Citrus Sinensis ID: 041335

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590----

AFEHFCNFAFKENHCPEDFKRDSRRVVKYADGNPLVLKVLGSSLKRKSHWGNVLDDLNRICESDIHNIYDILKISFNELTPRVKSIFLDIACFFEGEDKDFLARILDDSESDGLDVLIDKSLISISEKWADKLLQMHDILQEMGREIVRQESEKQPGKRSRLWDPKEIRRVLKQKRNCAVMEILQEIACLSSLTGLHLSGNNFESLPASIKQLSQLSSLDLKDCKMLQSLPELPLCLKSLDLMDCKILQSLPALPLCLESLALTGCNMLRSIPELPLCLKYLNLEDCNMLRSLPELSLCLQSLNARNCNRLRSLPEIPSCLQELDASVLEKLSKPSLDLIQWAPGCLESQPIYFGFTKCLKLNGKANNKILADSLLIIRHMAIASLRLGYEKAINEKISELRGSLIVLPGGEIPDWFSHQNSGSSICIQLPPHSFCRNLIGFAYCAVPDLKQGYSDCFRYFYVKCQFELEIKTLSETKHVDLGFRVRTKYIYSDHVILGFKPCLNVGFPDGYHHTTATFKFFAECNLKGYKIKRCGVCPVYANPSETKDNTFTINFATEVWKLDDLPSTSGSSDVEELEPSPKRICRANQINTP

cHHHHcHHcccccccccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHccccccccHHccEEEEcccccccccccEEEEEEccccccHHHHHHHHHccccccHHHHcccccEEEEEcccccEEEccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHccccccHHHHHHHccccccccEEEccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccEEEccccccccEEccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHcccccEEEEEccccccccccccccccEEEEEccccccccccccEEEEEEcccccccccccccEEEEEEEEEcccccccccEEEEccccccccccccEEEEEEEcccccccccccccEEEEEEEEEEEccccEEEEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccHHHHcccccccc

cHHHHHHHHHccccccccHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHEEEccccccHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHcEEEEEEccccccEEEHHHHHHHHHHHHHHccccccccccEEEccHHHHHHHHHHcccccEEEcccHccccccccEEEEccccccccccccccHHHHEEEcccccccccccccccHcccEEEccccccHccccccccccHEEEccccccHHccccHHHHHHEEcccccccHcccccHHHHHcEEcccccHHHcccccccccHHHHHHccHHHcccccccccccHHHHHHHHHHHEcccccccccccccccccHHHHHHcccccHHHccccHHHHHHcHHccccccEEEcccccccHHccccccccEEEEEccccccccccccEEEEEEEEccccccccccEEEEEEEEEEcccccccccccccccccccccEEccEEEEEEcccccccccccccccEEEEEEEEEcccccEEEEEcEEEEEEEcccccccccccccccccccccccccccccccccccccccccHcccccccccc

AFEHFcnfafkenhcpedfkrdsrrvvkyadgnpLVLKVLGSslkrkshwgnvLDDLNRICESDIHNIYDILKISFNELTPRVKSIFLDIACFFEGEDKDFLARIlddsesdgldvlidKSLISISEKWADKLLQMHDILQEMGREIVRQesekqpgkrsrlwdpKEIRRVLKQKRNCAVMEILQEIACLSsltglhlsgnnfesLPASIKQLSQlssldlkdckmlqslpelplclksldlmdckilqslpalpLCLESLALTGCnmlrsipelplclkylnledcnmlrslpelSLCLQSLNarncnrlrslpeipsCLQELDASVLEklskpsldliqwapgclesqpiyfgFTKCLKLNGKANNKILADSLLIIRHMAIASLRLGYEKAINEKISELRGSlivlpggeipdwfshqnsgssiciqlpphsfcrnligfaycavpdlkqgysdCFRYFYVKCQFELEIKTlsetkhvdlgfrvrtkyiysdhvilgfkpclnvgfpdgyhhttATFKFFAEcnlkgykikrcgvcpvyanpsetkdntfTINFATEvwklddlpstsgssdveelepspkricranqintp

afehfcnfafkenhcpedfkrDSRRVVKYADGNPLVLKvlgsslkrkshWGNVLDDLNRICESDIHNIYDILKISFNELTPRVKSIFLDIACFFEGEDKDFLARILDDSESDGLDVLIDKSLISISEKWADKLLQMHDILQEMGREIvrqesekqpgkrsrlwdpkeiRRVLKQKRNCAVMEILQEIACLSSLTGLHLSGNNFESLPASIKQLSQLSSLDLKDCKMLQSLPELPLCLKSLDLMDCKILQSLPALPLCLESLALTGCNMLRSIPELPLCLKYLNLEDCNMLRSLPELSLCLQSLNARNCNRLRSLPEIPSCLQELDASVLEKLSKPSLDLIQWAPGCLESQPIYFGFTKCLKLNGKANNKILADSLLIIRHMAIASLRLGYEKAINEKISELRGSLIVLPGGEIPDWFSHQNSGSSICIQLPPHSFCRNLIGFAYCAVPDLKQGYSDCFRYFYVKCQFELEIktlsetkhvdlgFRVRTKYIYSDHVILGFKPCLNVGFPDGYHHTTATFKFFAECNLKGYKIKRCGVCPVYanpsetkdntFTINFATEVWKLDDLPSTSgssdveelepspkricranqintp

AFEHFCNFAFKENHCPEDFKRDSRRVVKYADGNPLVLKVLGSSLKRKSHWGNVLDDLNRICESDIHNIYDILKISFNELTPRVKSIFLDIACFFEGEDKDFLARILDDSESDGLDVLIDKSLISISEKWADKLLQMHDILQEMGREIVRQESEKQPGKRSRLWDPKEIRRVLKQKRNCAVMEILQEIACLSSLTGLHLSGNNFESLPAsikqlsqlssldlkdCKMLQSLPELPLCLKSLDLMDCKILQSLPALPLCLESLALTGCNMLRSIPELPLCLKYLNLEDCNMLRSLPELSLCLQSLNARNCNRLRSLPEIPSCLQELDASVLEKLSKPSLDLIQWAPGCLESQPIYFGFTKCLKLNGKANNKILADSLLIIRHMAIASLRLGYEKAINEKISELRGSLIVLPGGEIPDWFSHQNSGSSICIQLPPHSFCRNLIGFAYCAVPDLKQGYSDCFRYFYVKCQFELEIKTLSETKHVDLGFRVRTKYIYSDHVILGFKPCLNVGFPDGYHHTTATFKFFAECNLKGYKIKRCGVCPVYANPSETKDNTFTINFATEVWKLDDLPSTSGSSDVEELEPSPKRICRANQINTP

***HFCNFAFKENHCPEDFKRDSRRVVKYADGNPLVLKVLGSSLKRKSHWGNVLDDLNRICESDIHNIYDILKISFNELTPRVKSIFLDIACFFEGEDKDFLARILDDSESDGLDVLIDKSLISISEKWADKLLQMHDILQEM**********************KEIRRVLKQKRNCAVMEILQEIACLSSLTGLHLSGNNFESLPASIKQLSQLSSLDLKDCKMLQSLPELPLCLKSLDLMDCKILQSLPALPLCLESLALTGCNMLRSIPELPLCLKYLNLEDCNMLRSLPELSLCLQSLNARNCNRLRSLPEIPSCLQELDASVLEKLSKPSLDLIQWAPGCLESQPIYFGFTKCLKLNGKANNKILADSLLIIRHMAIASLRLGYEKAINEKISELRGSLIVLPGGEIPDWFSHQNSGSSICIQLPPHSFCRNLIGFAYCAVPDLKQGYSDCFRYFYVKCQFELEIKTLSETKHVDLGFRVRTKYIYSDHVILGFKPCLNVGFPDGYHHTTATFKFFAECNLKGYKIKRCGVCPVYANPSETKDNTFTINFATEVWKLD******************************

AFEHFCNFAFKENHCPEDFKRDSRRVVKYADGNPLVLKVLGSSLKRKSHWGNVLDDLNRICESDIHNIYDILKISFNELTPRVKSIFLDIACFFEGEDKDFLARILDDSESDGLDVLIDKSLISISEKWADKLLQMHDILQEMGREIVRQESEKQPGKRSRLWDPKEIRRVLKQKRNCAVMEILQEIACLSSLTGLHLSGNNFESLPASIKQLSQLSSLDLKDCKMLQSLPELPLCLKSLDLMDCKILQSLPALPLCLESLALTGCNMLRSIPELPLCLKYLNLEDCNMLRSLPELSLCLQSLNARNCNRLRSLPEIPSCLQELDASVLEKLSKPSLDLIQWAPGCLESQPIYFGFTKCLKLNGKANNKILADSLLIIRHMAIASLRL*****INEKISELRGSLIVLPGGEIPDWFSHQNSGSSICIQLPPHSFCRNLIGFAYCAVPDLKQGYSDCFRYFYVKCQFELEIKTLSETKHVDLGFRVRTKYIYSDHVILGFKPCLNVGFPDGYHHTTATFKFFAECNLKGYKIKRCGVCPVY*****************************************************

AFEHFCNFAFKENHCPEDFKRDSRRVVKYADGNPLVLKVLGSSLKRKSHWGNVLDDLNRICESDIHNIYDILKISFNELTPRVKSIFLDIACFFEGEDKDFLARILDDSESDGLDVLIDKSLISISEKWADKLLQMHDILQEMGREIV*************LWDPKEIRRVLKQKRNCAVMEILQEIACLSSLTGLHLSGNNFESLPASIKQLSQLSSLDLKDCKMLQSLPELPLCLKSLDLMDCKILQSLPALPLCLESLALTGCNMLRSIPELPLCLKYLNLEDCNMLRSLPELSLCLQSLNARNCNRLRSLPEIPSCLQELDASVLEKLSKPSLDLIQWAPGCLESQPIYFGFTKCLKLNGKANNKILADSLLIIRHMAIASLRLGYEKAINEKISELRGSLIVLPGGEIPDWFSHQNSGSSICIQLPPHSFCRNLIGFAYCAVPDLKQGYSDCFRYFYVKCQFELEIKTLSETKHVDLGFRVRTKYIYSDHVILGFKPCLNVGFPDGYHHTTATFKFFAECNLKGYKIKRCGVCPVYANPSETKDNTFTINFATEVWKLDDL***************PKRICRANQINTP

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		594	2.2.26 [Sep-21-2011]
Q40392		1144	TMV resistance protein N	N/A	no	0.508	0.263	0.325	4e-30
O23530		1301	Protein SUPPRESSOR OF npr	no	no	0.531	0.242	0.314	4e-26
Q9FL92		1372	Probable WRKY transcripti	no	no	0.531	0.230	0.278	2e-25
O82500		1095	Putative disease resistan	no	no	0.781	0.423	0.246	4e-23
Q9FH83		1288	Probable WRKY transcripti	no	no	0.521	0.240	0.262	2e-21
Q9SZ67		1895	Probable WRKY transcripti	no	no	0.503	0.157	0.323	5e-21
Q83RJ4		571	E3 ubiquitin-protein liga	yes	no	0.262	0.273	0.395	3e-14
Q9FKN7		1613	Protein DA1-related 4 OS=	no	no	0.272	0.100	0.310	7e-14
D0ZVG2		700	E3 ubiquitin-protein liga	yes	no	0.215	0.182	0.429	8e-11
Q9LVT1		623	Putative disease resistan	no	no	0.267	0.255	0.252	1e-09

>sp\|Q40392\|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1	Back alignment and function desciption

 Score =  133 bits (335), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 118/362 (32%), Positives = 174/362 (48%), Gaps = 60/362 (16%)

Query: 5   FCNFAFKENHCPEDFKRDSRRVVKYADGNPLVLKVLGSSLK--RKSHWGNVLDDLNRICE 62
           F   AF +    E+F++ S  VV YA G PL LKV GS L   R + W + ++ +     
Sbjct: 357 FKQHAFGKEVPNENFEKLSLEVVNYAKGLPLALKVWGSLLHNLRLTEWKSAIEHMKNNSY 416

Query: 63  SDIHNIYDILKISFNELTPRVKSIFLDIACFFEGEDKDFLARILDD---SESDGLDVLID 119
           S    I D LKIS++ L P+ + +FLDIACF  GE+KD++ +IL+        GL +LID
Sbjct: 417 S---GIIDKLKISYDGLEPKQQEMFLDIACFLRGEEKDYILQILESCHIGAEYGLRILID 473

Query: 120 KSLISISEKWADKLLQMHDILQEMGREIVRQESEKQPGKRSRLWDPKEIRRVLKQKRNCA 179
           KSL+ ISE      +QMHD++Q+MG+ IV    +K PG+RSRLW  KE+  V+       
Sbjct: 474 KSLVFISEY---NQVQMHDLIQDMGKYIV--NFQKDPGERSRLWLAKEVEEVMSNNTGTM 528

Query: 180 VMEIL-------------QEIACLSSLTGLHLSGNN---------------------FES 205
            ME +             Q +  +  L   ++  ++                     +ES
Sbjct: 529 AMEAIWVSSYSSTLRFSNQAVKNMKRLRVFNMGRSSTHYAIDYLPNNLRCFVCTNYPWES 588

Query: 206 LPASIKQLSQLSSLDLKDCKMLQSLPE---LPLCLKSLDLMDCKILQSLP---ALPLCLE 259
            P++  +L  L  L L+   +     E   LP  L+ +DL   K L   P    +P  LE
Sbjct: 589 FPSTF-ELKMLVHLQLRHNSLRHLWTETKHLP-SLRRIDLSWSKRLTRTPDFTGMP-NLE 645

Query: 260 SLALTGCNMLRSIPE-LPLCLKY--LNLEDCNMLRSLPELSL-CLQSLNARNCNRLRSLP 315
            + L  C+ L  +   L  C K   L L DC  L+  P +++  L+ L  R+C+ L  LP
Sbjct: 646 YVNLYQCSNLEEVHHSLGCCSKVIGLYLNDCKSLKRFPCVNVESLEYLGLRSCDSLEKLP 705

Query: 316 EI 317
           EI
Sbjct: 706 EI 707

Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)

>sp\|O23530\|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3	Back alignment and function description

>sp\|Q9FL92\|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1	Back alignment and function description

>sp\|O82500\|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1	Back alignment and function description

>sp\|Q9FH83\|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3	Back alignment and function description

>sp\|Q9SZ67\|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1	Back alignment and function description

>sp\|Q83RJ4\|IPA3_SHIFL E3 ubiquitin-protein ligase ipaH3 OS=Shigella flexneri GN=ipaH3 PE=1 SV=1	Back alignment and function description

>sp\|Q9FKN7\|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2	Back alignment and function description

>sp\|D0ZVG2\|SSPH1_SALT1 E3 ubiquitin-protein ligase sspH1 OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=sspH1 PE=1 SV=1	Back alignment and function description

>sp\|Q9LVT1\|DRL39_ARATH Putative disease resistance protein At5g47280 OS=Arabidopsis thaliana GN=At5g47280 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		594
255564976		944	TMV resistance protein N, putative [Rici	0.858	0.540	0.305	1e-49
255573549		908	ATP binding protein, putative [Ricinus c	0.819	0.536	0.326	2e-48
298205187		660	unnamed protein product [Vitis vinifera]	0.850	0.765	0.301	6e-47
451798984		1049	TMV resistance protein N-like protein 4	0.885	0.501	0.272	8e-42
297800100		686	hypothetical protein ARALYDRAFT_354804 [	0.829	0.718	0.306	3e-41
147802475		1244	hypothetical protein VITISV_027841 [Viti	0.538	0.257	0.373	7e-41
357468447		806	NBS-containing resistance-like protein [	0.845	0.622	0.292	2e-40
255561510		1018	TMV resistance protein N, putative [Rici	0.865	0.504	0.283	8e-40
359493383		945	PREDICTED: TMV resistance protein N-like	0.676	0.425	0.329	3e-39
224145028		709	nbs-lrr resistance protein [Populus tric	0.693	0.581	0.321	6e-39

>gi\|255564976\|ref\|XP_002523481.1\| TMV resistance protein N, putative [Ricinus communis] gi\|223537309\|gb\|EEF38940.1\| TMV resistance protein N, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  204 bits (519), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 192/628 (30%), Positives = 286/628 (45%), Gaps = 118/628 (18%)

Query: 1   AFEHFCNFAFKENHCPE-DFKRDSRRVVKYADGNPLVLKVLGSSLKRKS--HWGNVLDDL 57
           A + F   AF++  CP+ D+ + S+RV+ YA GNPL LKVLGS L +++   W + L  L
Sbjct: 350 ALQLFSLNAFRQE-CPKADYMKLSKRVINYAKGNPLGLKVLGSFLYQRNIKEWESALHKL 408

Query: 58  NRICESDIHNIYDILKISFNELTPRVKSIFLDIACFFEGEDKDFLARILDD---SESDGL 114
            R    +I N+   LK+S++ L    K IFLD+ACFF GED+DF+ RIL+    S    +
Sbjct: 409 ERSTNKEIQNV---LKVSYDGLDDEEKDIFLDVACFFNGEDRDFVTRILNGCGFSADIAI 465

Query: 115 DVLIDKSLISISEKWADKLLQMHDILQEMGREIVRQESEKQPGKRSRLWDPKEIRRVLKQ 174
            VL+ KSL++IS    +  L +H++LQ+MG  IVRQES K+PG+RSRL   +++  VL +
Sbjct: 466 SVLVSKSLLTIS----NNTLAIHNLLQQMGWGIVRQESTKEPGRRSRLCTSEDVVHVLSK 521

Query: 175 KRNCAVMEILQEIACLSSLTGLHLSGNNFES-----------------------LPASIK 211
                 +E +     +S    ++LS   FE                        LP  ++
Sbjct: 522 NTGTEAIEGI--YLDMSKSRKVYLSPKAFERMHNLRLLKFHHSFSPIAMYSKVYLPEGLE 579

Query: 212 QLSQLSSLDLKDCKMLQSLP---------ELPL-------------CLKSLDLMDCKILQ 249
            L    S    +   L+SLP         EL +             CLK L+ ++    Q
Sbjct: 580 SLPDKLSCLHWNGYPLKSLPFNFCAEYLVELSMPHSHVKFLWEGDQCLKKLNSINLSDSQ 639

Query: 250 SLPALP-----LCLESLALTGCNMLRSIPE---LPLCLKYLNLEDCNMLRSLPELS--LC 299
            L  LP     L LE + L GC  L  +P        L  LNL+DC  LRS+P L     
Sbjct: 640 HLIRLPDFSEALNLEYINLEGCISLAQVPSSIGYLTKLDILNLKDCKELRSIPSLIDLQS 699

Query: 300 LQSLNARNCNRLRSLPEIPSCLQE--LDASVLEKLSKPSLDLIQWAPGCLESQPIYFGFT 357
           L+ LN   C+ L    + P  ++E  LD + +E+L     DL         S+  ++   
Sbjct: 700 LRKLNLSGCSNLNHCQDFPRNIEELCLDGTAIEELPASIEDL---------SELTFWSME 750

Query: 358 KCLKLNGKANNKILADSLLIIRHMAIASLRLGYEKAINEKISELRGSLIVLPGGEIPDWF 417
            C +L+  +   I AD+   I+  A A+            I  L       PG EIPDW 
Sbjct: 751 NCKRLDQNSCCLIAADAHKTIQRTATAA-----------GIHSLPSVSFGFPGTEIPDWL 799

Query: 418 SHQNSGSSICIQLPP--HSFCRNLIGFAYCAVPDLKQGYSDCFRYFYVKCQFELEIKTLS 475
            ++ +GSSI ++L P  H      +GFA C V            Y   +C F    KT  
Sbjct: 800 LYKETGSSITVKLHPNWHRNPSRFLGFAVCCVVKFTHFIDINNIYVICECNF----KTNH 855

Query: 476 ETKHVDLGF-------RVRTKYIYSDHVILGFKPCLNVGFPDG------YHHTTATFKFF 522
           +  HV   F       +  +  + S HV +G+   + +    G      YH+   TFKF+
Sbjct: 856 DDHHVVNCFLQGLNNGKDESDLVKSQHVYIGYDFGIYLRAVKGTYPGRLYHYEEVTFKFY 915

Query: 523 AECNLKGY-----KIKRCGVCPVYANPS 545
           A+  + G+     K+ +CGV  +YA  +
Sbjct: 916 AK-KMVGHTVAWRKVDKCGVHLLYAQDA 942

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255573549\|ref\|XP_002527699.1\| ATP binding protein, putative [Ricinus communis] gi\|223532930\|gb\|EEF34698.1\| ATP binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|298205187\|emb\|CBI17246.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|451798984\|gb\|AGF69190.1\| TMV resistance protein N-like protein 4 [Vitis labrusca]	Back alignment and taxonomy information

>gi\|297800100\|ref\|XP_002867934.1\| hypothetical protein ARALYDRAFT_354804 [Arabidopsis lyrata subsp. lyrata] gi\|297313770\|gb\|EFH44193.1\| hypothetical protein ARALYDRAFT_354804 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|147802475\|emb\|CAN61853.1\| hypothetical protein VITISV_027841 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|357468447\|ref\|XP_003604508.1\| NBS-containing resistance-like protein [Medicago truncatula] gi\|355505563\|gb\|AES86705.1\| NBS-containing resistance-like protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|255561510\|ref\|XP_002521765.1\| TMV resistance protein N, putative [Ricinus communis] gi\|223538978\|gb\|EEF40575.1\| TMV resistance protein N, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|359493383\|ref\|XP_002279002.2\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224145028\|ref\|XP_002325500.1\| nbs-lrr resistance protein [Populus trichocarpa] gi\|222862375\|gb\|EEE99881.1\| nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		594
TAIR\|locus:2118106		1219	AT4G12010 [Arabidopsis thalian	0.5	0.243	0.308	3.7e-37
TAIR\|locus:2081810		1226	AT3G51570 [Arabidopsis thalian	0.272	0.132	0.380	5.2e-36
TAIR\|locus:2162439		1008	AT5G22690 [Arabidopsis thalian	0.333	0.196	0.356	6.1e-35
TAIR\|locus:2122209		1179	AT4G36150 [Arabidopsis thalian	0.271	0.136	0.351	1.3e-33
TAIR\|locus:2155322		1170	LAZ5 "LAZARUS 5" [Arabidopsis	0.587	0.298	0.270	2e-33
TAIR\|locus:2175075		1068	AT5G41750 [Arabidopsis thalian	0.281	0.156	0.384	1.1e-31
TAIR\|locus:2158485		1288	RRS1 "RESISTANT TO RALSTONIA S	0.328	0.151	0.312	2.1e-31
TAIR\|locus:2153363		1261	AT5G45200 [Arabidopsis thalian	0.648	0.305	0.285	2.6e-30
TAIR\|locus:2155347		1372	TTR1 "TOLERANT TO TOBACCO RING	0.286	0.123	0.348	8.1e-30
TAIR\|locus:2167457		1191	AT5G36930 [Arabidopsis thalian	0.294	0.146	0.417	1.2e-29

TAIR\|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 251 (93.4 bits), Expect = 3.7e-37, Sum P(2) = 3.7e-37
 Identities = 102/331 (30%), Positives = 150/331 (45%)

Query:   277 LCLKYLNLEDCNMLRSLPELSLCLQSLNARNCNRLRSLPEIPSCLQELDASVLEKLSKPS 336
             LCL   N+E  N+  S  +L+  L+  + + C  L+SLP +P  LQ LDA   E L   +
Sbjct:   883 LCLSGNNIE--NLPESFNQLNN-LKWFDLKFCKMLKSLPVLPQNLQYLDAHECESLETLA 939

Query:   337 LDLIQWAPGCLESQPIYFGFTKCLKLNGKANNKILADSLLIIRHMAIASLRLGYEKAINE 396
               L     G  E     F F+ C KLN  A   ++  + +  + MA AS +  Y   + E
Sbjct:   940 NPLTPLTVG--ERIHSMFIFSNCYKLNQDAQASLVGHARIKSQLMANASAKRYYRGFVPE 997

Query:   397 KISELRGSLIVLPGGEIPDWFSHQNSGSSICIQLPPHSFCR-NLIGFAYCAVPDLKQGYS 455
                 L G  I  P  EIP WF HQ  G S+ I LPPH +C  N +G A   V   K  Y 
Sbjct:   998 P---LVG--ICYPATEIPSWFCHQRLGRSLEIPLPPH-WCDINFVGLALSVVVSFKD-YE 1050

Query:   456 DCFRYFYVKCQFELEIKTLSETKHVDL---GFRV-------RTKYIYSDHVILGFKPCL- 504
             D  + F VKC    E K  S T+  D    G+          ++ + SDHV +G+  C  
Sbjct:  1051 DSAKRFSVKCCGNFENKDSSFTRF-DFTLAGWNEPCGSLSHESRKLTSDHVFMGYNSCFL 1109

Query:   505 --NV-GFPDGYHHTTATFKFFAECNLKGYKIKRCGV--CPVYANPSETKDNTFTINFATE 559
               NV G  +   +T A+F+F+   +    KI+ C V  C +        D+   +   T 
Sbjct:  1110 VKNVHGESNSCCYTKASFEFYVTDDETRKKIETCEVIKCGMSLMYVPEDDDCMLLK-KTN 1168

Query:   560 VWKLDDLPSTSGSSDVEEL--EPSPKR-ICR 587
             + +L      S S D++++  +  PKR +C+
Sbjct:  1169 IVQLSLKSGPSCSYDLDDVMDDVRPKRGLCQ 1199

GO:0005634 "nucleus" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0007165 "signal transduction" evidence=IEA

GO:0043531 "ADP binding" evidence=IEA

GO:0006612 "protein targeting to membrane" evidence=RCA

GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA

GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA

TAIR\|locus:2081810 AT3G51570 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2162439 AT5G22690 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2122209 AT4G36150 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2155322 LAZ5 "LAZARUS 5" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2175075 AT5G41750 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2158485 RRS1 "RESISTANT TO RALSTONIA SOLANACEARUM 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2155347 TTR1 "TOLERANT TO TOBACCO RINGSPOT NEPOVIRUS 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2167457 AT5G36930 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh1_pg.C_scaffold_7001977	annotation not avaliable (686 aa)
		(Arabidopsis lyrata)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		594
PLN03210		1153	PLN03210, PLN03210, Resistant to P	2e-31
pfam00931		285	pfam00931, NB-ARC, NB-ARC domain	1e-13
PLN03210		1153	PLN03210, PLN03210, Resistant to P	9e-13
PRK15387		788	PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss	6e-12
PRK15387		788	PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss	1e-11
PRK15387		788	PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss	3e-09
PRK15370		754	PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl	7e-07
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	2e-06
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	6e-05
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	1e-04
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	0.001
PRK15386		426	PRK15386, PRK15386, type III secretion protein Gog	0.002
PRK15370		754	PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl	0.003
PRK15386		426	PRK15386, PRK15386, type III secretion protein Gog	0.003

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

 Score =  130 bits (328), Expect = 2e-31
 Identities = 119/388 (30%), Positives = 179/388 (46%), Gaps = 75/388 (19%)

Query: 1   AFEHFCNFAFKENHCPEDFKRDSRRVVKYADGNPLVLKVLGSSLKRKSHWGNVLDDLNRI 60
           A E FC  AFK+N  P+ F   +  V   A   PL L VLGS L R     + +D L R+
Sbjct: 356 ALEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLNVLGSYL-RGRDKEDWMDMLPRL 414

Query: 61  CESDIHNIYDILKISFNELTPRV-KSIFLDIACFFEGEDKDFLARILDDSESD---GLDV 116
                  I   L++S++ L  +  K+IF  IAC F GE  + +  +L +S+ D   GL  
Sbjct: 415 RNGLDGKIEKTLRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKN 474

Query: 117 LIDKSLISISEKWADKLLQMHDILQEMGREIVRQESEKQPGKRSRLWDPKEIRRVLKQKR 176
           L+DKSLI + E     +++MH +LQEMG+EIVR +S  +PG+R  L D K+I  VL+   
Sbjct: 475 LVDKSLIHVRE----DIVEMHSLLQEMGKEIVRAQSN-EPGEREFLVDAKDICDVLED-- 527

Query: 177 NCAVMEILQEIACLSSLTGLHLSGNNFES------LPASIKQLSQ--------------- 215
           N    ++L     +  +  LH+  N F+       L    K+  Q               
Sbjct: 528 NTGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYL 587

Query: 216 -----LSSLDLKDCKMLQS------LPELPLC----------------LKSLDLMDCKIL 248
                L   D    + + S      L +L +                 L+++DL   K L
Sbjct: 588 PPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNL 647

Query: 249 QSLPALPLC--LESLALTGCNMLRSIPELPLCLKYLN------LEDCNMLRSLPELSLCL 300
           + +P L +   LE+L L+ C+   S+ ELP  ++YLN      +  C  L  LP   + L
Sbjct: 648 KEIPDLSMATNLETLKLSDCS---SLVELPSSIQYLNKLEDLDMSRCENLEILP-TGINL 703

Query: 301 QS---LNARNCNRLRSLPEIPSCLQELD 325
           +S   LN   C+RL+S P+I + +  LD
Sbjct: 704 KSLYRLNLSGCSRLKSFPDISTNISWLD 731

syringae 6; Provisional. Length = 1153

>gnl\|CDD\|216202 pfam00931, NB-ARC, NB-ARC domain	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>gnl\|CDD\|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>gnl\|CDD\|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>gnl\|CDD\|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional	Back alignment and domain information

>gnl\|CDD\|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>gnl\|CDD\|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		594
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	100.0
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	99.42
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.17
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.16
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.1
PRK15386		426	type III secretion protein GogB; Provisional	99.1
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.08
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.04
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	98.98
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	98.96
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	98.83
KOG0617		264	consensus Ras suppressor protein (contains leucine	98.74
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	98.63
PRK15386		426	type III secretion protein GogB; Provisional	98.58
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	98.32
KOG0472		565	consensus Leucine-rich repeat protein [Function un	98.26
KOG0472		565	consensus Leucine-rich repeat protein [Function un	98.24
KOG0617		264	consensus Ras suppressor protein (contains leucine	98.13
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	98.11
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	98.1
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	98.05
PLN03150		623	hypothetical protein; Provisional	97.96
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	97.94
PLN03150		623	hypothetical protein; Provisional	97.8
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	97.75
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	97.71
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.7
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	97.7
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	97.69
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	97.57
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	97.54
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	97.5
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	97.49
KOG4237		498	consensus Extracellular matrix protein slit, conta	97.43
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	97.43
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	97.31
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.1
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	97.09
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	96.96
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	96.93
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	96.79
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	96.67
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	96.34
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	96.01
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	95.88
KOG4237		498	consensus Extracellular matrix protein slit, conta	95.22
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.06
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	94.81
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	94.7
KOG4341		483	consensus F-box protein containing LRR [General fu	94.68
PRK04841		903	transcriptional regulator MalT; Provisional	93.61
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	93.6
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	93.51
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	92.37
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	91.91
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	90.43
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	90.15
KOG4341		483	consensus F-box protein containing LRR [General fu	90.09
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	89.32
KOG2982		418	consensus Uncharacterized conserved protein [Funct	88.92
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	88.71
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	88.37
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	87.84
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	87.56
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	86.74
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	86.51
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	86.5
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	83.98
smart00370		26	LRR Leucine-rich repeats, outliers.	83.28
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	83.28
KOG1947		482	consensus Leucine rich repeat proteins, some prote	82.35

>PLN03210 Resistant to P	Back alignment and domain information

Probab=100.00  E-value=1.3e-63  Score=595.56  Aligned_cols=521  Identities=29%  Similarity=0.425  Sum_probs=355.7

Q ss_pred             CHhHHhhhhcCCCCCChhHHHHHHHHHHHhCCChHHHHHHHccCC--CHHHHHHHHHHhhhhcCCChhhHHHHHHHhhcC
Q 041335            1 AFEHFCNFAFKENHCPEDFKRDSRRVVKYADGNPLVLKVLGSSLK--RKSHWGNVLDDLNRICESDIHNIYDILKISFNE   78 (594)
Q Consensus         1 a~~LF~~~AF~~~~~~~~~~~l~~~iv~~c~GlPLAlkvlgs~L~--~~~~W~~~l~~l~~~~~~~i~~~~~~L~~Syd~   78 (594)
                      ||+||+++||++..+++++++++++||++|+|+||||+++|+.|+  +..+|+++++++++.++.+|   .++|++|||+
T Consensus       356 a~~LF~~~Af~~~~~~~~~~~l~~~iv~~c~GLPLAl~vlgs~L~~k~~~~W~~~l~~L~~~~~~~I---~~~L~~SYd~  432 (1153)
T PLN03210        356 ALEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLNVLGSYLRGRDKEDWMDMLPRLRNGLDGKI---EKTLRVSYDG  432 (1153)
T ss_pred             HHHHHHHHhcCCCCCcHHHHHHHHHHHHHhCCCcHHHHHHHHHHcCCCHHHHHHHHHHHHhCccHHH---HHHHHHhhhc
Confidence            799999999999888899999999999999999999999999999  88999999999999888777   9999999999


Q ss_pred             CCH-hHHhHhhhhccccCCCChhHHHHHhhh---hhhhhhhHHhhcCCceecccCCCCeEEecHHHHHHHHHHHhhcccc
Q 041335           79 LTP-RVKSIFLDIACFFEGEDKDFLARILDD---SESDGLDVLIDKSLISISEKWADKLLQMHDILQEMGREIVRQESEK  154 (594)
Q Consensus        79 L~~-~~K~~Fl~~a~Fp~~~~~~~v~~~l~~---~~~~~i~~Lv~~sli~~~~~~~~~~~~mHdLl~~~~~~i~~~e~~~  154 (594)
                      |++ .+|.||+||||||.+++++++..++.+   .++.+++.|++||||++.    .++++||||+|+||++|+++++ .
T Consensus       433 L~~~~~k~~Fl~ia~ff~~~~~~~v~~~l~~~~~~~~~~l~~L~~ksLi~~~----~~~~~MHdLl~~~~r~i~~~~~-~  507 (1153)
T PLN03210        433 LNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNLVDKSLIHVR----EDIVEMHSLLQEMGKEIVRAQS-N  507 (1153)
T ss_pred             cCccchhhhhheehhhcCCCCHHHHHHHHHhcCCCchhChHHHHhcCCEEEc----CCeEEhhhHHHHHHHHHHHhhc-C
Confidence            986 599999999999999999999998887   667789999999999987    6789999999999999999998 7


Q ss_pred             CCCCceecCCchhHHHHHhccCccceee--------------------------------------------ecccCcCC
Q 041335          155 QPGKRSRLWDPKEIRRVLKQKRNCAVME--------------------------------------------ILQEIACL  190 (594)
Q Consensus       155 ~~~~~~~l~~~~~i~~vl~~~~~~~~i~--------------------------------------------~l~~l~~L  190 (594)
                      +|++++++|.++++++|+..++|+..++                                            +++++..+
T Consensus       508 ~~~~r~~l~~~~di~~vl~~~~g~~~v~~i~l~~~~~~~~~i~~~aF~~m~~L~~L~~~~~~~~~~~~~~~~lp~~~~~l  587 (1153)
T PLN03210        508 EPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYL  587 (1153)
T ss_pred             CCCcceeEeCHHHHHHHHHhCcccceeeEEEeccCccceeeecHHHHhcCccccEEEEecccccccccceeecCcchhhc
Confidence            8999999999999999999988877654                                            11233445


Q ss_pred             C-CccEEEEeCCCCCccCccc----------------------cCCCCCcEEEccCCCCCccCCccc--ccccEEEeecC
Q 041335          191 S-SLTGLHLSGNNFESLPASI----------------------KQLSQLSSLDLKDCKMLQSLPELP--LCLKSLDLMDC  245 (594)
Q Consensus       191 ~-~L~~L~l~~~~l~~lP~~~----------------------~~l~~L~~L~Ls~c~~l~~lP~i~--~~L~~L~L~~c  245 (594)
                      | +||+|+|.+|+++.+|..|                      ..+++|+.|+|++|..++.+|.+.  ++|+.|+|++|
T Consensus       588 p~~Lr~L~~~~~~l~~lP~~f~~~~L~~L~L~~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~ls~l~~Le~L~L~~c  667 (1153)
T PLN03210        588 PPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDC  667 (1153)
T ss_pred             CcccEEEEecCCCCCCCCCcCCccCCcEEECcCccccccccccccCCCCCEEECCCCCCcCcCCccccCCcccEEEecCC
Confidence            5 6888888888877777544                      456677777777766666666632  56666666666


Q ss_pred             CCCcccCCCCC---CccEEEeeCCCCCCcCCCC--CCCccEEeeecCCC-------------------------------
Q 041335          246 KILQSLPALPL---CLESLALTGCNMLRSIPEL--PLCLKYLNLEDCNM-------------------------------  289 (594)
Q Consensus       246 ~~l~~lp~~~~---~L~~L~Ls~c~~l~~lp~~--~~~L~~L~Ls~c~~-------------------------------  289 (594)
                      ..+..+|..+.   +|+.|++++|+.++.+|..  +++|+.|+|++|..                               
T Consensus       668 ~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~i~l~sL~~L~Lsgc~~L~~~p~~~~nL~~L~L~~n~i~~lP~~~~l~  747 (1153)
T PLN03210        668 SSLVELPSSIQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKSFPDISTNISWLDLDETAIEEFPSNLRLE  747 (1153)
T ss_pred             CCccccchhhhccCCCCEEeCCCCCCcCccCCcCCCCCCCEEeCCCCCCccccccccCCcCeeecCCCcccccccccccc
Confidence            66666665544   5555555555555555532  23344444444322                               


Q ss_pred             -------------------------------------------CCCchhhhc---ccccccccccccccccCcc--cccc
Q 041335          290 -------------------------------------------LRSLPELSL---CLQSLNARNCNRLRSLPEI--PSCL  321 (594)
Q Consensus       290 -------------------------------------------~~~L~~l~~---~L~~L~L~~c~~L~~lp~l--~~sL  321 (594)
                                                                 .+.+|....   +|+.|+|++|+.++.+|..  +++|
T Consensus       748 ~L~~L~l~~~~~~~l~~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~~~L~sL  827 (1153)
T PLN03210        748 NLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGINLESL  827 (1153)
T ss_pred             ccccccccccchhhccccccccchhhhhccccchheeCCCCCCccccChhhhCCCCCCEEECCCCCCcCeeCCCCCcccc
Confidence                                                       222222111   4666777777777777654  5667


Q ss_pred             cccccccccccCCCCcccccccCCC-----CC------------------------CC-------C--ceeeccCccccc
Q 041335          322 QELDASVLEKLSKPSLDLIQWAPGC-----LE------------------------SQ-------P--IYFGFTKCLKLN  363 (594)
Q Consensus       322 ~~L~~~~c~~L~~~~~~~~~~~~~~-----~~------------------------~~-------~--~~l~~~nC~~L~  363 (594)
                      +.|++++|..|+.++.....+..+.     +.                        ..       +  ..+.|.+|.+|.
T Consensus       828 ~~L~Ls~c~~L~~~p~~~~nL~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~  907 (1153)
T PLN03210        828 ESLDLSGCSRLRTFPDISTNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALT  907 (1153)
T ss_pred             CEEECCCCCccccccccccccCEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCcccc
Confidence            7777777766665543211111000     00                        00       0  023455666554


Q ss_pred             hhhhhhHHHHHHHHHH-----HH---HHHHhhhhhh---hhhhhccccccceEEEecCCCCCCCccCCCCCceEE-EECC
Q 041335          364 GKANNKILADSLLIIR-----HM---AIASLRLGYE---KAINEKISELRGSLIVLPGGEIPDWFSHQNSGSSIC-IQLP  431 (594)
Q Consensus       364 ~~~~~~i~~~~~~~~~-----~~---~~~~l~~~~~---~~~~~~~~~~~~~~~~~PG~~IP~Wf~~q~~g~sv~-i~lp  431 (594)
                      ...+...-.... .+.     ..   ....+..++.   ....+..  .....+++||.++|+||.||+.|++++ |.+|
T Consensus       908 ~~~l~~~~~~~~-~~~~n~~~~~p~~~~l~f~nC~~L~~~a~l~~~--~~~~~~~l~g~evp~~f~hr~~g~sl~~i~l~  984 (1153)
T PLN03210        908 EASWNGSPSEVA-MATDNIHSKLPSTVCINFINCFNLDQEALLQQQ--SIFKQLILSGEEVPSYFTHRTTGASLTNIPLL  984 (1153)
T ss_pred             cccCCCCchhhh-hhcccccccCCchhccccccccCCCchhhhccc--ccceEEECCCccCchhccCCcccceeeeeccC
Confidence            332221100000 000     00   0000000000   0000000  022357899999999999999999999 9999


Q ss_pred             CCCCCCCceeEEEEEEcccCCCCCCc-eeeEEeeeEEeeccccccccceeeeeeeecCCCCCCCeEEEeeecCCcc----
Q 041335          432 PHSFCRNLIGFAYCAVPDLKQGYSDC-FRYFYVKCQFELEIKTLSETKHVDLGFRVRTKYIYSDHVILGFKPCLNV----  506 (594)
Q Consensus       432 ~~~~~~~~~gfa~c~v~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~sdH~~l~y~~~~~~----  506 (594)
                      +.|++..|.||++|+|+++....... ...+.|.|+|++.+|+...             ....+|+|+.|..+..+    
T Consensus       985 ~~~~~~~~~~f~~c~v~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~-------------~~~~~~~~~~~~~~~~l~~~~ 1051 (1153)
T PLN03210        985 HISPCQPFFRFRACAVVDSESFFIISVSFDIQVCCRFIDRLGNHFD-------------SPYQPHVFSVTKKGSHLVIFD 1051 (1153)
T ss_pred             CcccCCCccceEEEEEEecCccccCCCceeEEEEEEEECCCCCccc-------------cCCCceeEeeeccccceEEec
Confidence            99998899999999999887653322 2478899999988875321             12345555444432111    


Q ss_pred             -------CCC--CCccCcccEEEEEEEecCCceEEEEeecEEEecCCC
Q 041335          507 -------GFP--DGYHHTTATFKFFAECNLKGYKIKRCGVCPVYANPS  545 (594)
Q Consensus       507 -------~~~--~~~~~~~~~~~f~~~~~~~~~~vk~CGv~lvy~~~~  545 (594)
                             +..  .....+.+.|+|.+.......+||+||||++|+++.
T Consensus      1052 ~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~cg~~~~~~~~~ 1099 (1153)
T PLN03210       1052 CCFPLNEDNAPLAELNYDHVDIQFRLTNKNSQLKLKGCGIRLSEDDSS 1099 (1153)
T ss_pred             ccccccccccchhccCCceeeEEEEEecCCCCeEEEeeeEEEeccCCC
Confidence                   000  011233566888886655557999999999997665

syringae 6; Provisional

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		594
3cvr_A		571	Crystal Structure Of The Full Length Ipah3 Length =		6e-14
3g06_A		622	The Salmonella Virulence Effector Ssph2 Functions A		7e-08
1g9u_A		454	Crystal Structure Of Yopm-leucine Rich Effector Pro		3e-07

>pdb|3CVR|A Chain A, Crystal Structure Of The Full Length Ipah3 Length = 571

Back alignment and structure

Iteration: 1

Score = 75.9 bits (185), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 65/167 (38%), Positives = 86/167 (51%), Gaps = 11/167 (6%) Query: 163 WDPKEIRRVLKQKRNCAVMEILQEIACL-SSLTGLHLSGNNFESLPAXXXXXXXXXXXXX 221 WD E + + + RN AV +L+E CL + + L L+ N SLP Sbjct: 33 WDKWEKQALPGENRNEAV-SLLKE--CLINQFSELQLNRLNLSSLPDNLPPQITVLEITQ 89 Query: 222 XXCKMLQSLPELPLCLKSLDLMDCKILQSLPALPLCLESLALTGCNMLRSIPELPLCLKY 281 L SLPELP L+ LD D + L +LP LP L+ L + N L +PELP L+Y Sbjct: 90 ---NALISLPELPASLEYLDACDNR-LSTLPELPASLKHLDVDN-NQLTXLPELPALLEY 144 Query: 282 LNLEDCNMLRSLPELSLCLQSLNARNCNRLRSLPEIPSCLQELDASV 328 +N D N L LPEL L+ L+ RN N+L LPE+P L+ LD S Sbjct: 145 INA-DNNQLTXLPELPTSLEVLSVRN-NQLTFLPELPESLEALDVST 189

PyMOL of 3cvr

>pdb|3G06|A Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase Length = 622

Back alignment and structure

>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		594
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	1e-25
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-23
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	1e-16
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	1e-13
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	9e-06
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-04
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	8e-24
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-22
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	8e-22
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-19
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-06
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	6e-05
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-22
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	7e-22
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	8e-21
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-14
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-13
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-09
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-22
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-21
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	8e-21
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	4e-20
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	6e-20
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	6e-20
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	8e-20
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-18
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-09
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-18
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-17
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	4e-12
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	6e-08
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	4e-18
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	1e-13
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-13
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	5e-11
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-10
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-10
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-08
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	6e-08
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-13
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-07
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	6e-13
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	6e-13
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-10
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	6e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-07
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-05
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	7e-13
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-12
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-12
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	9e-12
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-10
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	4e-04
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-04
1o6v_A		466	Internalin A; bacterial infection, extracellular r	5e-12
1o6v_A		466	Internalin A; bacterial infection, extracellular r	5e-12
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-11
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-11
1o6v_A		466	Internalin A; bacterial infection, extracellular r	7e-11
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	5e-09
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-11
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	1e-11
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	5e-11
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	4e-09
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-11
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	8e-08
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-06
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	2e-11
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	4e-10
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	1e-09
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-09
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	2e-04
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-11
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	9e-11
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-10
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-10
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-09
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	9e-08
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	8e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	9e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-06
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	2e-11
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	4e-10
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	3e-09
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	7e-09
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	8e-07
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	3e-05
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	3e-11
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	4e-11
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	2e-09
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-07
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	8e-07
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	5e-11
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	2e-08
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	2e-08
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	3e-08
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-05
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	6e-11
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	3e-07
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	6e-04
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	7e-11
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	4e-10
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	2e-05
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	8e-11
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-10
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	4e-10
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	6e-10
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	4e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-10
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	8e-10
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-07
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	8e-07
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-05
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	1e-10
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-08
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-08
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-07
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	6e-05
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	2e-10
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	3e-10
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	5e-09
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	2e-08
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	3e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-10
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-10
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-07
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	5e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	8e-04
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-10
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-09
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-09
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	3e-08
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-08
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-07
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	6e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-10
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	7e-10
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-09
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-08
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-08
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	9e-08
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-06
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	5e-10
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	5e-09
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-08
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-04
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	2e-09
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	5e-08
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	2e-09
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	5e-08
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	2e-09
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	3e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	4e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-08
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-07
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-07
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-04
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	3e-09
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	7e-04
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-09
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-09
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-08
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-08
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-08
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	9e-08
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-07
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-07
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	7e-04
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	6e-09
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	5e-08
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	1e-07
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	6e-09
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-07
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-07
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-05
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-04
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	6e-09
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	1e-07
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	4e-07
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	9e-07
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	7e-09
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-08
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-06
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-05
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	7e-05
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	3e-08
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	4e-08
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	8e-08
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	3e-04
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	7e-04
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	4e-08
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	4e-08
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-07
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	9e-05
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-04
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	6e-08
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	5e-07
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	8e-08
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	1e-07
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	4e-07
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	3e-06
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	2e-05
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	1e-07
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	2e-07
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	2e-07
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	2e-05
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	3e-07
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	9e-07
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	3e-06
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	4e-07
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	6e-07
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	5e-07
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	1e-04
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	2e-06
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	3e-06
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	2e-06
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	2e-06
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-05
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	3e-05
3m19_A		251	Variable lymphocyte receptor A diversity region; a	1e-05
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	1e-05
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	2e-05
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	2e-05
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	4e-05
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	4e-05
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	7e-05
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	3e-04
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	4e-05
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	5e-04
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	6e-05
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	9e-04
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	7e-05
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-04
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	1e-04
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	1e-04
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	2e-04
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	7e-04
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	3e-04
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	4e-04
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	4e-04
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	6e-04
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	4e-04
3e6j_A		229	Variable lymphocyte receptor diversity region; var	6e-04
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	7e-04

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

 Score =  110 bits (276), Expect = 1e-25
 Identities = 64/174 (36%), Positives = 94/174 (54%), Gaps = 9/174 (5%)

Query: 154 KQPGKRSRLWDPKEIRRVLKQKRNCAVMEILQEIACLSSLTGLHLSGNNFESLPASIKQL 213
                    WD  E + +  + RN AV  +L+E   ++  + L L+  N  SLP ++   
Sbjct: 24  GTYADYFSAWDKWEKQALPGENRNEAV-SLLKECL-INQFSELQLNRLNLSSLPDNL--P 79

Query: 214 SQLSSLDLKDCKMLQSLPELPLCLKSLDLMDCKILQSLPALPLCLESLALTGCNMLRSIP 273
            Q++ L++     L SLPELP  L+ LD  D + L +LP LP  L+ L +   N L  +P
Sbjct: 80  PQITVLEITQNA-LISLPELPASLEYLDACDNR-LSTLPELPASLKHLDVDN-NQLTMLP 136

Query: 274 ELPLCLKYLNLEDCNMLRSLPELSLCLQSLNARNCNRLRSLPEIPSCLQELDAS 327
           ELP  L+Y+N ++ N L  LPEL   L+ L+ RN N+L  LPE+P  L+ LD S
Sbjct: 137 ELPALLEYINADN-NQLTMLPELPTSLEVLSVRN-NQLTFLPELPESLEALDVS 188

PyMOL of 3cvr

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		594
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	99.77
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	99.63
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.59
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.56
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	99.55
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	99.43
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.3
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.3
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.28
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.28
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.26
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.23
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.22
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.19
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.19
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.19
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.17
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.16
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.15
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.14
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.14
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.13
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.13
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.13
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.12
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.12
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.12
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.12
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.12
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.1
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.09
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.09
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.08
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.08
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.07
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.07
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.07
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.07
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.06
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.05
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.05
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.05
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.04
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.04
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.04
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.03
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.03
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.03
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.02
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.02
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.02
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.0
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.0
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.0
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.0
3m19_A		251	Variable lymphocyte receptor A diversity region; a	98.99
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	98.99
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	98.99
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	98.98
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	98.98
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	98.98
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	98.98
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	98.98
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	98.97
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	98.97
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	98.96
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	98.96
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	98.96
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	98.95
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	98.95
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	98.94
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	98.94
3e6j_A		229	Variable lymphocyte receptor diversity region; var	98.94
3m19_A		251	Variable lymphocyte receptor A diversity region; a	98.94
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	98.93
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	98.93
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	98.93
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	98.93
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	98.92
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	98.92
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	98.92
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	98.9
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	98.9
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	98.9
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.89
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	98.88
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	98.88
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	98.88
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	98.88
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	98.87
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	98.86
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	98.85
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	98.85
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	98.85
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	98.84
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	98.83
3e6j_A		229	Variable lymphocyte receptor diversity region; var	98.82
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	98.82
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	98.81
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	98.81
1o6v_A		466	Internalin A; bacterial infection, extracellular r	98.79
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	98.79
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	98.78
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	98.77
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	98.76
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	98.76
1o6v_A		466	Internalin A; bacterial infection, extracellular r	98.76
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	98.75
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.75
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	98.74
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	98.68
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.68
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	98.68
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	98.67
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	98.67
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.65
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.63
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	98.61
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	98.61
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	98.57
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	98.52
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	98.48
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	98.47
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	98.45
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.44
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.42
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.37
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.36
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.35
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.34
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	98.33
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.3
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	98.21
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.2
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.15
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	98.11
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	98.08
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.07
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.02
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	97.98
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	97.88
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	97.87
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	97.8
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	97.6
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	97.53
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	97.4
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.33
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.25
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.21
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	97.16
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	97.11
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	96.81
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	96.71
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	96.12
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	95.78
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	95.62
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	92.1
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	91.64
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	91.55
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	87.88
2qen_A		350	Walker-type ATPase; unknown function; HET: ADP; 2.	87.75
2fna_A		357	Conserved hypothetical protein; structural genomic	86.18
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	82.34
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	81.48
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	80.06

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

Probab=99.77  E-value=2e-19  Score=199.56  Aligned_cols=147  Identities=12%  Similarity=0.142  Sum_probs=115.4

Q ss_pred             CHhHHhhhhcCCCCCChhHHHHHHHHHHHhCCChHHHHHHHccCC-CHHHHHHHHHH-hhhhcCCChhhHHHHHHHhhcC
Q 041335            1 AFEHFCNFAFKENHCPEDFKRDSRRVVKYADGNPLVLKVLGSSLK-RKSHWGNVLDD-LNRICESDIHNIYDILKISFNE   78 (594)
Q Consensus         1 a~~LF~~~AF~~~~~~~~~~~l~~~iv~~c~GlPLAlkvlgs~L~-~~~~W~~~l~~-l~~~~~~~i~~~~~~L~~Syd~   78 (594)
                      ||+||+++||+... ++++++++++|+++|+|+||||+++|+.|+ ...+|...+.. ++..+...+   ..+|++||++
T Consensus       298 a~~Lf~~~a~~~~~-~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~~w~~~~~l~~~l~~~~~~~i---~~~l~~Sy~~  373 (549)
T 2a5y_B          298 CYDFLEAYGMPMPV-GEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGV---ECITPYSYKS  373 (549)
T ss_dssp             HHHHHHHTSCCCC---CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHCSSTT---CCCSSSSSSS
T ss_pred             HHHHHHHHhcCCCC-chhHHHHHHHHHHHhCCChHHHHHHHHHhccchHHHHHHhHHHhhcccHHHH---HHHHhccccc
Confidence            68999999998643 478999999999999999999999999999 42233333332 222244555   8899999999


Q ss_pred             CCHhHHhHhh-----------hhccccCCCChhHHHHHhhhh----------------hhhhhhHHhhcCCceecccCCC
Q 041335           79 LTPRVKSIFL-----------DIACFFEGEDKDFLARILDDS----------------ESDGLDVLIDKSLISISEKWAD  131 (594)
Q Consensus        79 L~~~~K~~Fl-----------~~a~Fp~~~~~~~v~~~l~~~----------------~~~~i~~Lv~~sli~~~~~~~~  131 (594)
                      ||.++|.||+           |||+||++++++  +++|.+.                +..++++|+++||++.......
T Consensus       374 L~~~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~--i~~w~a~~~G~i~~~~~~~~~~~~~~~l~~L~~rsLl~~~~~~~~  451 (549)
T 2a5y_B          374 LAMALQRCVEVLSDEDRSALAFAVVMPPGVDIP--VKLWSCVIPVDICSNEEEQLDDEVADRLKRLSKRGALLSGKRMPV  451 (549)
T ss_dssp             HHHHHHHHHHTSCHHHHHHTTGGGSSCTTCCEE--HHHHHHHSCC-------CCCTHHHHHHHHHTTTBSSCSEEECSSS
T ss_pred             ccHHHHHHHhccchhhhhHhhheeeeCCCCeee--eeeeeeeccceeccCCCCCCHHHHHHHHHHHHHcCCeeEecCCCc
Confidence            9999999999           999999999887  4444332                1238999999999998754334


Q ss_pred             CeEEecHHHHHHHHHHHhhccc
Q 041335          132 KLLQMHDILQEMGREIVRQESE  153 (594)
Q Consensus       132 ~~~~mHdLl~~~~~~i~~~e~~  153 (594)
                      .+++|||++|++|++++.+++.
T Consensus       452 ~~~~mHdlv~~~a~~~~~~~~~  473 (549)
T 2a5y_B          452 LTFKIDHIIHMFLKHVVDAQTI  473 (549)
T ss_dssp             CEEECCHHHHHHHHTTSCTHHH
T ss_pred             eEEEeChHHHHHHHHHHHHHHH
Confidence            5799999999999999877653

PyMOL of 2a5y

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi}	Back alignment and structure

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		594
d2a5yb3		277	c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor	4e-11
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	5e-10
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	5e-08
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-07
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-05
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	4e-04
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	5e-04
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	0.003
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-07
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	4e-07
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-04
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	4e-05
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	1e-04
d1xwdc1		242	c.10.2.7 (C:18-259) Follicle-stimulating hormone r	0.002
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	0.003

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 61.8 bits (149), Expect = 4e-11
 Identities = 11/87 (12%), Positives = 31/87 (35%), Gaps = 2/87 (2%)

Query: 1   AFEHFCNFAFKENHCPEDFKRDSRRVVKYADGNPLVLKVLGSSLKRKSHWGNVLDDLNRI 60
            ++    +        E  +    + ++ + GNP  L +   S + K+ +  +    N++
Sbjct: 190 CYDFLEAYGMPM-PVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKT-FEKMAQLNNKL 247

Query: 61  CESDIHNIYDILKISFNELTPRVKSIF 87
               +  +  I   S+  L   ++   
Sbjct: 248 ESRGLVGVECITPYSYKSLAMALQRCV 274

PyMOL of d2a5yb3

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		594
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	99.36
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.34
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.13
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.08
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.07
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.04
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.02
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.01
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.99
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.98
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.93
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	98.92
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	98.91
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	98.89
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	98.75
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.75
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	98.71
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	98.7
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	98.69
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	98.67
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	98.66
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	98.65
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	98.63
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	98.61
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	98.58
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	98.57
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	98.5
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	98.48
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.35
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.35
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.31
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.3
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.25
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	95.83
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	95.43
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	95.24
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	95.23
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	94.64
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	93.46
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	90.26
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	83.3

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.36  E-value=1e-13  Score=137.51  Aligned_cols=85  Identities=11%  Similarity=0.111  Sum_probs=75.7

Q ss_pred             CHhHHhhhhcCCCCCChhHHHHHHHHHHHhCCChHHHHHHHccCC--CHHHHHHHHHHhhhhcCCChhhHHHHHHHhhcC
Q 041335            1 AFEHFCNFAFKENHCPEDFKRDSRRVVKYADGNPLVLKVLGSSLK--RKSHWGNVLDDLNRICESDIHNIYDILKISFNE   78 (594)
Q Consensus         1 a~~LF~~~AF~~~~~~~~~~~l~~~iv~~c~GlPLAlkvlgs~L~--~~~~W~~~l~~l~~~~~~~i~~~~~~L~~Syd~   78 (594)
                      ||+||+++||+...++ ..++++++||++|+|+||||+++|+.|+  +.++|.+..++|.......+   ..+|++||++
T Consensus       190 a~~Lf~~~~~~~~~~~-~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~~L~~~~~~~v---~~il~~sY~~  265 (277)
T d2a5yb3         190 CYDFLEAYGMPMPVGE-KEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGV---ECITPYSYKS  265 (277)
T ss_dssp             HHHHHHHTSCCCC--C-HHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHCSSTT---CCCSSSSSSS
T ss_pred             HHHHHHHHhCCccCch-hhHHHHHHHHHHhCCCHHHHHHHHHHhccCCHHHHHHHHHHHhcCcHHHH---HHHHHHHHhc
Confidence            6999999999876544 5689999999999999999999999999  88899999999988777777   8999999999


Q ss_pred             CCHhHHhHhhh
Q 041335           79 LTPRVKSIFLD   89 (594)
Q Consensus        79 L~~~~K~~Fl~   89 (594)
                      ||+++|.||-+
T Consensus       266 L~~~lk~c~~~  276 (277)
T d2a5yb3         266 LAMALQRCVEV  276 (277)
T ss_dssp             HHHHHHHHHHT
T ss_pred             ccHHHHHHHHh
Confidence            99999999965

PyMOL of d2a5yb3

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure