Citrus Sinensis ID: 041302
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 484 | 2.2.26 [Sep-21-2011] | |||||||
| Q00IB6 | 440 | RNA polymerase II C-termi | yes | no | 0.857 | 0.943 | 0.589 | 1e-145 | |
| Q8LL04 | 1241 | RNA polymerase II C-termi | no | no | 0.667 | 0.260 | 0.393 | 1e-62 | |
| Q9P376 | 723 | RNA polymerase II subunit | yes | no | 0.419 | 0.280 | 0.311 | 5e-22 | |
| Q8SV03 | 411 | RNA polymerase II subunit | yes | no | 0.396 | 0.467 | 0.303 | 7e-21 | |
| Q9Y5B0 | 961 | RNA polymerase II subunit | no | no | 0.479 | 0.241 | 0.247 | 1e-20 | |
| Q03254 | 732 | RNA polymerase II subunit | yes | no | 0.427 | 0.282 | 0.296 | 2e-20 | |
| Q7TSG2 | 960 | RNA polymerase II subunit | yes | no | 0.466 | 0.235 | 0.258 | 2e-20 | |
| Q5XIK8 | 465 | CTD small phosphatase-lik | no | no | 0.264 | 0.275 | 0.251 | 2e-05 | |
| Q05D32 | 466 | CTD small phosphatase-lik | no | no | 0.264 | 0.274 | 0.251 | 2e-05 | |
| Q8BG15 | 465 | CTD small phosphatase-lik | no | no | 0.264 | 0.275 | 0.251 | 2e-05 |
| >sp|Q00IB6|CPL4_ARATH RNA polymerase II C-terminal domain phosphatase-like 4 OS=Arabidopsis thaliana GN=CPL4 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 516 bits (1329), Expect = e-145, Method: Compositional matrix adjust.
Identities = 271/460 (58%), Positives = 329/460 (71%), Gaps = 45/460 (9%)
Query: 17 LAAFLDAELDSNSLGSSPEKEAEDKDEDEESIDEEAENEEARDDKDLERIKRRKTQIVET 76
LAAFLDAELDS S SS E E+ ++D ES +KR+K + +E
Sbjct: 18 LAAFLDAELDSASDASSGPSEEEEAEDDVES-----------------GLKRQKLEHLE- 59
Query: 77 IQERPGPTLLGNLEEKTDMLYCAEVSLEMDNCPHPGSLGGMCYRCGKRLEEESGVTFSYI 136
E S C HPGS G MC+ CG++LEE +GV+F YI
Sbjct: 60 -----------------------EASSSKGECEHPGSFGNMCFVCGQKLEE-TGVSFRYI 95
Query: 137 CKGLRLGNDEIDRLRNTDMKHLLRHRKLYLILDLDHTLLNSTLLLHLTPEEDYLKSQADS 196
K +RL DEI RLR++D + L R RKLYL+LDLDHTLLN+T+L L PEE+YLKS S
Sbjct: 96 HKEMRLNEDEISRLRDSDSRFLQRQRKLYLVLDLDHTLLNTTILRDLKPEEEYLKSHTHS 155
Query: 197 LQD---VSKGSLFMLAFMNMMTKLRPFVHTFLKEASEMFEMYIYTMGDRPYALEMAKLLD 253
LQD VS GSLF+L FM MMTKLRPFVH+FLKEASEMF MYIYTMGDR YA +MAKLLD
Sbjct: 156 LQDGCNVSGGSLFLLEFMQMMTKLRPFVHSFLKEASEMFVMYIYTMGDRNYARQMAKLLD 215
Query: 254 PSREYFNARVISRDDGTQRHQKGLDVVLGQESAVLILDDTENAWTKHRDNLILMERYHFF 313
P EYF RVISRDDGT RH+K LDVVLGQESAVLILDDTENAW KH+DNLI++ERYHFF
Sbjct: 216 PKGEYFGDRVISRDDGTVRHEKSLDVVLGQESAVLILDDTENAWPKHKDNLIVIERYHFF 275
Query: 314 ASSCRQFGYHCQSLSQLRSDESELEGALASVLKVLKRIHNIFFDELANDLAGRDVRQVLK 373
+SSCRQF + +SLS+L+SDESE +GALA+VLKVLK+ H +FF+ + ++ RDVR +LK
Sbjct: 276 SSSCRQFDHRYKSLSELKSDESEPDGALATVLKVLKQAHALFFENVDEGISNRDVRLMLK 335
Query: 374 MVRGEVLKGCKLVFSHVFPTKFPADTHYLWKMAEQLGATCSIELDPSVTHVVSTDARTEK 433
VR E+LKGCK+VFS VFPTK + H LWKMAE+LGATC+ E+D SVTHVV+ D TEK
Sbjct: 336 QVRKEILKGCKIVFSRVFPTKAKPEDHPLWKMAEELGATCATEVDASVTHVVAMDVGTEK 395
Query: 434 SRWAAKEAKFLVDPRWIETANFLWQRQPEENFPVQQTKPE 473
+RWA +E K++V WI+ AN+LW +QPEENF ++Q K +
Sbjct: 396 ARWAVREKKYVVHRGWIDAANYLWMKQPEENFGLEQLKKQ 435
|
Processively dephosphorylates 'Ser-2' and/or 'Ser-5' of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit (RPB1). This promotes the activity of RNA polymerase II (By similarity). Required for normal plant growth. Arabidopsis thaliana (taxid: 3702) EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 6 |
| >sp|Q8LL04|CPL3_ARATH RNA polymerase II C-terminal domain phosphatase-like 3 OS=Arabidopsis thaliana GN=CPL3 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9P376|FCP1_SCHPO RNA polymerase II subunit A C-terminal domain phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fcp1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q8SV03|FCP1_ENCCU RNA polymerase II subunit A C-terminal domain phosphatase OS=Encephalitozoon cuniculi (strain GB-M1) GN=FCP1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9Y5B0|CTDP1_HUMAN RNA polymerase II subunit A C-terminal domain phosphatase OS=Homo sapiens GN=CTDP1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q03254|FCP1_YEAST RNA polymerase II subunit A C-terminal domain phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCP1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q7TSG2|CTDP1_MOUSE RNA polymerase II subunit A C-terminal domain phosphatase OS=Mus musculus GN=Ctdp1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q5XIK8|CTSL2_RAT CTD small phosphatase-like protein 2 OS=Rattus norvegicus GN=Ctdspl2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q05D32|CTSL2_HUMAN CTD small phosphatase-like protein 2 OS=Homo sapiens GN=CTDSPL2 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q8BG15|CTSL2_MOUSE CTD small phosphatase-like protein 2 OS=Mus musculus GN=Ctdspl2 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 484 | ||||||
| 255570505 | 478 | RNA polymerase II ctd phosphatase, putat | 0.958 | 0.970 | 0.688 | 1e-180 | |
| 449447765 | 452 | PREDICTED: RNA polymerase II C-terminal | 0.925 | 0.991 | 0.649 | 1e-173 | |
| 356498756 | 428 | PREDICTED: RNA polymerase II C-terminal | 0.882 | 0.997 | 0.639 | 1e-165 | |
| 356564913 | 442 | PREDICTED: RNA polymerase II C-terminal | 0.911 | 0.997 | 0.633 | 1e-164 | |
| 449532013 | 340 | PREDICTED: LOW QUALITY PROTEIN: RNA poly | 0.692 | 0.985 | 0.731 | 1e-148 | |
| 9758369 | 1065 | unnamed protein product [Arabidopsis tha | 0.857 | 0.389 | 0.589 | 1e-144 | |
| 145334837 | 440 | RNA polymerase II C-terminal domain phos | 0.857 | 0.943 | 0.589 | 1e-144 | |
| 224142399 | 312 | predicted protein [Populus trichocarpa] | 0.644 | 1.0 | 0.775 | 1e-143 | |
| 297793317 | 1006 | hypothetical protein ARALYDRAFT_332090 [ | 0.855 | 0.411 | 0.580 | 1e-139 | |
| 242093742 | 558 | hypothetical protein SORBIDRAFT_10g02558 | 0.772 | 0.670 | 0.622 | 1e-136 |
| >gi|255570505|ref|XP_002526210.1| RNA polymerase II ctd phosphatase, putative [Ricinus communis] gi|223534449|gb|EEF36151.1| RNA polymerase II ctd phosphatase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 636 bits (1640), Expect = e-180, Method: Compositional matrix adjust.
Identities = 331/481 (68%), Positives = 380/481 (79%), Gaps = 17/481 (3%)
Query: 1 MSLATDSPVNSSSS---DDLAAFLDAELDSNSLGSSPEKEAEDKDEDEESIDEEAENEEA 57
MSL TDSP++SS S DD AA LDAELDS S S +A D+ ++ D+ E EE
Sbjct: 1 MSLVTDSPLHSSHSSSSDDFAALLDAELDSKSSSSDSSPKAIKHDDASDANDDVNEEEEE 60
Query: 58 RDDKDL-------ERIKRRKTQIVETIQERPGPTLLGNLEEKTDMLYCAEVSLEMDNCPH 110
+ RIKR + + +E E P + +L++ T + ++V+ C H
Sbjct: 61 EESDSDDDSDIATNRIKRSRVETLEN-GENPKESTRVSLDQ-TLVASSSKVA-----CTH 113
Query: 111 PGSLGGMCYRCGKRLEEESGVTFSYICKGLRLGNDEIDRLRNTDMKHLLRHRKLYLILDL 170
PGS G MC CG+RL EE+GVTF YI KGLRL NDEI RLRNTDMK+LLRHRKLYL+LDL
Sbjct: 114 PGSFGDMCILCGERLIEETGVTFGYIHKGLRLANDEIVRLRNTDMKNLLRHRKLYLVLDL 173
Query: 171 DHTLLNSTLLLHLTPEEDYLKSQADSLQDVSKGSLFMLAFMNMMTKLRPFVHTFLKEASE 230
DHTLLNST L+HLT EE+YLKSQ DS+QDVS GSLFM+ FM+MMTKLRPF+ TFLKEAS+
Sbjct: 174 DHTLLNSTQLMHLTAEEEYLKSQIDSMQDVSNGSLFMVDFMHMMTKLRPFIRTFLKEASQ 233
Query: 231 MFEMYIYTMGDRPYALEMAKLLDPSREYFNARVISRDDGTQRHQKGLDVVLGQESAVLIL 290
MFEMYIYTMGDR YALEMAK LDP REYFNARVISRDDGTQRHQKGLD+VLGQESAVLIL
Sbjct: 234 MFEMYIYTMGDRAYALEMAKFLDPGREYFNARVISRDDGTQRHQKGLDIVLGQESAVLIL 293
Query: 291 DDTENAWTKHRDNLILMERYHFFASSCRQFGYHCQSLSQLRSDESELEGALASVLKVLKR 350
DDTENAWTKH+DNLILMERYHFFASSCRQFG+ C+SLSQL+SDE+E +GALASVLKVL+R
Sbjct: 294 DDTENAWTKHKDNLILMERYHFFASSCRQFGFECKSLSQLKSDENESDGALASVLKVLRR 353
Query: 351 IHNIFFDELANDLAGRDVRQVLKMVRGEVLKGCKLVFSHVFPTKFPADTHYLWKMAEQLG 410
IH+IFFDEL + + GRDVRQVL VR +VLKGCK+VFS VFPT+F AD H+LWKMAEQLG
Sbjct: 354 IHHIFFDELEDAIDGRDVRQVLSTVRKDVLKGCKIVFSRVFPTQFQADNHHLWKMAEQLG 413
Query: 411 ATCSIELDPSVTHVVSTDARTEKSRWAAKEAKFLVDPRWIETANFLWQRQPEENFPVQQT 470
ATCS E+DPSVTHVVS +A TEKSRWA K KFLV PRWIE N++WQRQPEENF V Q
Sbjct: 414 ATCSREVDPSVTHVVSAEAGTEKSRWALKNDKFLVHPRWIEATNYMWQRQPEENFSVNQP 473
Query: 471 K 471
K
Sbjct: 474 K 474
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449447765|ref|XP_004141638.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356498756|ref|XP_003518215.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 4-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356564913|ref|XP_003550691.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 4-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449532013|ref|XP_004172979.1| PREDICTED: LOW QUALITY PROTEIN: RNA polymerase II C-terminal domain phosphatase-like 4-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|9758369|dbj|BAB08870.1| unnamed protein product [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|145334837|ref|NP_001078764.1| RNA polymerase II C-terminal domain phosphatase-like 4 [Arabidopsis thaliana] gi|122154038|sp|Q00IB6.1|CPL4_ARATH RecName: Full=RNA polymerase II C-terminal domain phosphatase-like 4; Short=FCP-like 4; AltName: Full=Carboxyl-terminal phosphatase-like 4; Short=AtCPL4; Short=CTD phosphatase-like 4 gi|95115186|gb|ABF55959.1| carboxyl-terminal phosphatase-like 4 [Arabidopsis thaliana] gi|332009601|gb|AED96984.1| RNA polymerase II C-terminal domain phosphatase-like 4 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224142399|ref|XP_002324546.1| predicted protein [Populus trichocarpa] gi|222865980|gb|EEF03111.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297793317|ref|XP_002864543.1| hypothetical protein ARALYDRAFT_332090 [Arabidopsis lyrata subsp. lyrata] gi|297310378|gb|EFH40802.1| hypothetical protein ARALYDRAFT_332090 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|242093742|ref|XP_002437361.1| hypothetical protein SORBIDRAFT_10g025580 [Sorghum bicolor] gi|241915584|gb|EER88728.1| hypothetical protein SORBIDRAFT_10g025580 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 484 | ||||||
| TAIR|locus:4010714056 | 440 | CPL4 "C-terminal domain phosph | 0.770 | 0.847 | 0.618 | 9.2e-124 | |
| TAIR|locus:2051164 | 1241 | CPL3 "C-terminal domain phosph | 0.576 | 0.224 | 0.413 | 2.3e-53 | |
| TAIR|locus:2162565 | 306 | AT5G54210 [Arabidopsis thalian | 0.547 | 0.866 | 0.349 | 1.3e-38 | |
| TAIR|locus:2090467 | 296 | AT3G17550 [Arabidopsis thalian | 0.561 | 0.918 | 0.349 | 4.3e-38 | |
| TAIR|locus:2045044 | 277 | AT2G04930 [Arabidopsis thalian | 0.537 | 0.938 | 0.345 | 3.9e-37 | |
| TAIR|locus:4515103095 | 307 | AT3G19595 [Arabidopsis thalian | 0.543 | 0.856 | 0.341 | 4.9e-37 | |
| TAIR|locus:2012943 | 342 | AT1G20320 [Arabidopsis thalian | 0.557 | 0.789 | 0.353 | 8e-37 | |
| TAIR|locus:2154458 | 302 | AT5G23470 [Arabidopsis thalian | 0.535 | 0.857 | 0.312 | 6.9e-31 | |
| DICTYBASE|DDB_G0271690 | 782 | DDB_G0271690 "putative RNA pol | 0.464 | 0.287 | 0.282 | 1.3e-30 | |
| TAIR|locus:2056256 | 302 | AT2G02290 [Arabidopsis thalian | 0.533 | 0.854 | 0.296 | 8.2e-28 |
| TAIR|locus:4010714056 CPL4 "C-terminal domain phosphatase-like 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1200 (427.5 bits), Expect = 9.2e-124, Sum P(2) = 9.2e-124
Identities = 233/377 (61%), Positives = 281/377 (74%)
Query: 100 EVSLEMDNCPHPGSLGGMCYRCGKRLEEESGVTFSYICKGLRLGNDEIDRLRNTDMKHLL 159
E S C HPGS G MC+ CG++LEE +GV+F YI K +RL DEI RLR++D + L
Sbjct: 60 EASSSKGECEHPGSFGNMCFVCGQKLEE-TGVSFRYIHKEMRLNEDEISRLRDSDSRFLQ 118
Query: 160 RHRKXXXXXXXXXXXXXXXXXXXXXPEEDYLKSQADSLQD---VSKGSLFMLAFMNMMTK 216
R RK PEE+YLKS SLQD VS GSLF+L FM MMTK
Sbjct: 119 RQRKLYLVLDLDHTLLNTTILRDLKPEEEYLKSHTHSLQDGCNVSGGSLFLLEFMQMMTK 178
Query: 217 LRPFVHTFLKEASEMFEMYIYTMGDRPYALEMAKLLDPSREYFNARVISRDDGTQRHQKG 276
LRPFVH+FLKEASEMF MYIYTMGDR YA +MAKLLDP EYF RVISRDDGT RH+K
Sbjct: 179 LRPFVHSFLKEASEMFVMYIYTMGDRNYARQMAKLLDPKGEYFGDRVISRDDGTVRHEKS 238
Query: 277 LDVVLGQESAVLILDDTENAWTKHRDNLILMERYHFFASSCRQFGYHCQSLSQLRSDESE 336
LDVVLGQESAVLILDDTENAW KH+DNLI++ERYHFF+SSCRQF + +SLS+L+SDESE
Sbjct: 239 LDVVLGQESAVLILDDTENAWPKHKDNLIVIERYHFFSSSCRQFDHRYKSLSELKSDESE 298
Query: 337 LEGALASVLKVLKRIHNIFFDELANDLAGRDVRQVLKMVRGEVLKGCKLVFSHVFPTKFP 396
+GALA+VLKVLK+ H +FF+ + ++ RDVR +LK VR E+LKGCK+VFS VFPTK
Sbjct: 299 PDGALATVLKVLKQAHALFFENVDEGISNRDVRLMLKQVRKEILKGCKIVFSRVFPTKAK 358
Query: 397 ADTHYLWKMAEQLGATCSIELDPSVTHVVSTDARTEKSRWAAKEAKFLVDPRWIETANFL 456
+ H LWKMAE+LGATC+ E+D SVTHVV+ D TEK+RWA +E K++V WI+ AN+L
Sbjct: 359 PEDHPLWKMAEELGATCATEVDASVTHVVAMDVGTEKARWAVREKKYVVHRGWIDAANYL 418
Query: 457 WQRQPEENFPVQQTKPE 473
W +QPEENF ++Q K +
Sbjct: 419 WMKQPEENFGLEQLKKQ 435
|
|
| TAIR|locus:2051164 CPL3 "C-terminal domain phosphatase-like 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162565 AT5G54210 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2090467 AT3G17550 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2045044 AT2G04930 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:4515103095 AT3G19595 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2012943 AT1G20320 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2154458 AT5G23470 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0271690 DDB_G0271690 "putative RNA polymerase II C-terminal domain phosphatase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2056256 AT2G02290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q00IB6 | CPL4_ARATH | 3, ., 1, ., 3, ., 1, 6 | 0.5891 | 0.8574 | 0.9431 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.1.3.16 | 0.946 |
| 3rd Layer | 3.1.3 | 0.963 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00035715001 | SubName- Full=Chromosome undetermined scaffold_80, whole genome shotgun sequence; (350 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 484 | |||
| TIGR02250 | 156 | TIGR02250, FCP1_euk, FCP1-like phosphatase, phosph | 6e-72 | |
| smart00577 | 148 | smart00577, CPDc, catalytic domain of ctd-like pho | 2e-45 | |
| pfam03031 | 153 | pfam03031, NIF, NLI interacting factor-like phosph | 2e-25 | |
| TIGR02251 | 162 | TIGR02251, HIF-SF_euk, Dullard-like phosphatase do | 6e-13 | |
| COG5190 | 390 | COG5190, FCP1, TFIIF-interacting CTD phosphatases, | 6e-08 | |
| pfam00533 | 77 | pfam00533, BRCT, BRCA1 C Terminus (BRCT) domain | 8e-07 | |
| smart00292 | 78 | smart00292, BRCT, breast cancer carboxy-terminal d | 2e-06 | |
| pfam12738 | 63 | pfam12738, PTCB-BRCT, twin BRCT domain | 7e-06 | |
| cd00027 | 72 | cd00027, BRCT, Breast Cancer Suppressor Protein (B | 3e-05 |
| >gnl|CDD|131304 TIGR02250, FCP1_euk, FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
Score = 224 bits (574), Expect = 6e-72
Identities = 72/157 (45%), Positives = 102/157 (64%), Gaps = 2/157 (1%)
Query: 158 LLRHRKLYLILDLDHTLLNSTLLLHLTPEEDYLKSQADSLQDVSKGSLFMLAFMNMMTKL 217
LLR +KL+L+LDLD TL+++T L+ E Y + +S + F L M +TKL
Sbjct: 1 LLREKKLHLVLDLDQTLIHTTKDPTLSEWEKYDIEEPNS-ETRRDLRKFNLGTMWYLTKL 59
Query: 218 RPFVHTFLKEASEMFEMYIYTMGDRPYALEMAKLLDPSREYFNARVISRDDGTQRHQKGL 277
RPF+H FLKEAS+++EM++YTMG R YA +AKL+DP +YF R+ISRD+ H K L
Sbjct: 60 RPFLHEFLKEASKLYEMHVYTMGTRAYAQAIAKLIDPDGKYFGDRIISRDESGSPHTKSL 119
Query: 278 -DVVLGQESAVLILDDTENAWTKHRDNLILMERYHFF 313
+ ES V+I+DD E+ W H+ NLI +E Y++F
Sbjct: 120 LRLFPADESMVVIIDDREDVWPWHKRNLIQIEPYNYF 156
|
This model represents the phosphatase domain of the humanRNA polymerase II subunit A C-terminal domain phosphatase (FCP1, ) and closely related phosphatases from eukaryotes including plants, fungi and slime mold. This domain is a member of the haloacid dehalogenase (HAD) superfamily by virtue of a conserved set of three catalytic motifs and a conserved fold as predicted by PSIPRED. The third motif in this family is distinctive (hhhhDDppphW). This domain is classified as a "Class III" HAD, since there is no large "cap" domain found between motifs 1 and 2 or motifs 2 and 3.This domain is related to domains found in the human NLI interacting factor-like phosphatases, and together both are detected by the pfam03031. Length = 156 |
| >gnl|CDD|214729 smart00577, CPDc, catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >gnl|CDD|217328 pfam03031, NIF, NLI interacting factor-like phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|233801 TIGR02251, HIF-SF_euk, Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|227517 COG5190, FCP1, TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|215978 pfam00533, BRCT, BRCA1 C Terminus (BRCT) domain | Back alignment and domain information |
|---|
| >gnl|CDD|214602 smart00292, BRCT, breast cancer carboxy-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|193214 pfam12738, PTCB-BRCT, twin BRCT domain | Back alignment and domain information |
|---|
| >gnl|CDD|237994 cd00027, BRCT, Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 484 | |||
| KOG0323 | 635 | consensus TFIIF-interacting CTD phosphatases, incl | 100.0 | |
| TIGR02250 | 156 | FCP1_euk FCP1-like phosphatase, phosphatase domain | 100.0 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 100.0 | |
| KOG1605 | 262 | consensus TFIIF-interacting CTD phosphatase, inclu | 99.97 | |
| PF03031 | 159 | NIF: NLI interacting factor-like phosphatase; Inte | 99.97 | |
| TIGR02245 | 195 | HAD_IIID1 HAD-superfamily subfamily IIID hydrolase | 99.94 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 99.89 | |
| KOG2832 | 393 | consensus TFIIF-interacting CTD phosphatase, inclu | 99.87 | |
| COG5190 | 390 | FCP1 TFIIF-interacting CTD phosphatases, including | 99.84 | |
| COG5190 | 390 | FCP1 TFIIF-interacting CTD phosphatases, including | 99.76 | |
| PF12738 | 63 | PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2W | 99.47 | |
| KOG3226 | 508 | consensus DNA repair protein [Replication, recombi | 99.45 | |
| PF00533 | 78 | BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IP | 99.43 | |
| smart00292 | 80 | BRCT breast cancer carboxy-terminal domain. | 99.29 | |
| cd00027 | 72 | BRCT Breast Cancer Suppressor Protein (BRCA1), car | 99.26 | |
| PLN03122 | 815 | Poly [ADP-ribose] polymerase; Provisional | 98.64 | |
| PLN03123 | 981 | poly [ADP-ribose] polymerase; Provisional | 98.52 | |
| KOG1929 | 811 | consensus Nucleotide excision repair factor NEF2, | 97.98 | |
| PRK14350 | 669 | ligA NAD-dependent DNA ligase LigA; Provisional | 97.98 | |
| KOG3524 | 850 | consensus Predicted guanine nucleotide exchange fa | 97.97 | |
| PRK06063 | 313 | DNA polymerase III subunit epsilon; Provisional | 97.92 | |
| PRK07956 | 665 | ligA NAD-dependent DNA ligase LigA; Validated | 97.91 | |
| PRK14351 | 689 | ligA NAD-dependent DNA ligase LigA; Provisional | 97.89 | |
| KOG1929 | 811 | consensus Nucleotide excision repair factor NEF2, | 97.81 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 97.79 | |
| PRK06195 | 309 | DNA polymerase III subunit epsilon; Validated | 97.78 | |
| COG0272 | 667 | Lig NAD-dependent DNA ligase (contains BRCT domain | 97.74 | |
| TIGR00575 | 652 | dnlj DNA ligase, NAD-dependent. The member of this | 97.68 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 97.68 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 97.68 | |
| COG5275 | 276 | BRCT domain type II [General function prediction o | 97.66 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 97.63 | |
| KOG2043 | 896 | consensus Signaling protein SWIFT and related BRCT | 97.48 | |
| KOG0966 | 881 | consensus ATP-dependent DNA ligase IV [Replication | 97.38 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 97.37 | |
| PF05152 | 297 | DUF705: Protein of unknown function (DUF705); Inte | 97.28 | |
| KOG3548 | 1176 | consensus DNA damage checkpoint protein RHP9/CRB2/ | 97.23 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 97.19 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 97.19 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 97.18 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 97.14 | |
| KOG2481 | 570 | consensus Protein required for normal rRNA process | 97.14 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 97.13 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 97.12 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 97.1 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 97.09 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 97.02 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 96.95 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 96.88 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 96.84 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 96.8 | |
| COG5163 | 591 | NOP7 Protein required for biogenesis of the 60S ri | 96.79 | |
| COG4996 | 164 | Predicted phosphatase [General function prediction | 96.62 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 96.62 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 96.42 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 96.4 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 96.32 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 95.92 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 95.75 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 95.75 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 95.7 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 95.67 | |
| PRK08238 | 479 | hypothetical protein; Validated | 95.65 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 95.63 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 95.59 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 95.59 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 95.46 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 95.44 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 95.41 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 95.37 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 95.36 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 95.1 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 94.94 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 94.89 | |
| PRK06769 | 173 | hypothetical protein; Validated | 94.85 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 94.81 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 94.79 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 94.54 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 94.44 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 94.37 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 94.32 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 94.2 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 94.04 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 94.03 | |
| KOG3524 | 850 | consensus Predicted guanine nucleotide exchange fa | 94.0 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 93.91 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 93.79 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 93.65 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 93.64 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 93.62 | |
| PF08645 | 159 | PNK3P: Polynucleotide kinase 3 phosphatase; InterP | 93.52 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 93.48 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 93.4 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 93.39 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 93.34 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 93.26 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 93.13 | |
| TIGR01689 | 126 | EcbF-BcbF capsule biosynthesis phosphatase. Due to | 93.11 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 93.11 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 92.91 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 92.62 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 92.61 | |
| TIGR01544 | 277 | HAD-SF-IE haloacid dehalogenase superfamily, subfa | 92.53 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 92.38 | |
| PLN02940 | 382 | riboflavin kinase | 92.04 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 92.01 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 91.63 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 91.6 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 91.39 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 90.87 | |
| TIGR01493 | 175 | HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su | 90.76 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 89.72 | |
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 89.33 | |
| KOG0966 | 881 | consensus ATP-dependent DNA ligase IV [Replication | 89.27 | |
| PLN02811 | 220 | hydrolase | 88.95 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 88.84 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 88.68 | |
| KOG3109 | 244 | consensus Haloacid dehalogenase-like hydrolase [Ge | 87.8 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 87.74 | |
| PF09419 | 168 | PGP_phosphatase: Mitochondrial PGP phosphatase; In | 87.73 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 87.58 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 86.87 | |
| TIGR01456 | 321 | CECR5 HAD-superfamily class IIA hydrolase, TIGR014 | 86.6 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 86.15 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 85.53 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 84.96 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 84.45 | |
| COG0241 | 181 | HisB Histidinol phosphatase and related phosphatas | 84.3 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 84.18 | |
| PLN02954 | 224 | phosphoserine phosphatase | 84.14 | |
| COG2503 | 274 | Predicted secreted acid phosphatase [General funct | 83.06 | |
| PRK05601 | 377 | DNA polymerase III subunit epsilon; Validated | 82.3 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 82.24 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 81.64 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 81.36 | |
| PTZ00445 | 219 | p36-lilke protein; Provisional | 81.3 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 80.19 |
| >KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.7e-68 Score=574.81 Aligned_cols=365 Identities=38% Similarity=0.626 Sum_probs=320.0
Q ss_pred ccCCCCceeecccccccccccccccCceeeeecCCcccCHHHHHHHHh-hhhhhhhhcCccEEEEcCCCceeeeccCCCC
Q 041302 105 MDNCPHPGSLGGMCYRCGKRLEEESGVTFSYICKGLRLGNDEIDRLRN-TDMKHLLRHRKLYLILDLDHTLLNSTLLLHL 183 (484)
Q Consensus 105 ~~~C~H~~~~~~~C~~Cg~~~~~~~~~~~~~~~~~l~vs~~ea~~~~~-~~~~~ll~~rKL~LVLDLDeTLIhs~~~~~~ 183 (484)
.+.|.|+++++|||+.||+.|+...+..+.|+..++.++...+..+.. ......+++++|+||+|||+||+|++..+.+
T Consensus 87 ~~~C~H~~v~~GlC~~Cg~~l~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~L~lv~Dld~tllh~~~~~~l 166 (635)
T KOG0323|consen 87 TSCCEHFTVFGGLCASCGKDLESLQGRSFDYLVKGLQLSNEMVAFTKTLTTQFSSLNRKKLHLVLDLDHTLLHTILKSDL 166 (635)
T ss_pred cCCccceeecccHHHHHHHHHHHhhccchhcccchhhhhhhhhhhhhHHHHHHHHHhhhcceeehhhhhHHHHhhccchh
Confidence 588999999999999999999988788889999999999999888877 4555667777789999999999999998888
Q ss_pred Chhhhhhhccccccccccccceeeee----ceeEEEEecccHHHHHHHhhhCCeEEEecCCcHhHHHHHHhhhCCCCccc
Q 041302 184 TPEEDYLKSQADSLQDVSKGSLFMLA----FMNMMTKLRPFVHTFLKEASEMFEMYIYTMGDRPYALEMAKLLDPSREYF 259 (484)
Q Consensus 184 ~~~e~~~~~~~~~~~d~~~~~~f~l~----~~~~~vklRPgl~eFL~~ls~~yEl~IyT~g~r~YA~~I~~~LDP~~~~F 259 (484)
...+.++..+...+ ..+..+|.++ .++||||+|||+.+||++++++|||||||||+|.||..|+++|||+|+||
T Consensus 167 ~e~~~~l~~~~~~~--~sn~dl~~~~~~~~~~~~~vKlRP~~~efL~~~sklfemhVyTmg~R~YA~~i~~liDP~~~lF 244 (635)
T KOG0323|consen 167 SETEKYLKEEAESV--ESNKDLFRFNPLGHDTEYLVKLRPFVHEFLKEANKLFEMHVYTMGTRDYALEIAKLIDPEGKYF 244 (635)
T ss_pred hhhhhhcccccccc--cccccceeecccCCCceEEEEeCccHHHHHHHHHhhceeEEEeccchHHHHHHHHHhCCCCccc
Confidence 87778887766531 0112233333 47899999999999999999999999999999999999999999999999
Q ss_pred ceeEEeecCCCCCccccccccC-CCCCcEEEEcCChhhhhcCCCCeEEecccccccccccccC-----------------
Q 041302 260 NARVISRDDGTQRHQKGLDVVL-GQESAVLILDDTENAWTKHRDNLILMERYHFFASSCRQFG----------------- 321 (484)
Q Consensus 260 ~~RI~sRd~c~~~~~KdL~~l~-~~~~~vVIIDD~~~vw~~~~~NlI~I~py~fF~~~~~~~g----------------- 321 (484)
++|||||++....-.+||..++ ++.+||||||||.+||..++.|+|+|.||.||.+.++.+-
T Consensus 245 ~dRIisrde~~~~kt~dL~~~~p~g~smvvIIDDr~dVW~~~~~nLI~i~~y~yF~~~gd~nap~~~~~~~~~~~~~~~~ 324 (635)
T KOG0323|consen 245 GDRIISRDESPFFKTLDLVLLFPCGDSMVVIIDDRSDVWPDHKRNLIQIAPYPYFSGQGDINAPPPLHVLRNVACSVRGA 324 (635)
T ss_pred cceEEEecCCCcccccccccCCCCCCccEEEEeCccccccCCCcceEEeeeeecccCcccccCCcccccccchhcccccc
Confidence 9999999998776777887776 6899999999999999987779999999999999774331
Q ss_pred --------------------------------------------------------CcccccccccccchhhHHHHHHHH
Q 041302 322 --------------------------------------------------------YHCQSLSQLRSDESELEGALASVL 345 (484)
Q Consensus 322 --------------------------------------------------------~~~~sl~e~~~de~~~D~~L~~l~ 345 (484)
...+++.+.+.|+.+.|++|.+++
T Consensus 325 ~~k~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~s~~~~~~de~~~D~~L~~~~ 404 (635)
T KOG0323|consen 325 FFKEFDPSLKSRISEVRYEDDDESNPTSYSVELSANPGPLKQDGMDEFVPEENAPEARSGSYREKKSDESDEDGELANLL 404 (635)
T ss_pred cccccCcccccccccccccccccccCcccccccccccCcccccccccccccccchhhcccccccccccccccchhHHHHh
Confidence 122344445566778899999999
Q ss_pred HHHHHHHHHHHhhhh---hhccCchhHHHHhhhhcccccceeeeeeeccCCCCCcchHHHHHHHHHhCCeEeeecCCCcc
Q 041302 346 KVLKRIHNIFFDELA---NDLAGRDVRQVLKMVRGEVLKGCKLVFSHVFPTKFPADTHYLWKMAEQLGATCSIELDPSVT 422 (484)
Q Consensus 346 ~~L~~IH~~ff~~~~---~~~~~~DVr~IL~~lr~~vL~G~~IvfSG~~p~~~~~~~~~l~~la~~lGA~v~~~i~~~vT 422 (484)
++|+.||..||..++ +....+|||.+|+++|..+|+||.++|||++|.+.+.+++.+..++..+||..+++++..+|
T Consensus 405 kvl~~vH~~ff~~~~~~~e~~~~~Dvr~~i~~~~~~v~~~~~~vfSg~~P~~~~~~~s~~~~~~~~~g~vs~~~~~~~~t 484 (635)
T KOG0323|consen 405 KVLKPVHKGFFAKYDEVEETLESPDVRLLIPELRTKVLKGSQIVFSGLHPTGSTDESADILGVAQQLGAVSAPDVSDKTT 484 (635)
T ss_pred hhhcccchhhhhccccccccccCCChhhhhhhhhhHHhhccceeecccccCcCCcchhhhhhhhhcccceecccccchhh
Confidence 999999999999874 35678999999999999999999999999999999888899999999999999999999999
Q ss_pred EEEEcCCCChHHHHHHhcC-CeeeChhhHHHHHHhcCCCCCCCCCCCCCC
Q 041302 423 HVVSTDARTEKSRWAAKEA-KFLVDPRWIETANFLWQRQPEENFPVQQTK 471 (484)
Q Consensus 423 HlVa~~~~T~K~~~A~~~g-i~IV~~~WL~~c~~~w~r~dE~~Y~l~~~~ 471 (484)
|+|+.+.||.|+.+|...+ ++||++.||+.|+.+|.+++|..|.+....
T Consensus 485 h~i~~~~gt~k~~~a~~~~~~~Vv~~~wl~~~~e~w~~v~ek~~~l~~~~ 534 (635)
T KOG0323|consen 485 HLIAANAGTKKVYKAVVSGSAKVVNAAWLWRSLEKWGKVEEKLEPLDDDQ 534 (635)
T ss_pred hHHhhccCcceeeccccccceeEechhHHHHHHHHhcchhcccccccccc
Confidence 9999999999999999865 999999999999999999999999986444
|
|
| >TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >KOG1605 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] | Back alignment and domain information |
|---|
| >PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear | Back alignment and domain information |
|---|
| >TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >KOG2832 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] | Back alignment and domain information |
|---|
| >COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >PF12738 PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2WT8_C 3EF1_A 3EF0_A | Back alignment and domain information |
|---|
| >KOG3226 consensus DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF00533 BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IPR001357 The BRCT domain (after the C_terminal domain of a breast cancer susceptibility protein) is found predominantly in proteins involved in cell cycle checkpoint functions responsive to DNA damage [], for example as found in the breast cancer DNA-repair protein BRCA1 | Back alignment and domain information |
|---|
| >smart00292 BRCT breast cancer carboxy-terminal domain | Back alignment and domain information |
|---|
| >cd00027 BRCT Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain | Back alignment and domain information |
|---|
| >PLN03122 Poly [ADP-ribose] polymerase; Provisional | Back alignment and domain information |
|---|
| >PLN03123 poly [ADP-ribose] polymerase; Provisional | Back alignment and domain information |
|---|
| >KOG1929 consensus Nucleotide excision repair factor NEF2, RAD4/CUT5 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14350 ligA NAD-dependent DNA ligase LigA; Provisional | Back alignment and domain information |
|---|
| >KOG3524 consensus Predicted guanine nucleotide exchange factor (PEBBLE) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK06063 DNA polymerase III subunit epsilon; Provisional | Back alignment and domain information |
|---|
| >PRK07956 ligA NAD-dependent DNA ligase LigA; Validated | Back alignment and domain information |
|---|
| >PRK14351 ligA NAD-dependent DNA ligase LigA; Provisional | Back alignment and domain information |
|---|
| >KOG1929 consensus Nucleotide excision repair factor NEF2, RAD4/CUT5 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >PRK06195 DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >COG0272 Lig NAD-dependent DNA ligase (contains BRCT domain type II) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00575 dnlj DNA ligase, NAD-dependent | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >COG5275 BRCT domain type II [General function prediction only] | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >KOG2043 consensus Signaling protein SWIFT and related BRCT domain proteins [Transcription; Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0966 consensus ATP-dependent DNA ligase IV [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins | Back alignment and domain information |
|---|
| >KOG3548 consensus DNA damage checkpoint protein RHP9/CRB2/53BP1 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2481 consensus Protein required for normal rRNA processing [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >COG5163 NOP7 Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG4996 Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG3524 consensus Predicted guanine nucleotide exchange factor (PEBBLE) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0966 consensus ATP-dependent DNA ligase IV [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >COG2503 Predicted secreted acid phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05601 DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >PTZ00445 p36-lilke protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 484 | ||||
| 3ef0_A | 372 | The Structure Of Fcp1, An Essential Rna Polymerase | 1e-25 | ||
| 3ef1_A | 442 | The Structure Of Fcp1, An Essential Rna Polymerase | 1e-14 | ||
| 3ef1_A | 442 | The Structure Of Fcp1, An Essential Rna Polymerase | 2e-10 |
| >pdb|3EF0|A Chain A, The Structure Of Fcp1, An Essential Rna Polymerase Ii Ctd Phosphatase Length = 372 | Back alignment and structure |
|
| >pdb|3EF1|A Chain A, The Structure Of Fcp1, An Essential Rna Polymerase Ii Ctd Phosphatase Length = 442 | Back alignment and structure |
| >pdb|3EF1|A Chain A, The Structure Of Fcp1, An Essential Rna Polymerase Ii Ctd Phosphatase Length = 442 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Length = 372 | Back alignment and structure |
|---|
Score = 270 bits (690), Expect = 9e-87
Identities = 96/371 (25%), Positives = 171/371 (46%), Gaps = 51/371 (13%)
Query: 147 IDRLRNTDMKHLLRHRKLYLILDLDHTLLNSTLLLHLTP-EEDYLKSQADSLQDVSKGSL 205
+ RL + ++K L + ++L LI+DLD T++++T+ + D D L+DV +L
Sbjct: 2 LSRLESENVKRLRQEKRLSLIVDLDQTIIHATVDPTVGEWMSDPGNVNYDVLRDVRSFNL 61
Query: 206 FMLA---FMNMMTKLRPFVHTFLKEASEMFEMYIYTMGDRPYALEMAKLLDPSREYFNAR 262
K RP + FL++ SE++E++IYTMG + YA E+AK++DP+ + F R
Sbjct: 62 QEGPSGYTSCYYIKFRPGLAQFLQKISELYELHIYTMGTKAYAKEVAKIIDPTGKLFQDR 121
Query: 263 VISRDDGTQRHQKGLDVVLGQE-SAVLILDDTENAWTKHRDNLILMERYHFFAS------ 315
V+SRDD QK L + + S V+++DD + W NLI + Y FF
Sbjct: 122 VLSRDDSGSLAQKSLRRLFPCDTSMVVVIDDRGDVW-DWNPNLIKVVPYEFFVGIGDINS 180
Query: 316 ------------------SCRQFGYHCQSLSQLRSDE--------------SELEGALAS 343
+ + + L++ ++ + L
Sbjct: 181 NFLSGNREALEEQNKERVTALELQKSERPLAKQQNALLEDEGKPTPSHTLLHNRDHELER 240
Query: 344 VLKVLKRIHNIFFDE------LANDLAGRDVRQVLKMVRGEVLKGCKLVFSHVFPTKFPA 397
+ KVLK IH ++++E + + +V ++ ++ +VLKGC+L+FS V P
Sbjct: 241 LEKVLKDIHAVYYEEENDISSRSGNHKHANVGLIIPKMKQKVLKGCRLLFSGVIPLGVDV 300
Query: 398 DTHYLWKMAEQLGATCSIELDPSVTHVVSTDARTEKSRWAAKEAKF-LVDPRWIETANFL 456
+ + K A GA ++ TH+++ RTEK + A +V W+ +
Sbjct: 301 LSSDIAKWAMSFGAEVVLDFSVPPTHLIAAKIRTEKVKKAVSMGNIKVVKLNWLTESLSQ 360
Query: 457 WQRQPEENFPV 467
W+R PE ++ +
Sbjct: 361 WKRLPESDYLL 371
|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442 | Back alignment and structure |
|---|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442 | Back alignment and structure |
|---|
| >3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* Length = 107 | Back alignment and structure |
|---|
| >2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 129 | Back alignment and structure |
|---|
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Length = 204 | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Length = 181 | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 Length = 132 | Back alignment and structure |
|---|
| >2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A Length = 210 | Back alignment and structure |
|---|
| >1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 Length = 229 | Back alignment and structure |
|---|
| >2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A Length = 214 | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Length = 298 | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Length = 298 | Back alignment and structure |
|---|
| >3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} PDB: 3pc8_A* 3qvg_B* 1cdz_A Length = 104 | Back alignment and structure |
|---|
| >3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Length = 320 | Back alignment and structure |
|---|
| >3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* Length = 235 | Back alignment and structure |
|---|
| >2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A Length = 209 | Back alignment and structure |
|---|
| >3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* Length = 220 | Back alignment and structure |
|---|
| >3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* Length = 199 | Back alignment and structure |
|---|
| >2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* Length = 263 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 484 | |||
| 3ef1_A | 442 | RNA polymerase II subunit A C-terminal domain phos | 100.0 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 100.0 | |
| 3qle_A | 204 | TIM50P; chaperone, mitochondrion, preprotein trans | 100.0 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 99.97 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 99.96 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 99.96 | |
| 3l3e_A | 107 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.82 | |
| 2d8m_A | 129 | DNA-repair protein XRCC1; parallel beta-sheet, DNA | 99.78 | |
| 3pa6_A | 107 | Microcephalin; BRCT domain, cell cycle; HET: MSE; | 99.78 | |
| 2cou_A | 109 | ECT2 protein; BRCT domain, RHO GTPase, structural | 99.77 | |
| 3l46_A | 112 | Protein ECT2; alternative splicing, guanine-nucleo | 99.77 | |
| 4id3_A | 92 | DNA repair protein REV1; BRCT domain, protein bind | 99.72 | |
| 2ebw_A | 97 | DNA repair protein REV1; A/B/A 3 layers, parallel | 99.66 | |
| 3olc_X | 298 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.62 | |
| 1wf6_A | 132 | Similar to S.pombe -RAD4+/CUT5+product (A40727); B | 99.62 | |
| 3pc6_A | 104 | DNA repair protein XRCC1; BRCT domain, protein:pro | 99.59 | |
| 1l0b_A | 229 | BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu | 99.52 | |
| 2nte_A | 210 | BARD-1, BRCA1-associated ring domain protein 1; BR | 99.48 | |
| 3sqd_A | 219 | PAX-interacting protein 1; tandem BRCT domains, ce | 99.48 | |
| 2etx_A | 209 | Mediator of DNA damage checkpoint protein 1; tande | 99.45 | |
| 1t15_A | 214 | Breast cancer type 1 susceptibility protein; prote | 99.45 | |
| 3al2_A | 235 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.35 | |
| 2jw5_A | 106 | DNA polymerase lambda; BRCT domain, family X polym | 99.34 | |
| 3olc_X | 298 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.33 | |
| 3u3z_A | 199 | Microcephalin; DNA repair, cell cycle regulation, | 99.3 | |
| 3l41_A | 220 | BRCT-containing protein 1; BRC1, BRCT domain, tand | 99.3 | |
| 3ii6_X | 263 | DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter | 99.23 | |
| 3ii6_X | 263 | DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter | 99.21 | |
| 1kzy_C | 259 | Tumor suppressor P53-binding protein 1; tandem-BRC | 99.18 | |
| 1l7b_A | 92 | DNA ligase; BRCT, autostructure, structural genomi | 99.13 | |
| 2vxb_A | 241 | DNA repair protein RHP9; BRCT, nucleus, cell cycle | 99.11 | |
| 2k6g_A | 109 | Replication factor C subunit 1; protein, BRCT, DNA | 99.09 | |
| 2ebu_A | 112 | Replication factor C subunit 1; A/B/A 3 layers, pa | 99.02 | |
| 1z56_C | 264 | DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA | 98.98 | |
| 2ep8_A | 100 | Pescadillo homolog 1; A/B/A 3 layers, nucleolus, r | 98.98 | |
| 2cok_A | 113 | Poly [ADP-ribose] polymerase-1; BRCT domain, DNA r | 98.95 | |
| 1z56_C | 264 | DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA | 98.88 | |
| 2coe_A | 120 | Deoxynucleotidyltransferase, terminal variant; BRC | 98.86 | |
| 3pc7_A | 88 | DNA ligase 3; DNA repair, BRCT domain, protein:pro | 98.78 | |
| 1l0b_A | 229 | BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu | 98.71 | |
| 1t15_A | 214 | Breast cancer type 1 susceptibility protein; prote | 98.67 | |
| 3u3z_A | 199 | Microcephalin; DNA repair, cell cycle regulation, | 98.49 | |
| 2dun_A | 133 | POL MU, DNA polymerase MU; layers A/B/A, parallel | 98.45 | |
| 2etx_A | 209 | Mediator of DNA damage checkpoint protein 1; tande | 98.35 | |
| 1kzy_C | 259 | Tumor suppressor P53-binding protein 1; tandem-BRC | 98.29 | |
| 2nte_A | 210 | BARD-1, BRCA1-associated ring domain protein 1; BR | 98.2 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 97.86 | |
| 2owo_A | 671 | DNA ligase; protein-DNA complex, ligase-DNA comple | 97.86 | |
| 1dgs_A | 667 | DNA ligase; AMP complex, NAD+-dependent; HET: DNA | 97.85 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 97.78 | |
| 3sqd_A | 219 | PAX-interacting protein 1; tandem BRCT domains, ce | 97.69 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 97.61 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 97.6 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 97.57 | |
| 2vxb_A | 241 | DNA repair protein RHP9; BRCT, nucleus, cell cycle | 97.55 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 97.54 | |
| 3t7k_A | 256 | RTT107, regulator of TY1 transposition protein 107 | 97.43 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 97.42 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 97.37 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 97.32 | |
| 3al2_A | 235 | DNA topoisomerase 2-binding protein 1; BRCT domain | 97.3 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 97.25 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 97.17 | |
| 4gns_A | 290 | Chitin biosynthesis protein CHS5; FN3, BRCT, tetra | 96.94 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 96.82 | |
| 3huf_A | 325 | DNA repair and telomere maintenance protein NBS1; | 96.81 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 96.74 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 96.66 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 96.66 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 96.41 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 96.27 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 96.13 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 96.0 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 95.96 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 95.82 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 95.78 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 95.68 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 95.47 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 95.45 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 95.36 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 95.36 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 95.34 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 95.33 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 95.33 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 95.28 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 95.16 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 95.14 | |
| 2l42_A | 106 | DNA-binding protein RAP1; BRCT domain, protein bin | 95.1 | |
| 3qbz_A | 160 | DDK kinase regulatory subunit DBF4; FHA domain,RAD | 95.1 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 95.1 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 95.08 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 95.05 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 94.96 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 94.76 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 94.69 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 94.68 | |
| 3oq0_A | 151 | DBF4, protein DNA52; DDK, BRCT, RAD53, replication | 94.66 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 94.59 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 94.55 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 94.53 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 94.5 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 94.48 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 94.46 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 94.44 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 94.4 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 94.22 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 94.13 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 94.13 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 94.08 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 94.03 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 93.87 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 93.72 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 93.71 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 93.6 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 93.53 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 93.51 | |
| 3l41_A | 220 | BRCT-containing protein 1; BRC1, BRCT domain, tand | 93.49 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 93.37 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 93.36 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 93.36 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 93.32 | |
| 3oq4_A | 134 | DBF4, protein DNA52; DDK, BRCT, RAD53, replication | 93.3 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 93.2 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 92.98 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 92.85 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 92.42 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 92.38 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 92.22 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 92.07 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 91.98 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 91.84 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 91.82 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 91.78 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 91.67 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 91.62 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 91.54 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 91.33 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 91.08 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 90.79 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 90.62 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 90.57 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 90.36 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 90.09 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 89.73 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 89.24 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 88.62 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 88.34 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 88.07 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 87.94 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 87.94 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 87.18 | |
| 1xpj_A | 126 | Hypothetical protein; structural genomics, MCSG, p | 87.07 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 87.01 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 86.53 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 86.38 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 86.14 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 85.82 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 85.81 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 84.95 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 84.47 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 84.39 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 83.53 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 82.37 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 81.02 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 80.99 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 80.78 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 80.24 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 80.13 |
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
Probab=100.00 E-value=4.2e-72 Score=587.95 Aligned_cols=324 Identities=31% Similarity=0.482 Sum_probs=277.3
Q ss_pred CCcccCHHHHHHHHhhhhhhhhhcCccEEEEcCCCceeeeccCCCCChhhh--hhh-ccccccccccccceeeee-----
Q 041302 138 KGLRLGNDEIDRLRNTDMKHLLRHRKLYLILDLDHTLLNSTLLLHLTPEED--YLK-SQADSLQDVSKGSLFMLA----- 209 (484)
Q Consensus 138 ~~l~vs~~ea~~~~~~~~~~ll~~rKL~LVLDLDeTLIhs~~~~~~~~~e~--~~~-~~~~~~~d~~~~~~f~l~----- 209 (484)
.||+||.+||.+++++..+||+..+||+||||||||||||+..+ ...+| ++. .++.+++|+. .|.++
T Consensus 1 ~~l~vs~~~a~~~~~~~~~rll~~~Kl~LVLDLDeTLiHs~~~~--~~~~~~~~~~~~~~~~~~dv~---~F~l~~~~~~ 75 (442)
T 3ef1_A 1 SDLTVSLEEASRLESENVKRLRQEKRLSLIVXLDQTIIHATVDP--TVGEWMSDPGNVNYDVLRDVR---SFNLQEGPSG 75 (442)
T ss_dssp CTTHHHHHHHHHHHHHHHHHHHHTTCEEEEECCBTTTEEEECCT--HHHHHHTCTTSTTTGGGTTCE---EEEEEETTTT
T ss_pred CCceecHHHHHHHHHHHHHHHHhcCCeEEEEeeccceecccccc--ccchhccCCCCcchhhhcccc---ceeeeeccCC
Confidence 48999999999999999999999999999999999999999854 22332 111 1233444542 35553
Q ss_pred -ceeEEEEecccHHHHHHHhhhCCeEEEecCCcHhHHHHHHhhhCCCCcccceeEEeecCCCCCccccccccC-CCCCcE
Q 041302 210 -FMNMMTKLRPFVHTFLKEASEMFEMYIYTMGDRPYALEMAKLLDPSREYFNARVISRDDGTQRHQKGLDVVL-GQESAV 287 (484)
Q Consensus 210 -~~~~~vklRPgl~eFL~~ls~~yEl~IyT~g~r~YA~~I~~~LDP~~~~F~~RI~sRd~c~~~~~KdL~~l~-~~~~~v 287 (484)
+++|||++|||+++||++|+++|||+|||+|++.||++|++.|||.+.||++|||||++|+..++|||++|+ +++++|
T Consensus 76 ~~~~~~V~~RPgl~eFL~~ls~~yEivIfTas~~~YA~~Vl~~LDp~~~~f~~Rl~sRd~cg~~~~KdL~~ll~rdl~~v 155 (442)
T 3ef1_A 76 YTSCYYIKFRPGLAQFLQKISELYELHIYTMGTKAYAKEVAKIIDPTGKLFQDRVLSRDDSGSLAQKSLRRLFPCDTSMV 155 (442)
T ss_dssp EEEEEEEEECTTHHHHHHHHTTTEEEEEECSSCHHHHHHHHHHHCTTSTTTTTCEECTTTSSCSSCCCGGGTCSSCCTTE
T ss_pred ceeEEEEEeCCCHHHHHHHHhCCcEEEEEcCCCHHHHHHHHHHhccCCccccceEEEecCCCCceeeehHHhcCCCcceE
Confidence 478999999999999999999999999999999999999999999999999999999999877999999874 699999
Q ss_pred EEEcCChhhhhcCCCCeEEecccccccccccc--------------cCC-c--c--cc------------cc--------
Q 041302 288 LILDDTENAWTKHRDNLILMERYHFFASSCRQ--------------FGY-H--C--QS------------LS-------- 328 (484)
Q Consensus 288 VIIDD~~~vw~~~~~NlI~I~py~fF~~~~~~--------------~g~-~--~--~s------------l~-------- 328 (484)
|||||++.+|..|+ |+|+|.||+||.+.++. ++. + . +. ..
T Consensus 156 vIIDd~p~~~~~~p-N~I~I~~~~fF~~~gD~n~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 234 (442)
T 3ef1_A 156 VVIDDRGDVWDWNP-NLIKVVPYEFFVGIGDINSNFLAKSTPLPEQEQLIPLEIPKDEPDSVDEINEENEETPEYDSSNS 234 (442)
T ss_dssp EEEESCSGGGTTCT-TEEECCCCCCSTTCCCSCC----------------------------------------------
T ss_pred EEEECCHHHhCCCC-CEEEcCCccccCCCCcccccccccccccccccccccccccccccccccccccccccCcccccccc
Confidence 99999999999886 99999999999986431 121 0 0 00 00
Q ss_pred ---------------------------cc-------------------cc-----c----------chhhHHHHHHHHHH
Q 041302 329 ---------------------------QL-------------------RS-----D----------ESELEGALASVLKV 347 (484)
Q Consensus 329 ---------------------------e~-------------------~~-----d----------e~~~D~~L~~l~~~ 347 (484)
++ +| | ..++|++|.+|.++
T Consensus 235 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~rpl~~~q~~l~~~~~~~~~~~~~l~d~D~~L~~l~~~ 314 (442)
T 3ef1_A 235 SYAQDSSTIPEKTLLKDTFLQNREALEEQNKERVTALELQKSERPLAKQQNALLEDEGKPTPSHTLLHNRDHELERLEKV 314 (442)
T ss_dssp ------------------------CHHHHHHHHHHHHHHHHHHCHHHHHHHHHHTSCCSCHHHHCSCCCCCCHHHHHHHH
T ss_pred cccccccccchhhhhccccCccchhhHHHHHHhhhhhhhhhccCchhhHHHHhhhhhhccccccccccCCcHHHHHHHHH
Confidence 00 00 0 01358999999999
Q ss_pred HHHHHHHHHhhhhhhc------cCchhHHHHhhhhcccccceeeeeeeccCCCCCcchHHHHHHHHHhCCeEeeecCCCc
Q 041302 348 LKRIHNIFFDELANDL------AGRDVRQVLKMVRGEVLKGCKLVFSHVFPTKFPADTHYLWKMAEQLGATCSIELDPSV 421 (484)
Q Consensus 348 L~~IH~~ff~~~~~~~------~~~DVr~IL~~lr~~vL~G~~IvfSG~~p~~~~~~~~~l~~la~~lGA~v~~~i~~~v 421 (484)
|.+||++||+.|+... ..+||+.||+++|+++|+||+|||||++|.+.+++++.++.+|+++||+|+.+++++|
T Consensus 315 L~~iH~~fy~~~d~~~~~~~~~~~~Dv~~il~~~k~~~L~G~~IvfSG~~p~~~~~~r~~l~~~~~~lGa~~~~~vs~~v 394 (442)
T 3ef1_A 315 LKDIHAVYYEEENDISSRSGNHKHANVGLIIPKMKQKVLKGCRLLFSGVIPLGVDVLSSDIAKWAMSFGAEVVLDFSVPP 394 (442)
T ss_dssp HHHHHHHHHHHHHTCCSCCSSSCCCCHHHHHHHHHHTTSTTCEEEEESSSCTTSCSTTSHHHHHHHTTTCEECSSSSSCC
T ss_pred HHHHHHHHHHHhhhcccccccCCCCcHHHHHHHHhhcccCCcEEEEecccCCCCCccHHHHHHHHHHcCCEEeCCCCCCc
Confidence 9999999999998632 3589999999999999999999999999998878889999999999999999999999
Q ss_pred cEEEEcCCCChHHHHHHhc-CCeeeChhhHHHHHHhcCCCCCCCCCC
Q 041302 422 THVVSTDARTEKSRWAAKE-AKFLVDPRWIETANFLWQRQPEENFPV 467 (484)
Q Consensus 422 THlVa~~~~T~K~~~A~~~-gi~IV~~~WL~~c~~~w~r~dE~~Y~l 467 (484)
|||||++.+|.|+++|.++ ||+||+++||++|+.+|+|+||.+|+|
T Consensus 395 THLVa~~~~t~K~~~A~~~g~IkIVs~~WL~dcl~~~krldE~~YlL 441 (442)
T 3ef1_A 395 THLIAAKIRTEKVKKAVSMGNIKVVKLNWLTESLSQWKRLPESDYLL 441 (442)
T ss_dssp SEEEECSCCCHHHHHHHHHSSSEEEEHHHHHHHHHHTSCCCGGGTBC
T ss_pred eEEEeCCCCCHHHHHHHhcCCCEEEeHHHHHHHHHcCCcCChhcccc
Confidence 9999999999999999998 599999999999999999999999987
|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* | Back alignment and structure |
|---|
| >2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} | Back alignment and structure |
|---|
| >4id3_A DNA repair protein REV1; BRCT domain, protein binding; HET: DNA; 1.97A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* | Back alignment and structure |
|---|
| >1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 | Back alignment and structure |
|---|
| >3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} SCOP: c.15.1.1 PDB: 3pc8_A* 3qvg_B* 1cdz_A | Back alignment and structure |
|---|
| >1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 | Back alignment and structure |
|---|
| >2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A | Back alignment and structure |
|---|
| >3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A | Back alignment and structure |
|---|
| >1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A | Back alignment and structure |
|---|
| >3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* | Back alignment and structure |
|---|
| >2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* | Back alignment and structure |
|---|
| >3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* | Back alignment and structure |
|---|
| >3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* | Back alignment and structure |
|---|
| >3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* | Back alignment and structure |
|---|
| >3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* | Back alignment and structure |
|---|
| >1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B | Back alignment and structure |
|---|
| >1l7b_A DNA ligase; BRCT, autostructure, structural genomics, NESG, PSI, protein structure initiative, northeast structural genomics consortium; HET: DNA; NMR {Thermus thermophilus} SCOP: c.15.1.2 | Back alignment and structure |
|---|
| >2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* | Back alignment and structure |
|---|
| >2k6g_A Replication factor C subunit 1; protein, BRCT, DNA binding, activator, alternative splicing, ATP-binding, DNA replication, DNA- binding; NMR {Homo sapiens} PDB: 2k7f_A | Back alignment and structure |
|---|
| >2ebu_A Replication factor C subunit 1; A/B/A 3 layers, parallel beta-sheet, DNA replication, clamp loader, RFC1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ep8_A Pescadillo homolog 1; A/B/A 3 layers, nucleolus, ribosome biogenesis, DNA damage, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cok_A Poly [ADP-ribose] polymerase-1; BRCT domain, DNA repair, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2le0_A | Back alignment and structure |
|---|
| >1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2coe_A Deoxynucleotidyltransferase, terminal variant; BRCT domain, DNA polymerase, teminal deoxynucleotidyltransferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pc7_A DNA ligase 3; DNA repair, BRCT domain, protein:protein interactions, XRCC1 domain, DNA binding protein; HET: DNA MSE; 1.65A {Homo sapiens} SCOP: c.15.1.2 PDB: 3pc8_C* 1imo_A* 1in1_A* 3qvg_A* | Back alignment and structure |
|---|
| >1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 | Back alignment and structure |
|---|
| >1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A | Back alignment and structure |
|---|
| >3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* | Back alignment and structure |
|---|
| >2dun_A POL MU, DNA polymerase MU; layers A/B/A, parallel beta-sheet of 4 strands, non- homologous END jonting, somatic hypermutation, V(D)J recombination; HET: DNA; NMR {Homo sapiens} PDB: 2htf_A* | Back alignment and structure |
|---|
| >2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A | Back alignment and structure |
|---|
| >1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B | Back alignment and structure |
|---|
| >2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >2owo_A DNA ligase; protein-DNA complex, ligase-DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A* | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3t7k_A RTT107, regulator of TY1 transposition protein 107; BRCT, DNA repair, phospho-peptide, protein binding; HET: SEP; 2.03A {Saccharomyces cerevisiae} PDB: 3t7j_A* 3t7i_A | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >2l42_A DNA-binding protein RAP1; BRCT domain, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qbz_A DDK kinase regulatory subunit DBF4; FHA domain,RAD53, replication checkpoint, cell cycle; 2.69A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3oq0_A DBF4, protein DNA52; DDK, BRCT, RAD53, replication checkpoint, FHA domain, regula subunit of DDK, CDC7, phosphorylation, nuclear; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >3oq4_A DBF4, protein DNA52; DDK, BRCT, RAD53, replication checkpoint, FHA domain, regula subunit of DDK, CDC7, phosphorylation, nuclear; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 484 | ||||
| d1ta0a_ | 181 | c.108.1.16 (A:) Carboxy-terminal domain RNA polyme | 8e-25 | |
| d1wf6a_ | 132 | c.15.1.5 (A:) DNA topoisomerase II binding protein | 3e-11 | |
| d1cdza_ | 96 | c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Hom | 4e-10 | |
| d1t15a1 | 109 | c.15.1.3 (A:1649-1757) Breast cancer associated pr | 1e-09 | |
| d1t15a2 | 102 | c.15.1.3 (A:1758-1859) Breast cancer associated pr | 9e-06 |
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 181 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: NLI interacting factor-like phosphatase domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 99.0 bits (246), Expect = 8e-25
Identities = 44/226 (19%), Positives = 80/226 (35%), Gaps = 53/226 (23%)
Query: 155 MKHLL------RHRKLYLILDLDHTLLNSTLLLHLTPEEDYLKSQADSLQDVSKGSLFML 208
M++LL K+ +++DLD TL++S+ + + D
Sbjct: 1 MQYLLPEAKAQDSDKICVVIDLDETLVHSS-------------FKPVNNADFIIPVEIDG 47
Query: 209 AFMNMMTKLRPFVHTFLKEASEMFEMYIYTMGDRPYALEMAKLLDPSREYFNARVISRDD 268
+ RP V FL+ E+FE ++T YA +A LLD +
Sbjct: 48 VVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCV 107
Query: 269 GTQR-HQKGLDVVLGQESAVLILDDTENAWTKHRDNLILMERYHFFASSCRQFGYHCQSL 327
+ + K L + VLILD++ ++ H DN + + +
Sbjct: 108 FHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWF---------------- 151
Query: 328 SQLRSDESELEGALASVLKVLKRIHNIFFDELANDLAGRDVRQVLK 373
+ S+ E L +L +++ + DV VL+
Sbjct: 152 ----DNMSDTE--LHDLLPFFEQLSRV-----------DDVYSVLR 180
|
| >d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 132 | Back information, alignment and structure |
|---|
| >d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 484 | |||
| d1ta0a_ | 181 | Carboxy-terminal domain RNA polymerase II polypept | 100.0 | |
| d1wf6a_ | 132 | DNA topoisomerase II binding protein 1, TopBP1 {Hu | 99.67 | |
| d1cdza_ | 96 | DNA-repair protein XRCC1 {Human (Homo sapiens) [Ta | 99.64 | |
| d1t15a2 | 102 | Breast cancer associated protein, BRCA1 {Human (Ho | 99.6 | |
| d1t15a1 | 109 | Breast cancer associated protein, BRCA1 {Human (Ho | 99.6 | |
| d1l7ba_ | 92 | NAD+-dependent DNA ligase, domain 4 {Thermus therm | 99.18 | |
| d1in1a_ | 88 | DNA ligase III alpha {Human (Homo sapiens) [TaxId: | 99.16 | |
| d1kzyc1 | 153 | 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | 99.0 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 98.31 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 97.79 | |
| d2obba1 | 122 | Hypothetical protein BT0820 {Bacteroides thetaiota | 97.46 | |
| d1l0ba2 | 97 | Breast cancer associated protein, BRCA1 {Rat (Ratt | 97.44 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 97.42 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 97.15 | |
| d1kzyc2 | 106 | 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | 96.29 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 96.28 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 96.27 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 96.25 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 96.24 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 96.21 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 96.06 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 95.85 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 95.73 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 95.67 | |
| d1xpja_ | 124 | Hypothetical protein VC0232 {Vibrio cholerae [TaxI | 95.52 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 94.99 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 93.88 | |
| d1yj5a1 | 195 | 5' polynucleotide kinase-3' phosphatase, middle do | 93.83 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 93.33 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 93.26 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 92.13 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 91.75 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 91.74 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 90.72 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 89.62 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 89.34 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 88.48 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 87.96 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 86.36 | |
| d1vjra_ | 261 | Hypothetical protein TM1742 {Thermotoga maritima [ | 86.28 | |
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 85.68 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 85.57 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 85.39 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 84.71 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 84.4 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 83.8 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 82.75 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 82.16 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 81.83 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 81.29 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 80.55 |
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: NLI interacting factor-like phosphatase domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=7.4e-38 Score=291.74 Aligned_cols=169 Identities=25% Similarity=0.328 Sum_probs=139.2
Q ss_pred hhhcCccEEEEcCCCceeeeccCCCCChhhhhhhccccccccccccceeeeeceeEEEEecccHHHHHHHhhhCCeEEEe
Q 041302 158 LLRHRKLYLILDLDHTLLNSTLLLHLTPEEDYLKSQADSLQDVSKGSLFMLAFMNMMTKLRPFVHTFLKEASEMFEMYIY 237 (484)
Q Consensus 158 ll~~rKL~LVLDLDeTLIhs~~~~~~~~~e~~~~~~~~~~~d~~~~~~f~l~~~~~~vklRPgl~eFL~~ls~~yEl~Iy 237 (484)
....+|++||||||||||||+..+.... +......+......+||++|||+++||+.++++|||+||
T Consensus 10 ~~~~~k~~LVLDLDeTLihs~~~~~~~~-------------~~~~~~~~~~~~~~~~v~~RP~l~eFL~~l~~~yei~I~ 76 (181)
T d1ta0a_ 10 AQDSDKICVVIDLDETLVHSSFKPVNNA-------------DFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLF 76 (181)
T ss_dssp GGGTTSCEEEECCBTTTEEEESSCCTTC-------------SEEEEEEETTEEEEEEEEECTTHHHHHHHHHHHSEEEEE
T ss_pred cccCCCeEEEEeCCCCEEccccCCCCCc-------------cceeeecccceeeeeEEecCCCHHHHHHHHHhceEEEEE
Confidence 4567899999999999999987532111 100000111123578999999999999999999999999
Q ss_pred cCCcHhHHHHHHhhhCCCCcccceeEEeecCCCC---CccccccccCCCCCcEEEEcCChhhhhcCCCCeEEeccccccc
Q 041302 238 TMGDRPYALEMAKLLDPSREYFNARVISRDDGTQ---RHQKGLDVVLGQESAVLILDDTENAWTKHRDNLILMERYHFFA 314 (484)
Q Consensus 238 T~g~r~YA~~I~~~LDP~~~~F~~RI~sRd~c~~---~~~KdL~~l~~~~~~vVIIDD~~~vw~~~~~NlI~I~py~fF~ 314 (484)
|+|++.||++|++.|||++. |..++ +|++|.. .++|||+++++++++||||||++.+|..|++|+|+|+||.
T Consensus 77 Ta~~~~YA~~il~~ldp~~~-~~~~~-~r~~c~~~~~~~~KdL~~l~~~l~~vvivDd~~~~~~~~~~N~I~I~~f~--- 151 (181)
T d1ta0a_ 77 TASLAKYADPVADLLDKWGA-FRARL-FRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWF--- 151 (181)
T ss_dssp CSSCHHHHHHHHHHHCSSCC-EEEEE-CGGGSEEETTEEECCGGGSCSCGGGEEEECSCGGGGTTCGGGBCCCCCCS---
T ss_pred cCCcHHHHHHHHHHhccCCc-eeEEE-EeeeeeecCCcccccHhhcCCCHHHeEEEcCChhhhhcCccCeeEecCcC---
Confidence 99999999999999999985 44555 5999963 5789999999999999999999999999999999999997
Q ss_pred ccccccCCcccccccccccchhhHHHHHHHHHHHHHHHHHHHhhhhhhccCchhHHHHhh
Q 041302 315 SSCRQFGYHCQSLSQLRSDESELEGALASVLKVLKRIHNIFFDELANDLAGRDVRQVLKM 374 (484)
Q Consensus 315 ~~~~~~g~~~~sl~e~~~de~~~D~~L~~l~~~L~~IH~~ff~~~~~~~~~~DVr~IL~~ 374 (484)
| +.+|++|..|+++|+++++ .+|||.+|++
T Consensus 152 ------~-------------~~~D~eL~~l~~~L~~l~~-----------~~DVR~~l~~ 181 (181)
T d1ta0a_ 152 ------D-------------NMSDTELHDLLPFFEQLSR-----------VDDVYSVLRQ 181 (181)
T ss_dssp ------S-------------CTTCCHHHHHHHHHHHHTT-----------CSCHHHHHCC
T ss_pred ------C-------------CCCcHHHHHHHHHHHHHcc-----------CCcHHHHhcC
Confidence 2 4679999999999999973 6899999864
|
| >d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l7ba_ c.15.1.2 (A:) NAD+-dependent DNA ligase, domain 4 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1in1a_ c.15.1.2 (A:) DNA ligase III alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1l0ba2 c.15.1.3 (A:1705-1801) Breast cancer associated protein, BRCA1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kzyc2 c.15.1.4 (C:1867-1972) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|