Citrus Sinensis ID: 041295


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MNGNVDISSAYNGDEIGIHIENHRGSGRSRDFMDVDLLEEEPCIKCNRRDESLLVCIQSGCPISVHENCLSCGVKSDDVGNIYCPYFWYKCELMRTKELRKKAMETKKQLACFIDPKSFTGDKKENCRTDKGKELNTSSLHQERNYGYGGCEGQMDDVQVENLIVEVEGKLENAGDNAKTADSCDRFKRALENQSELQDKSYSRENTWD
ccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHccccccccccccccHHccccccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccc
ccccccccccccccccccEEEcccccccccccccccccHcccEEEEcccccEEEEEccccccEEEEHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHcccccccccccccccccccEEEccccccccccccccccccHHEEccccEEEEcccccccEEccccccHHHHHHHHcHHHHccccccccccc
mngnvdissayngdeigihienhrgsgrsrdfmdvdlleeepcikcnrrdeSLLVCIqsgcpisvhenclscgvksddvgniycpyfwYKCELMRTKELRKKAMETKKQLacfidpksftgdkkencrtdkgkelntsslhqernygyggcegqmddvQVENLIVEVEGklenagdnaktadsCDRFKRALENQSElqdksysrentwd
MNGNVDISSAYNGDEIGihienhrgsgrsRDFMDVDLLEEEPCIKCNRRDESLLVCIQSGCPISVHENCLSCGVKSDDVGNIYCPYFWYKCELMRTKELRKKAMETKKQlacfidpksftgdkkencrtdkgkelntsslhqeRNYGYGGCEGQMDDVQVENLIVEVEGklenagdnaktadsCDRFKRALenqselqdksysrentwd
MNGNVDISSAYNGDEIGIHIENHRGSGRSRDFMDVDLLEEEPCIKCNRRDESLLVCIQSGCPISVHENCLSCGVKSDDVGNIYCPYFWYKCELMRTKELRKKAMETKKQLACFIDPKSFTGDKKENCRTDKGKELNTSSLHQERNYGYGGCEGQMDDVQVENLIVEVEGKLENAGDNAKTADSCDRFKRALENQSELQDKSYSRENTWD
***************IGIHI**********DFMDVDLLEEEPCIKCNRRDESLLVCIQSGCPISVHENCLSCGVKSDDVGNIYCPYFWYKCELMRTKELRKKAMETKKQLACFID******************************YGYGGCEGQMDDVQVENLIVEVE*****************************************
****************************************EPCIKCNRRDESLLVCIQSGCPISVHENCLSCGVKSDDVGNIYCPYFWYKCELMR******************************************************************************************************************
MNGNVDISSAYNGDEIGIHIENHRGSGRSRDFMDVDLLEEEPCIKCNRRDESLLVCIQSGCPISVHENCLSCGVKSDDVGNIYCPYFWYKCELMRTKELRKKAMETKKQLACFIDPKSFTGDKKENCRTDKGKELNTSSLHQERNYGYGGCEGQMDDVQVENLIVEVEGKLENAGDNAKTADSCDRFKRALEN****************
********SAYNGDEIGIHIENH****RSRDFMDVDLLEEEPCIKCNRRDESLLVCIQSGCPISVHENCLSCGVKSDDVGNIYCPYFWYKCELMRTKELRKKAMETKKQLACFIDPK*******************TS***QERNYGYGGCEGQMDDVQVENLIVEVEGKLENAGDNAKTADSCDRFKRALENQ***************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNGNVDISSAYNGDEIGIHIENHRGSGRSRDFMDVDLLEEEPCIKCNRRDESLLVCIQSGCPISVHENCLSCGVKSDDVGNIYCPYFWYKCELMRTKELRKKAMETKKQLACFIDPKSFTGDKKENCRTDKGKELNTSSLHQERNYGYGGCEGQMDDVQVENLIVEVEGKLENAGDNAKTADSCDRFKRALENQSELQDKSYSRENTWD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
296085075 566 unnamed protein product [Vitis vinifera] 0.641 0.236 0.344 2e-18
224065645 472 predicted protein [Populus trichocarpa] 0.454 0.201 0.465 7e-15
357462399 351 hypothetical protein MTR_3g082160 [Medic 0.397 0.236 0.469 4e-14
449453762 510 PREDICTED: uncharacterized protein LOC10 0.425 0.174 0.452 5e-14
297739691 774 unnamed protein product [Vitis vinifera] 0.511 0.138 0.389 4e-11
147846688 774 hypothetical protein VITISV_016915 [Viti 0.511 0.138 0.389 4e-11
356546362 466 PREDICTED: uncharacterized protein LOC10 0.349 0.156 0.448 4e-11
356555030 580 PREDICTED: uncharacterized protein LOC10 0.444 0.160 0.377 3e-10
255571552 814 conserved hypothetical protein [Ricinus 0.555 0.142 0.333 1e-09
255539006 422 hypothetical protein RCOM_1598630 [Ricin 0.363 0.180 0.402 2e-09
>gi|296085075|emb|CBI28490.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 87/151 (57%), Gaps = 17/151 (11%)

Query: 5   VDISSAYNGDEI--------GIHIENHRGSGRS-------RDFMDVDLLEEEPCIKCNRR 49
           ++ SS YNG++         G  I   + SG S       + +M+++  ++  CIKC   
Sbjct: 79  LETSSHYNGEQAHQLAPNSSGETIVGTKQSGASGSWDMSTQAWMEIEWTQQSKCIKCGEG 138

Query: 50  DESLLVCIQSGCPISVHENCLSCGVKSDDVGNIYCPYFWYKCELMRTKELRKKAMETKKQ 109
            E +LVC    C ++VHE C++C    DD+G+ YCPY WY+C + ++ E RK+AM +KK 
Sbjct: 139 GE-VLVCSDRVCRLAVHEKCMNCSAAFDDMGDFYCPYCWYRCAIAKSNEARKRAMSSKKA 197

Query: 110 LACFIDPKSFTGD-KKENCRTDKGKELNTSS 139
           L+ F+D K+  G+ +KE  ++  GK+  ++S
Sbjct: 198 LSTFLDTKALCGNQQKEKTKSSNGKKPPSTS 228




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224065645|ref|XP_002301900.1| predicted protein [Populus trichocarpa] gi|222843626|gb|EEE81173.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357462399|ref|XP_003601481.1| hypothetical protein MTR_3g082160 [Medicago truncatula] gi|355490529|gb|AES71732.1| hypothetical protein MTR_3g082160 [Medicago truncatula] Back     alignment and taxonomy information
>gi|449453762|ref|XP_004144625.1| PREDICTED: uncharacterized protein LOC101213119 [Cucumis sativus] gi|449520068|ref|XP_004167056.1| PREDICTED: uncharacterized LOC101213119 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297739691|emb|CBI29873.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147846688|emb|CAN80644.1| hypothetical protein VITISV_016915 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356546362|ref|XP_003541595.1| PREDICTED: uncharacterized protein LOC100787956 [Glycine max] Back     alignment and taxonomy information
>gi|356555030|ref|XP_003545842.1| PREDICTED: uncharacterized protein LOC100806195 [Glycine max] Back     alignment and taxonomy information
>gi|255571552|ref|XP_002526722.1| conserved hypothetical protein [Ricinus communis] gi|223533911|gb|EEF35636.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|255539006|ref|XP_002510568.1| hypothetical protein RCOM_1598630 [Ricinus communis] gi|223551269|gb|EEF52755.1| hypothetical protein RCOM_1598630 [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
TAIR|locus:2035372345 AT1G01150 [Arabidopsis thalian 0.660 0.4 0.268 1.9e-11
TAIR|locus:2144568 420 TRFL10 "TRF-like 10" [Arabidop 0.789 0.392 0.267 5.5e-09
TAIR|locus:2006792429 AT1G14770 [Arabidopsis thalian 0.349 0.170 0.386 5.5e-08
TAIR|locus:2200201314 AT1G68030 [Arabidopsis thalian 0.387 0.257 0.268 0.00082
TAIR|locus:2035372 AT1G01150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 162 (62.1 bits), Expect = 1.9e-11, P = 1.9e-11
 Identities = 39/145 (26%), Positives = 70/145 (48%)

Query:     3 GNVDISSAYNGDEI-GIHIENHRGSGRSRDFMDVDLLEEEPCIKCNRRDESLLVCIQSGC 61
             G+ D++SA N      + ++     G S  F   + L E  CI C+  D+ ++ C  + C
Sbjct:    46 GDEDVNSAPNIFTYDNVPLKKRHYLGTSDTFRSFEPLNEHACIVCDIADDGVVPCSGNEC 105

Query:    62 PISVHENCLSCGVKSDDVGNIYCPYFWYKCELMRTKELRKKAMETKKQLACFIDPKSFTG 121
             P++VH  C+   +  +D    YCPY W+K +  R+  LR + +   K L  +   +  +G
Sbjct:   106 PLAVHRKCVE--LDCEDPATFYCPYCWFKEQATRSTALRTRGVAAAKTLVQYGCSELRSG 163

Query:   122 D---KKENCRTDKGKELNTS-SLHQ 142
             D    +EN + + G + +    LH+
Sbjct:   164 DIVMTRENSQLENGSDNSLPMQLHE 188




GO:0005634 "nucleus" evidence=ISM
TAIR|locus:2144568 TRFL10 "TRF-like 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2006792 AT1G14770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200201 AT1G68030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_II000043
hypothetical protein (472 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 209
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.4
KOG4299 613 consensus PHD Zn-finger protein [General function 98.28
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.26
KOG0383 696 consensus Predicted helicase [General function pre 97.61
KOG1973274 consensus Chromatin remodeling protein, contains P 97.4
COG5141 669 PHD zinc finger-containing protein [General functi 97.33
KOG1244336 consensus Predicted transcription factor Requiem/N 97.28
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.06
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 96.94
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 96.87
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 96.5
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 96.37
KOG0956 900 consensus PHD finger protein AF10 [General functio 95.74
KOG1245 1404 consensus Chromatin remodeling complex WSTF-ISWI, 95.6
KOG1512381 consensus PHD Zn-finger protein [General function 95.58
KOG0954 893 consensus PHD finger protein [General function pre 95.04
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 94.55
KOG0957707 consensus PHD finger protein [General function pre 94.44
PF1377190 zf-HC5HC2H: PHD-like zinc-binding domain 94.43
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 94.36
KOG0956 900 consensus PHD finger protein AF10 [General functio 92.5
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 92.13
KOG4323 464 consensus Polycomb-like PHD Zn-finger protein [Gen 91.39
KOG4299 613 consensus PHD Zn-finger protein [General function 90.61
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 90.58
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 90.57
KOG0957 707 consensus PHD finger protein [General function pre 83.61
KOG1081 463 consensus Transcription factor NSD1 and related SE 81.56
>smart00249 PHD PHD zinc finger Back     alignment and domain information
Probab=98.40  E-value=2.7e-07  Score=57.51  Aligned_cols=43  Identities=35%  Similarity=0.736  Sum_probs=37.3

Q ss_pred             ceeeccC---CCCeEEeeCCCCCcccccccccCCCCc-cCCCCCcccccc
Q 041295           42 PCIKCNR---RDESLLVCIQSGCPISVHENCLSCGVK-SDDVGNIYCPYF   87 (209)
Q Consensus        42 ~CikC~k---dGq~LL~Cs~~gCPlAvH~kClg~sl~-~dd~GnfYCPyC   87 (209)
                      .|.+|+.   ++. +|.|+  .|+..||..|++.+.. ..+...|+||.|
T Consensus         1 ~C~~C~~~~~~~~-~i~C~--~C~~~~H~~C~~~~~~~~~~~~~~~C~~C   47 (47)
T smart00249        1 YCSVCGKPDDGGE-LLQCD--GCDRWYHQTCLGPPLLEEEPDGKWYCPKC   47 (47)
T ss_pred             CcccCCCcCCCCC-EEECC--CCCchhhhhhCCCcccCCCCCCCEECcCC
Confidence            4788888   455 99999  9999999999998766 778999999987



The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the

>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>PF13771 zf-HC5HC2H: PHD-like zinc-binding domain Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG1081 consensus Transcription factor NSD1 and related SET domain proteins [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 99.37
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 99.33
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 99.32
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.31
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 99.31
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 99.29
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 99.26
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 99.24
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.23
2yt5_A66 Metal-response element-binding transcription facto 99.22
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.21
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 99.15
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 99.14
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 99.14
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.08
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 99.02
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 99.02
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.99
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.95
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.87
2k16_A75 Transcription initiation factor TFIID subunit 3; p 98.8
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 98.8
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.79
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.78
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.77
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.76
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 98.7
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.66
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 98.66
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 98.64
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 98.59
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 98.5
1weu_A91 Inhibitor of growth family, member 4; structural g 98.47
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 98.32
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 98.21
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.15
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 97.94
1x4i_A70 Inhibitor of growth protein 3; structural genomics 97.86
1wil_A89 KIAA1045 protein; ring finger domain, structural g 97.81
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 97.74
1wew_A78 DNA-binding family protein; structural genomics, P 97.71
1we9_A64 PHD finger family protein; structural genomics, PH 97.61
1wee_A72 PHD finger family protein; structural genomics, PH 97.58
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 97.47
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 97.44
3o70_A68 PHD finger protein 13; PHF13, structural genomics 97.14
1wem_A76 Death associated transcription factor 1; structura 97.06
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 96.71
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 96.28
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 96.27
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 95.96
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 95.43
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 94.48
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 94.4
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 94.34
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 93.69
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 93.5
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 93.48
3kv5_D 488 JMJC domain-containing histone demethylation prote 92.06
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 91.95
2pv0_B 386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 89.73
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 87.94
2lq6_A87 Bromodomain-containing protein 1; PHD finger, meta 83.51
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
Probab=99.37  E-value=2.5e-13  Score=95.36  Aligned_cols=53  Identities=28%  Similarity=0.563  Sum_probs=48.4

Q ss_pred             CCCCCCceeeccCCCCeEEeeCCCCCcccccccccCCCCccCCCCCccccccchhh
Q 041295           36 DLLEEEPCIKCNRRDESLLVCIQSGCPISVHENCLSCGVKSDDVGNIYCPYFWYKC   91 (209)
Q Consensus        36 d~~neD~CikC~kdGq~LL~Cs~~gCPlAvH~kClg~sl~~dd~GnfYCPyC~ykk   91 (209)
                      ...+++.|.+|+.+|+ ||+|+  +||.+||..|+++++...+.|.||||.|..++
T Consensus         4 ~~~~~~~C~vC~~~g~-ll~CD--~C~~~fH~~Cl~ppl~~~P~g~W~C~~C~~~~   56 (66)
T 1xwh_A            4 AQKNEDECAVCRDGGE-LICCD--GCPRAFHLACLSPPLREIPSGTWRCSSCLQAT   56 (66)
T ss_dssp             CCSCCCSBSSSSCCSS-CEECS--SCCCEECTTTSSSCCSSCCSSCCCCHHHHHTC
T ss_pred             CCCCCCCCccCCCCCC-EEEcC--CCChhhcccccCCCcCcCCCCCeECccccCcc
Confidence            3458899999999999 99999  99999999999998888899999999998654



>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>2lq6_A Bromodomain-containing protein 1; PHD finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 99.21
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 99.08
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.83
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.66
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 98.52
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 98.16
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 97.98
d1wema_76 Death associated transcription factor 1, Datf1 (DI 97.8
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 97.79
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 97.69
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 97.15
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 93.51
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 93.04
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 83.56
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Mi2-beta (CHD4)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.21  E-value=3.5e-12  Score=86.46  Aligned_cols=51  Identities=31%  Similarity=0.526  Sum_probs=46.4

Q ss_pred             CCCCceeeccCCCCeEEeeCCCCCcccccccccCCCCccCCCCCccccccchhh
Q 041295           38 LEEEPCIKCNRRDESLLVCIQSGCPISVHENCLSCGVKSDDVGNIYCPYFWYKC   91 (209)
Q Consensus        38 ~neD~CikC~kdGq~LL~Cs~~gCPlAvH~kClg~sl~~dd~GnfYCPyC~ykk   91 (209)
                      .++++|.+|+.+|+ ||.|+  +|+.+||..|+...+...+.+.||||.|.-+.
T Consensus         7 ~~~~~C~~C~~~g~-lv~Cd--~C~~~~H~~C~~~~~~~~~~~~W~C~~C~~~~   57 (61)
T d1mm2a_           7 HHMEFCRVCKDGGE-LLCCD--TCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPA   57 (61)
T ss_dssp             SSCSSCTTTCCCSS-CBCCS--SSCCCBCSSSSSSCCSSCCSSCCCCTTTTTTC
T ss_pred             CCcCCCcCCCCCCe-EEEeC--CCCccCchhhcCCCcCcCCCCcEECCCCcCcc
Confidence            47889999999999 99999  99999999999988888889999999997543



>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure