEN  230 (230)
T ss_pred             EEEeccCC
Confidence            99999985

This model describes a large family of plant domains, with several hundred members in Arabidopsis thaliana. Most examples are found C-terminal to an F-box (pfam00646), a 60 amino acid motif involved in ubiquitination of target proteins to mark them for degradation. Two-hybid experiments support the idea that most members are interchangeable F-box subunits of SCF E3 complexes. Some members have two copies of this domain.
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PF07734 FBA_1: F-box associated; InterPro: IPR006527 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3545 consensus Olfactomedin and related extracellular matrix glycoproteins [Extracellular structures] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07762 DUF1618: Protein of unknown function (DUF1618); InterPro: IPR011676 The proteins of this entry are mainly hypothetical proteins expressed by Oryza sativa Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>smart00564 PQQ beta-propeller repeat Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query362
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 5e-04
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 6e-04
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 Back     alignment and structure
 Score = 36.8 bits (86), Expect = 5e-04
 Identities = 12/44 (27%), Positives = 22/44 (50%), Gaps = 1/44 (2%)

Query: 6  ELSHDLLVETLSRLPVKSLMRFRCVSKSWFSLLKDPNFIYKHLN 49
           L  +LL+   S L +  L++   V K W+ L  D   +++ L+
Sbjct: 11 SLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDE-SLWQTLD 53
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query362
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 99.31
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 99.3
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 99.3
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 99.29
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.29
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 99.27
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 99.22
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 99.17
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 99.17
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 99.16
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.16
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 99.12
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 99.12
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 99.09
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 99.08
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 98.98
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 98.81
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.79
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.76
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.57
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.24
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 98.2
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.14
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 97.66
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 97.0
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 96.21
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 95.78
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 94.62
3jro_A 753 Fusion protein of protein transport protein SEC13 93.92
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 93.87
3jrp_A 379 Fusion protein of protein transport protein SEC13 93.87
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 92.9
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 92.78
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 92.65
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 92.49
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 92.4
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 92.23
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 91.8
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 91.71
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 91.3
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 91.21
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 90.98
4e54_B435 DNA damage-binding protein 2; beta barrel, double 90.75
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 89.51
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 89.4
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 89.23
4g56_B357 MGC81050 protein; protein arginine methyltransfera 89.07
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 88.72
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 88.09
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 88.01
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 87.99
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 87.96
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 87.92
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 87.83
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 87.65
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 87.62
2fp8_A322 Strictosidine synthase; six bladed beta propeller 87.6
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 87.31
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 86.89
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 86.65
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 86.58
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 86.38
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 86.28
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 86.23
4e54_B435 DNA damage-binding protein 2; beta barrel, double 85.78
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 85.71
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 85.45
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 85.26
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 85.01
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 84.56
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 83.49
3v65_B386 Low-density lipoprotein receptor-related protein; 83.35
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 83.25
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 83.15
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 83.02
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 82.71
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 82.58
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 82.39
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 82.32
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 82.25
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 82.16
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 81.89
3v9f_A 781 Two-component system sensor histidine kinase/RESP 81.82
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 81.29
3g4e_A 297 Regucalcin; six bladed beta-propeller, gluconolcat 80.9
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 80.05
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
Probab=99.31  E-value=1.7e-10  Score=102.85  Aligned_cols=195  Identities=9%  Similarity=-0.007  Sum_probs=126.6

Q ss_pred             CcEEEEeccccceecccCCCCCCCCCCccceeeeEEeecCCCCCeEEEEEEEEecCCcccccCCccEEEEEcCCCCceec
Q 041235          117 ENIYLWNVSMNEYRIVTKRKARLPCNTSIYCYNFGLGLDPTTNDFKLVLILTLYDGKRLSVHDLLPVAIYNFSTNSWRDL  196 (362)
Q Consensus       117 ~~~~v~NP~T~~~~~LP~~~~~~~~~~~~~~~~~~l~~d~~~~~ykvv~~~~~~~~~~~~~~~~~~~~vyss~~~~W~~~  196 (362)
                      ..++++||.|++|..+|+++.+....       ....++   +  +++.+.... ..   ......+++|+..+++|+.+
T Consensus        70 ~~~~~~d~~~~~W~~~~~~p~~r~~~-------~~~~~~---~--~iyv~GG~~-~~---~~~~~~~~~~d~~~~~W~~~  133 (306)
T 3ii7_A           70 KRMDCYNVVKDSWYSKLGPPTPRDSL-------AACAAE---G--KIYTSGGSE-VG---NSALYLFECYDTRTESWHTK  133 (306)
T ss_dssp             CEEEEEETTTTEEEEEECCSSCCBSC-------EEEEET---T--EEEEECCBB-TT---BSCCCCEEEEETTTTEEEEE
T ss_pred             ceEEEEeCCCCeEEECCCCCccccce-------eEEEEC---C--EEEEECCCC-CC---CcEeeeEEEEeCCCCceEeC
Confidence            57899999999999998876532211       112222   2  344443211 01   11125789999999999998


Q ss_pred             ccCcccceeecCCCCccEEECceEEEEeecCCC-C----ccEEEEEECCCceeeEec-CCCCCCCCCCCCCCCceeEEEE
Q 041235          197 EGLFQMGHYYGSDSTDNVYLNGYCYWVASGHNS-Y----NASILSFSMSDEVFEEIK-GPNFPQITTYDESEMTSWRIGI  270 (362)
Q Consensus       197 ~~~~~~~~~~~~~~~~~v~~~G~lywl~~~~~~-~----~~~il~fD~~~~~~~~i~-~P~~~~~~~~~~~~~~~~~l~~  270 (362)
                      +..+. +.    ....++.++|.+|.+++.... .    ...+..||+.+++|+.++ +|...          ....++.
T Consensus       134 ~~~p~-~r----~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd~~~~~W~~~~~~p~~r----------~~~~~~~  198 (306)
T 3ii7_A          134 PSMLT-QR----CSHGMVEANGLIYVCGGSLGNNVSGRVLNSCEVYDPATETWTELCPMIEAR----------KNHGLVF  198 (306)
T ss_dssp             CCCSS-CC----BSCEEEEETTEEEEECCEESCTTTCEECCCEEEEETTTTEEEEECCCSSCC----------BSCEEEE
T ss_pred             CCCcC-Cc----ceeEEEEECCEEEEECCCCCCCCcccccceEEEeCCCCCeEEECCCccchh----------hcceEEE
Confidence            76211 11    235678899999999874321 1    356999999999999884 45433          2446778


Q ss_pred             EcCeEEEEEecCCCC-EEEEEEEcC--CeeeEEEEecCCCcceeeEEEeeCCeEEEEEe------CCeEEEEECCCCeEE
Q 041235          271 YDGSLSLLYSEESGH-SFSLWMMKG--GFWTKHLSFGPFMEAYQPLGFWRNGEFFLESS------DNRLVLYDSRYEEIR  341 (362)
Q Consensus       271 ~~g~L~l~~~~~~~~-~~~iW~l~~--~~W~~~~~i~~~~~~~~~~~~~~~~~i~~~~~------~~~l~~yd~~t~~~~  341 (362)
                      .+|+|+++....... .-++|+++.  ..|+.+..++...  ....++.-++.++++..      ...+..||+++++|+
T Consensus       199 ~~~~i~v~GG~~~~~~~~~~~~yd~~~~~W~~~~~~p~~r--~~~~~~~~~~~i~v~GG~~~~~~~~~~~~yd~~~~~W~  276 (306)
T 3ii7_A          199 VKDKIFAVGGQNGLGGLDNVEYYDIKLNEWKMVSPMPWKG--VTVKCAAVGSIVYVLAGFQGVGRLGHILEYNTETDKWV  276 (306)
T ss_dssp             ETTEEEEECCEETTEEBCCEEEEETTTTEEEECCCCSCCB--SCCEEEEETTEEEEEECBCSSSBCCEEEEEETTTTEEE
T ss_pred             ECCEEEEEeCCCCCCCCceEEEeeCCCCcEEECCCCCCCc--cceeEEEECCEEEEEeCcCCCeeeeeEEEEcCCCCeEE
Confidence            899999997653221 224566654  8999886554322  12222333778877754      367999999999999


Q ss_pred             EEE
Q 041235          342 DLE  344 (362)
Q Consensus       342 ~i~  344 (362)
                      .+.
T Consensus       277 ~~~  279 (306)
T 3ii7_A          277 ANS  279 (306)
T ss_dssp             EEE
T ss_pred             eCC
Confidence            886
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 362
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 3e-07
d1p22a1118 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b 2e-04
d2ovrb1102 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing 6e-04
d1nexb1100 a.158.1.1 (B:270-369) Cdc4 F-box and linker domain 0.003
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Skp2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 44.3 bits (105), Expect = 3e-07
 Identities = 11/38 (28%), Positives = 18/38 (47%)

Query: 6  ELSHDLLVETLSRLPVKSLMRFRCVSKSWFSLLKDPNF 43
           L  +LL+   S L +  L++   V K W+ L  D + 
Sbjct: 3  SLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESL 40
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query362
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.31
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 98.66
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 98.63
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.57
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.52
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.15
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 98.15
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 98.1
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 95.29
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 89.74
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 87.5
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 86.75
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 86.41
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 86.28
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 86.18
d2ghsa1 295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 83.78
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 82.44
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 81.97
d2dg1a1 319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 80.39
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.31  E-value=2.2e-13  Score=80.47  Aligned_cols=40  Identities=28%  Similarity=0.561  Sum_probs=37.6

Q ss_pred             CCCCCHHHHHHHHccCCccccccccccccchhhhcCCHHH
Q 041235            4 YRELSHDLLVETLSRLPVKSLMRFRCVSKSWFSLLKDPNF   43 (362)
Q Consensus         4 ~~~LP~dll~~IL~rLp~~~l~r~r~VcK~W~~li~~p~F   43 (362)
                      |+.||+|++.+||++||++++.|+++|||+|+.+++++.+
T Consensus         1 f~~LP~eil~~If~~L~~~dl~~~~~Vcr~w~~l~~~~~l   40 (41)
T d1fs1a1           1 WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESL   40 (41)
T ss_dssp             CCSSCHHHHHHHHTTSCGGGHHHHHTTCHHHHHHHTCGGG
T ss_pred             CCcCCHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhCCccc
Confidence            6789999999999999999999999999999999998753
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure