Citrus Sinensis ID: 041358

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------

YLTISPGQIIDVLIKANQIPNKYYMSAKAHSSATDVYDDNTTTTAIVQYEGLYPSSKTPLPNLPSYDDTKASVKVLEYNTAVEIVFQGTDLLAGTDHPMHLHGYSFYVVGGGFGNFDRAKDAKRFNFVEPSLQNTIMVPKNVNGPKTFKCPKITCHEQALIHMNMCLHAWVLTDTCHKKRAWFVHCHLDHHQSWAMQMAFIVKNDRCAKAKMLPPLCELYKLCHKG

cEEEcccccccccccccccccccHHHHHHcccccccccccccccccEEcccccccccccccccccccccccEEEEEEcccEEEEEEEcccccccccccEEEccccEEEEEcccccccccccccccccccccccccEEEcccccccccccccccccccHHHHccccccEEEEEEEEccccEEEEEEEHHHHHHHHccEEEEEEEccccccccccccccccccccccc

cEEEccccccEEEEEccccccHHHHHHHHHHcccccccccccccccEEEccccccccccccccccccccccEEEEEEcccEEEEEEEcccEEccccccEEEcccEEEEEEcccccccccccccccccccccccccEEcccccEEEEEEccccHHHHHHHHHHHHHHHcEEEEEEEcccccEEEEEccHHHHHHHHHHEEEEEcccccccccccccccccccccccc

yltispgqIIDVLIKAnqipnkyymsakahssatdvyddnttTTAIVQYeglypssktplpnlpsyddtkaSVKVLEYNTAVEIVFQgtdllagtdhpmhlhgySFYVvgggfgnfdrakdakrfnfvepslqntimvpknvngpktfkcpkitcHEQALIHMNMCLHAWVltdtchkkrawfvhchldHHQSWAMQMAFIVKNDrcakakmlpplcelyklchkg

yltispgqiIDVLIKANQIPNKYYMSAKAHSSATDVYDDNTTTTAIVQYEglypssktplpnlpSYDDTKASVKVLEYNTAVEIVFQGTDLLAGTDHPMHLHGYSFYVVGGGFGNFDRAKDAKRFNfvepslqntimvpknvngPKTFKCPKITCHEQALIHMNMCLHAWVLTDTCHKKRAWFVHCHLDHHQSWAMQMAFIVKNDRCAKAKMLPPLCELYKLCHKG

YLTISPGQIIDVLIKANQIPNKYYMSAKAHSSATDVYDDNTTTTAIVQYEGLYPSSKTPLPNLPSYDDTKASVKVLEYNTAVEIVFQGTDLLAGTDHPMHLHgysfyvvgggfgNFDRAKDAKRFNFVEPSLQNTIMVPKNVNGPKTFKCPKITCHEQALIHMNMCLHAWVLTDTCHKKRAWFVHCHLDHHQSWAMQMAFIVKNDRCAKAKMLPPLCELYKLCHKG

******GQIIDVLIKANQIPNKYYMSAKAHSSATDVYDDNTTTTAIVQYEGLYP***********YDDTKASVKVLEYNTAVEIVFQGTDLLAGTDHPMHLHGYSFYVVGGGFGNFDRAKDAKRFNFVEPSLQNTIMVPKNVNGPKTFKCPKITCHEQALIHMNMCLHAWVLTDTCHKKRAWFVHCHLDHHQSWAMQMAFIVKNDRCAKAKMLPPLCELYKLC***

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		226	2.2.26 [Sep-21-2011]
Q9FY79		569	Laccase-14 OS=Arabidopsis	yes	no	0.579	0.230	0.364	6e-26
Q9LMS3		581	Laccase-1 OS=Arabidopsis	no	no	0.522	0.203	0.388	2e-24
Q6Z8L2		579	Putative laccase-9 OS=Ory	yes	no	0.690	0.269	0.338	2e-24
Q84J37		565	Laccase-15 OS=Arabidopsis	no	no	0.473	0.189	0.405	4e-24
Q9FJD5		577	Laccase-17 OS=Arabidopsis	no	no	0.544	0.213	0.370	4e-24
Q7XE50		467	Putative laccase-16 OS=Or	yes	no	0.5	0.241	0.394	6e-24
Q5ZCW1		577	Putative laccase-1 OS=Ory	yes	no	0.716	0.280	0.341	8e-24
Q5N9X2		579	Laccase-4 OS=Oryza sativa	no	no	0.579	0.226	0.347	2e-23
Q2QZ80		583	Laccase-21 OS=Oryza sativ	no	no	0.606	0.234	0.352	4e-23
O81081		573	Laccase-2 OS=Arabidopsis	no	no	0.539	0.212	0.366	4e-23

>sp\|Q9FY79\|LAC14_ARATH Laccase-14 OS=Arabidopsis thaliana GN=LAC14 PE=2 SV=1	Back alignment and function desciption

 Score =  117 bits (293), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 81/159 (50%), Gaps = 28/159 (17%)

Query: 62  NLPSYDDTKASVKVLEYNTAVEIVFQGTDLLAGTDHPMHLHGYSFYVVGGGFGNFDRAKD 121
           NLP        V VL+YN++VE++ QGT + A   HP+HLHGY+FYVVG GFGNFDR KD
Sbjct: 435 NLPFPTRFGTKVVVLDYNSSVELILQGTTVWASNIHPIHLHGYNFYVVGSGFGNFDRRKD 494

Query: 122 AKRFNFVEPSLQNTIMVPKNVNGPKTFKCPKITCHEQALIHMNMCLHAWVLTD-TCHKKR 180
             R+N V+P  + T+ VP+N                            W       +   
Sbjct: 495 PLRYNLVDPPEETTVGVPRN---------------------------GWTAVRFVANNPG 527

Query: 181 AWFVHCHLDHHQSWAMQMAFIVKNDRCAKAKMLPPLCEL 219
            W +HCH++ H +W M   FIVK+     ++M+ P  +L
Sbjct: 528 VWLLHCHIERHATWGMNTVFIVKDGPTKSSRMVKPPPDL 566

Lignin degradation and detoxification of lignin-derived products.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 0EC: .EC: 3EC: .EC: 2

>sp\|Q9LMS3\|LAC1_ARATH Laccase-1 OS=Arabidopsis thaliana GN=LAC1 PE=2 SV=1	Back alignment and function description

>sp\|Q6Z8L2\|LAC9_ORYSJ Putative laccase-9 OS=Oryza sativa subsp. japonica GN=LAC9 PE=3 SV=1	Back alignment and function description

>sp\|Q84J37\|LAC15_ARATH Laccase-15 OS=Arabidopsis thaliana GN=TT10 PE=1 SV=1	Back alignment and function description

>sp\|Q9FJD5\|LAC17_ARATH Laccase-17 OS=Arabidopsis thaliana GN=LAC17 PE=2 SV=1	Back alignment and function description

>sp\|Q7XE50\|LAC16_ORYSJ Putative laccase-16 OS=Oryza sativa subsp. japonica GN=LAC16 PE=5 SV=1	Back alignment and function description

>sp\|Q5ZCW1\|LAC1_ORYSJ Putative laccase-1 OS=Oryza sativa subsp. japonica GN=LAC1 PE=3 SV=1	Back alignment and function description

>sp\|Q5N9X2\|LAC4_ORYSJ Laccase-4 OS=Oryza sativa subsp. japonica GN=LAC4 PE=2 SV=1	Back alignment and function description

>sp\|Q2QZ80\|LAC21_ORYSJ Laccase-21 OS=Oryza sativa subsp. japonica GN=LAC21 PE=2 SV=1	Back alignment and function description

>sp\|O81081\|LAC2_ARATH Laccase-2 OS=Arabidopsis thaliana GN=LAC2 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		226
147787211		227	hypothetical protein VITISV_032561 [Viti	0.747	0.744	0.414	3e-39
359495139		563	PREDICTED: laccase-14 [Vitis vinifera]	0.535	0.214	0.517	3e-35
224085288		565	predicted protein [Populus trichocarpa]	0.508	0.203	0.524	2e-34
359495131		565	PREDICTED: LOW QUALITY PROTEIN: laccase-	0.681	0.272	0.451	9e-34
224085286		518	predicted protein [Populus trichocarpa]	0.504	0.220	0.528	2e-33
359497766		359	PREDICTED: laccase-14-like, partial [Vit	0.535	0.337	0.482	2e-33
359493265		660	PREDICTED: putative laccase-9-like [Viti	0.592	0.203	0.462	3e-33
359496819		565	PREDICTED: laccase-14-like [Vitis vinife	0.535	0.214	0.482	3e-33
225462386		565	PREDICTED: laccase-14-like [Vitis vinife	0.557	0.223	0.467	6e-33
296080996		231	unnamed protein product [Vitis vinifera]	0.592	0.580	0.462	7e-33

>gi\|147787211\|emb\|CAN75766.1\| hypothetical protein VITISV_032561 [Vitis vinifera]	Back alignment and taxonomy information

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 95/229 (41%), Positives = 121/229 (52%), Gaps = 60/229 (26%)

Query: 1   YLTISPGQIIDVLIKANQIPNKYYMSAKAHSSATDVYDDNTTTTAIVQYEGLYPSSKTPL 60
           Y+TI PGQ  DVL++ANQ P+ YYM+     S+     D                     
Sbjct: 46  YITIFPGQTYDVLLEANQRPDHYYMTGYYTPSSPPSSPD--------------------- 84

Query: 61  PNLPSYDDTKASV---------KVLEYNTAVEIVFQGTDLLAGTDHPMHLHGYSFYVVGG 111
             LP+Y+DTKASV         +VLEYN+ VEI+ QGT +LA T HPMHLHGYSFYVVG 
Sbjct: 85  --LPAYNDTKASVQLSSSGTEVRVLEYNSTVEIILQGTAVLAKTHHPMHLHGYSFYVVGW 142

Query: 112 GFGNFDRAKDAKRFNFVEPSLQNTIMVPKNVNGPKTFKCPKITCHEQALIHMNMCLHAWV 171
           GFGNFD  +D  R+N V+P LQNTI VP N                            WV
Sbjct: 143 GFGNFDGNRDPLRYNLVDPPLQNTIFVPSN---------------------------GWV 175

Query: 172 -LTDTCHKKRAWFVHCHLDHHQSWAMQMAFIVKNDRCAKAKMLPPLCEL 219
            +         WF+HCH++ H +W M+ AFIVKN +  +A+MLPP  ++
Sbjct: 176 AIRFKASNPGVWFMHCHIERHLTWGMETAFIVKNGKHPEAQMLPPPSDM 224

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|359495139\|ref\|XP_002264394.2\| PREDICTED: laccase-14 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224085288\|ref\|XP_002307537.1\| predicted protein [Populus trichocarpa] gi\|222856986\|gb\|EEE94533.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|359495131\|ref\|XP_003634921.1\| PREDICTED: LOW QUALITY PROTEIN: laccase-14-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224085286\|ref\|XP_002307536.1\| predicted protein [Populus trichocarpa] gi\|222856985\|gb\|EEE94532.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|359497766\|ref\|XP_003635635.1\| PREDICTED: laccase-14-like, partial [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359493265\|ref\|XP_002268847.2\| PREDICTED: putative laccase-9-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359496819\|ref\|XP_003635347.1\| PREDICTED: laccase-14-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225462386\|ref\|XP_002264702.1\| PREDICTED: laccase-14-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|296080996\|emb\|CBI18500.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		226
TAIR\|locus:2184802		569	LAC14 "laccase 14" [Arabidopsi	0.327	0.130	0.52	2e-35
TAIR\|locus:2153469		565	LAC12 "laccase 12" [Arabidopsi	0.300	0.120	0.485	1.1e-31
TAIR\|locus:2063109		580	LAC5 "laccase 5" [Arabidopsis	0.300	0.117	0.444	2.7e-24
TAIR\|locus:2060879		570	LAC3 "laccase 3" [Arabidopsis	0.296	0.117	0.453	8.1e-24
TAIR\|locus:2042842		558	IRX12 "IRREGULAR XYLEM 12" [Ar	0.318	0.129	0.388	2.1e-21
TAIR\|locus:2154518		566	LAC16 "laccase 16" [Arabidopsi	0.283	0.113	0.406	6.6e-20
TAIR\|locus:2194110		581	LAC1 "laccase 1" [Arabidopsis	0.283	0.110	0.421	2.8e-19
TAIR\|locus:2162677		565	TT10 "TRANSPARENT TESTA 10" [A	0.353	0.141	0.360	2.8e-17
TAIR\|locus:2083604		567	LAC7 "laccase 7" [Arabidopsis	0.407	0.162	0.333	6.7e-17
TAIR\|locus:2150049		586	AT5G01050 [Arabidopsis thalian	0.535	0.206	0.295	1.5e-16

TAIR\|locus:2184802 LAC14 "laccase 14" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 178 (67.7 bits), Expect = 2.0e-35, Sum P(3) = 2.0e-35
 Identities = 39/75 (52%), Positives = 53/75 (70%)

Query:     1 YLTISPGQIIDVLIKANQIPNKYYMSAKAHSSATDVYDDNTTTTAIVQYEGLYPSSKTP- 59
             YL I+PGQ +DVL+ ANQ PN Y+++A+A+SSA     D TTTTAI+QY+G   +   P 
Sbjct:   269 YLMITPGQSMDVLLHANQRPNHYFVAARAYSSAFGAGFDKTTTTAILQYKGDTLNRIKPI 328

Query:    60 LPNLPSYDDTKASVK 74
             LP LP Y+ T+AS +
Sbjct:   329 LPYLPPYNRTEASTR 343

GO:0005507 "copper ion binding" evidence=IEA

GO:0005576 "extracellular region" evidence=ISM

GO:0016491 "oxidoreductase activity" evidence=IEA

GO:0046274 "lignin catabolic process" evidence=IEA

GO:0048046 "apoplast" evidence=IEA

GO:0052716 "hydroquinone:oxygen oxidoreductase activity" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

TAIR\|locus:2153469 LAC12 "laccase 12" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2063109 LAC5 "laccase 5" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2060879 LAC3 "laccase 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2042842 IRX12 "IRREGULAR XYLEM 12" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2154518 LAC16 "laccase 16" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2194110 LAC1 "laccase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2162677 TT10 "TRANSPARENT TESTA 10" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2083604 LAC7 "laccase 7" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2150049 AT5G01050 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		226
TIGR03389		539	TIGR03389, laccase, laccase, plant	2e-40
pfam07731		135	pfam07731, Cu-oxidase_2, Multicopper oxidase	1e-22
TIGR03389		539	TIGR03389, laccase, laccase, plant	7e-18
TIGR03388		541	TIGR03388, ascorbase, L-ascorbate oxidase, plant t	5e-13
PLN02604		566	PLN02604, PLN02604, oxidoreductase	1e-11
PLN02191		574	PLN02191, PLN02191, L-ascorbate oxidase	5e-11
TIGR03390		538	TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fu	4e-10
pfam00394		146	pfam00394, Cu-oxidase, Multicopper oxidase	2e-06
PLN02168		545	PLN02168, PLN02168, copper ion binding / pectinest	3e-04
PLN02354		552	PLN02354, PLN02354, copper ion binding / oxidoredu	4e-04
PLN02991		543	PLN02991, PLN02991, oxidoreductase	0.002
PLN02835		539	PLN02835, PLN02835, oxidoreductase	0.003

>gnl\|CDD\|234194 TIGR03389, laccase, laccase, plant	Back alignment and domain information

 Score =  144 bits (365), Expect = 2e-40
 Identities = 61/164 (37%), Positives = 85/164 (51%), Gaps = 39/164 (23%)

Query: 58  TPLP-NLPSYDDTKASVKVLEYNTAVEIVFQGTDLLAGTDHPMHLHGYSFYVVGGGFGNF 116
           T LP NL + + TK  V  L++N+ VE+V Q T +L   +HP+HLHGY+F+VVG GFGNF
Sbjct: 402 TNLPNNLFTTNGTK--VVRLKFNSTVELVLQDTSILGSENHPIHLHGYNFFVVGTGFGNF 459

Query: 117 DRAKDAKRFNFVEPSLQNTIMVPKNVNGPKTFKCPKITCHEQALIHMNMCLHAWVLTDTC 176
           D  KD  +FN V+P  +NT+ VP                              W      
Sbjct: 460 DPKKDPAKFNLVDPPERNTVGVPTG---------------------------GWAAI--- 489

Query: 177 HKKRA-----WFVHCHLDHHQSWAMQMAFIVKNDRCAKAKMLPP 215
            +  A     WF+HCHL+ H +W ++MAF+V N +     +LPP
Sbjct: 490 -RFVADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNQSLLPP 532

Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate. Length = 539

>gnl\|CDD\|219541 pfam07731, Cu-oxidase_2, Multicopper oxidase	Back alignment and domain information

>gnl\|CDD\|234194 TIGR03389, laccase, laccase, plant	Back alignment and domain information

>gnl\|CDD\|234193 TIGR03388, ascorbase, L-ascorbate oxidase, plant type	Back alignment and domain information

>gnl\|CDD\|215324 PLN02604, PLN02604, oxidoreductase	Back alignment and domain information

>gnl\|CDD\|177843 PLN02191, PLN02191, L-ascorbate oxidase	Back alignment and domain information

>gnl\|CDD\|132431 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fungal type	Back alignment and domain information

>gnl\|CDD\|215896 pfam00394, Cu-oxidase, Multicopper oxidase	Back alignment and domain information

>gnl\|CDD\|215113 PLN02168, PLN02168, copper ion binding / pectinesterase	Back alignment and domain information

>gnl\|CDD\|177987 PLN02354, PLN02354, copper ion binding / oxidoreductase	Back alignment and domain information

>gnl\|CDD\|215536 PLN02991, PLN02991, oxidoreductase	Back alignment and domain information

>gnl\|CDD\|178429 PLN02835, PLN02835, oxidoreductase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		226
PLN02792		536	oxidoreductase	100.0
PLN02991		543	oxidoreductase	100.0
PLN00044		596	multi-copper oxidase-related protein; Provisional	100.0
TIGR03389		539	laccase laccase, plant. Members of this protein fa	100.0
PLN02835		539	oxidoreductase	100.0
KOG1263		563	consensus Multicopper oxidases [Secondary metaboli	100.0
PLN02168		545	copper ion binding / pectinesterase	100.0
PLN02354		552	copper ion binding / oxidoreductase	100.0
TIGR03388		541	ascorbase L-ascorbate oxidase, plant type. Members	100.0
PLN02191		574	L-ascorbate oxidase	100.0
PLN02604		566	oxidoreductase	100.0
TIGR03390		538	ascorbOXfungal L-ascorbate oxidase, fungal type. T	100.0
PF07731		138	Cu-oxidase_2: Multicopper oxidase; InterPro: IPR01	99.96
PRK10965		523	multicopper oxidase; Provisional	99.92
TIGR01480		587	copper_res_A copper-resistance protein, CopA famil	99.92
PRK10883		471	FtsI repressor; Provisional	99.89
COG2132		451	SufI Putative multicopper oxidases [Secondary meta	99.87
TIGR02376		311	Cu_nitrite_red nitrite reductase, copper-containin	99.07
PLN02604		566	oxidoreductase	98.9
PF07732		117	Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01	98.72
TIGR02376		311	Cu_nitrite_red nitrite reductase, copper-containin	98.59
TIGR03388		541	ascorbase L-ascorbate oxidase, plant type. Members	98.53
PF00394		159	Cu-oxidase: Multicopper oxidase; InterPro: IPR0011	98.21
TIGR03095		148	rusti_cyanin rusticyanin. Rusticyanin is a blue co	98.07
PLN02191		574	L-ascorbate oxidase	98.01
TIGR01480		587	copper_res_A copper-resistance protein, CopA famil	97.91
TIGR03389		539	laccase laccase, plant. Members of this protein fa	97.72
PLN02835		539	oxidoreductase	97.69
PLN02168		545	copper ion binding / pectinesterase	97.62
PLN02792		536	oxidoreductase	97.53
PRK10965		523	multicopper oxidase; Provisional	97.5
PLN02354		552	copper ion binding / oxidoreductase	97.45
PLN00044		596	multi-copper oxidase-related protein; Provisional	97.25
PRK10883		471	FtsI repressor; Provisional	97.19
PLN02991		543	oxidoreductase	96.88
TIGR03390		538	ascorbOXfungal L-ascorbate oxidase, fungal type. T	96.86
TIGR02656		99	cyanin_plasto plastocyanin. Members of this family	96.86
PF00127		99	Copper-bind: Copper binding proteins, plastocyanin	96.03
TIGR03096		135	nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de	95.64
KOG1263		563	consensus Multicopper oxidases [Secondary metaboli	95.53
PRK02888		635	nitrous-oxide reductase; Validated	95.02
PF13473		104	Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D	93.86
PRK02710		119	plastocyanin; Provisional	92.77
COG2132		451	SufI Putative multicopper oxidases [Secondary meta	92.56
TIGR02375		116	pseudoazurin pseudoazurin. Pseudoazurin, also call	90.45
COG4454		158	Uncharacterized copper-binding protein [Inorganic	88.37
TIGR03102		115	halo_cynanin halocyanin domain. Halocyanins are bl	87.38
PF06525		196	SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb	86.86
TIGR02657		83	amicyanin amicyanin. Members of this family are am	86.46
TIGR03094		195	sulfo_cyanin sulfocyanin. Members of this family a	83.89

>PLN02792 oxidoreductase	Back alignment and domain information

Probab=100.00  E-value=1.3e-44  Score=347.51  Aligned_cols=188  Identities=21%  Similarity=0.295  Sum_probs=153.3

Q ss_pred             CEEeccCceEEEEEEeCCCCCeeEEEEEeccCCCccCCCCCceEEEEEecCCCCCC--CCCC------------------
Q 041358            1 YLTISPGQIIDVLIKANQIPNKYYMSAKAHSSATDVYDDNTTTTAIVQYEGLYPSS--KTPL------------------   60 (226)
Q Consensus         1 ~l~I~pGQRydVLV~a~~~pg~Y~ira~~~~~~~~~~~~~~~~~AILrY~g~~p~~--~~~l------------------   60 (226)
                      .|.|++||||||||++++++|+|||++.+...+     .+..++|||+|.|+....  .+.+                  
T Consensus       242 ~l~i~~GqRydVlV~a~~~~g~Y~i~a~~~~~~-----~~~~~~ail~Y~g~~~~~~~~p~~p~~~~~~~~~~~~~~~~~  316 (536)
T PLN02792        242 SLDIHVGQTYSVLVTMDQPPQNYSIVVSTRFIA-----AKVLVSSTLHYSNSKGHKIIHARQPDPDDLEWSIKQAQSIRT  316 (536)
T ss_pred             EEEEccCceEEEEEEcCCCCceEEEEEEeccCC-----CCCceEEEEEECCCCCCCCCCCCCCCcCCccccccchhhhhh
Confidence            378999999999999999889999999876432     235788999998753210  0000                  


Q ss_pred             ------C-CCCC-----------C-------------------CCC----------------------------------
Q 041358           61 ------P-NLPS-----------Y-------------------DDT----------------------------------   69 (226)
Q Consensus        61 ------P-~~p~-----------~-------------------~d~----------------------------------   69 (226)
                            | ..|.           .                   |+.                                  
T Consensus       317 ~l~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iN~~s~~~p~~p~L~a~~~~~~g~~~~~~~~~~p~~~~  396 (536)
T PLN02792        317 NLTASGPRTNPQGSYHYGKMKISRTLILESSAALVKRKQRYAINGVSFVPSDTPLKLADHFKIKGVFKVGSIPDKPRRGG  396 (536)
T ss_pred             ccCCCCCCCCCCcccccceeccceeEEecccccccCceeEEEECCcccCCCCCchhhhhhhccCCCcCcccCccCCcccC
Confidence                  0 0110           0                   000                                  


Q ss_pred             ----cceEEEeecCCEEEEEEEcCCCCCCcCcceeecCceEEEEecCCCCCCCccccccCCCCCCCccceEEcCCCCCCC
Q 041358           70 ----KASVKVLEYNTAVEIVFQGTDLLAGTDHPMHLHGYSFYVVGGGFGNFDRAKDAKRFNFVEPSLQNTIMVPKNVNGP  145 (226)
Q Consensus        70 ----~~~~~~~~~g~~v~iv~~n~~~~~~~~HP~HlHG~~f~vv~~g~g~~~~~~~~~~~n~~~p~~rDtv~v~~~~~~~  145 (226)
                          ..+++.+++|++|||+|+|.   ....||||||||+||||++|.|.|++. +...+|+.+|++|||+.|+++    
T Consensus       397 ~~~~~~~v~~~~~~~~VeiViqn~---~~~~HP~HLHGh~F~Vvg~G~G~~~~~-~~~~~Nl~nP~~RdTv~v~~~----  468 (536)
T PLN02792        397 GMRLDTSVMGAHHNAFLEIIFQNR---EKIVQSYHLDGYNFWVVGINKGIWSRA-SRREYNLKDAISRSTTQVYPE----  468 (536)
T ss_pred             CCccCceEEEcCCCCEEEEEEECC---CCCCCCeeeCCCceEEEeecCCCCCcc-cccccCcCCCCccceEEECCC----
Confidence                01245688999999999997   356899999999999999999999874 456799999999999999999    


Q ss_pred             CCCCCCcccchhhhhhhccccceeEEEEE-eCCCCeeEEEeecchhhhhccceeEEEEEcCcccccccCCCchhHhhccc
Q 041358          146 KTFKCPKITCHEQALIHMNMCLHAWVLTD-TCHKKRAWFVHCHLDHHQSWAMQMAFIVKNDRCAKAKMLPPLCELYKLCH  224 (226)
Q Consensus       146 ~~~~~~~~~~~~~~~~~~~~~~~~~~~ir-~adnpG~W~~HCHi~~H~~~Gm~~~~~v~~~~~~~~~~~~~p~~~~~~~~  224 (226)
                                             ||++|| ++||||+|+||||+.+|+.+||+++|+|+++....+++.+||.+++.|+.
T Consensus       469 -----------------------gw~aIRf~aDNPGvW~~HCh~~~h~~~Gm~~~~~v~~~~~~~~~~~~pP~~~~~Cg~  525 (536)
T PLN02792        469 -----------------------SWTAVYVALDNVGMWNLRSQFWARQYLGQQFYLRVYSPTHSLKDEYPLPKNALLCGR  525 (536)
T ss_pred             -----------------------CEEEEEEEeeCCEEEeeeEcchhccccceEEEEEEccCCCccccccCCCcccCcccc
Confidence                                   999999 99999999999999999999999999999988877899999999999964

>PLN02991 oxidoreductase	Back alignment and domain information

>PLN00044 multi-copper oxidase-related protein; Provisional	Back alignment and domain information

>TIGR03389 laccase laccase, plant	Back alignment and domain information

>PLN02835 oxidoreductase	Back alignment and domain information

>KOG1263 consensus Multicopper oxidases [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PLN02168 copper ion binding / pectinesterase	Back alignment and domain information

>PLN02354 copper ion binding / oxidoreductase	Back alignment and domain information

>TIGR03388 ascorbase L-ascorbate oxidase, plant type	Back alignment and domain information

>PLN02191 L-ascorbate oxidase	Back alignment and domain information

>PLN02604 oxidoreductase	Back alignment and domain information

>TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type	Back alignment and domain information

>PF07731 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR011706 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties	Back alignment and domain information

>PRK10965 multicopper oxidase; Provisional	Back alignment and domain information

>TIGR01480 copper_res_A copper-resistance protein, CopA family	Back alignment and domain information

>PRK10883 FtsI repressor; Provisional	Back alignment and domain information

>COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing	Back alignment and domain information

>PLN02604 oxidoreductase	Back alignment and domain information

>PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties	Back alignment and domain information

>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing	Back alignment and domain information

>TIGR03388 ascorbase L-ascorbate oxidase, plant type	Back alignment and domain information

>PF00394 Cu-oxidase: Multicopper oxidase; InterPro: IPR001117 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties	Back alignment and domain information

>TIGR03095 rusti_cyanin rusticyanin	Back alignment and domain information

>PLN02191 L-ascorbate oxidase	Back alignment and domain information

>TIGR01480 copper_res_A copper-resistance protein, CopA family	Back alignment and domain information

>TIGR03389 laccase laccase, plant	Back alignment and domain information

>PLN02835 oxidoreductase	Back alignment and domain information

>PLN02168 copper ion binding / pectinesterase	Back alignment and domain information

>PLN02792 oxidoreductase	Back alignment and domain information

>PRK10965 multicopper oxidase; Provisional	Back alignment and domain information

>PLN02354 copper ion binding / oxidoreductase	Back alignment and domain information

>PLN00044 multi-copper oxidase-related protein; Provisional	Back alignment and domain information

>PRK10883 FtsI repressor; Provisional	Back alignment and domain information

>PLN02991 oxidoreductase	Back alignment and domain information

>TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type	Back alignment and domain information

>TIGR02656 cyanin_plasto plastocyanin	Back alignment and domain information

>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ]	Back alignment and domain information

>TIGR03096 nitroso_cyanin nitrosocyanin	Back alignment and domain information

>KOG1263 consensus Multicopper oxidases [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PRK02888 nitrous-oxide reductase; Validated	Back alignment and domain information

>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D	Back alignment and domain information

>PRK02710 plastocyanin; Provisional	Back alignment and domain information

>COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>TIGR02375 pseudoazurin pseudoazurin	Back alignment and domain information

>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR03102 halo_cynanin halocyanin domain	Back alignment and domain information

>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus	Back alignment and domain information

>TIGR02657 amicyanin amicyanin	Back alignment and domain information

>TIGR03094 sulfo_cyanin sulfocyanin	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		226
3pxl_A		499	Laccase; 4-copper protein, metal-binding, oxidored	7e-35
1aoz_A		552	Ascorbate oxidase; oxidoreductase(oxygen acceptor)	3e-32
1aoz_A		552	Ascorbate oxidase; oxidoreductase(oxygen acceptor)	1e-13
1hfu_A		503	Laccase 1; oxidoreductase, blue multi-copper oxida	3e-29
3t6v_A		495	Laccase; beta barrel, oxidoreductase; HET: CBS; 2.	6e-29
2q9o_A		559	Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct	5e-28
2q9o_A		559	Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct	4e-13
1v10_A		521	Laccase; multicopper blue oxidase, oxidase; 1.7A {	2e-25
1zpu_A		534	Iron transport multicopper oxidase FET3; ferroxida	5e-25
1zpu_A		534	Iron transport multicopper oxidase FET3; ferroxida	6e-08
3sqr_A		580	Laccase; multicopper oxidase, glycosylation, oxido	2e-24
3sqr_A		580	Laccase; multicopper oxidase, glycosylation, oxido	5e-11
3aw5_A		448	Multicopper oxidase; beta barrel, oxidoreductase;	5e-08
3abg_A		534	Bilirubin oxidase; cleavage on PAIR of basic resid	1e-07
2zwn_A		339	Two-domain type laccase; muticopper oxidase, oxido	2e-07
2uxt_A		451	Protein SUFI, SUFI; oxidoreductase, periplasmic, c	7e-07
2wsd_A		513	Spore coat protein A; oxidoreductase, multi-copper	6e-06
3g5w_A		318	Multicopper oxidase type 1; two domain, laccase, n	1e-05

>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Length = 499	Back alignment and structure

 Score =  128 bits (324), Expect = 7e-35
 Identities = 53/296 (17%), Positives = 80/296 (27%), Gaps = 115/296 (38%)

Query: 1   YLTISPGQIIDVLIKANQIPNKYYMSAKAHSSATDVYDDNTTTTAIVQYEG--------- 51
            + I   Q    ++ ANQ  + Y++ A  +        D    +AI++Y+G         
Sbjct: 235 SIQIFAAQRYSFVLDANQAVDNYWIRANPNFGNVGF--DGGINSAILRYDGAPAVEPTTN 292

Query: 52  ------------LYPSSKTPLPNLPSYDDT------------------------------ 69
                       L+P   TP+P  PS                                  
Sbjct: 293 QTTSVKPLNEVDLHPLVSTPVPGAPSSGGVDKAINMAFNFNGSNFFINGASFVPPTVPVL 352

Query: 70  ---------------KASVKVLEYNTAVEIVFQGTDLLAGTDHPMHLHGYSFYVVGGGFG 114
                            SV VL  N ++EI F  T    G  HP HLHG++F VV     
Sbjct: 353 LQILSGAQTAQDLLPSGSVYVLPSNASIEISFPATAAAPGAPHPFHLHGHTFAVVRSA-- 410

Query: 115 NFDRAKDAKRFNFVEPSLQNTIMVPKNVNGPKTFKCPKITCHEQALIHMNMCLHAWVLTD 174
                  +  +N+  P  ++ +       G                          V   
Sbjct: 411 ------GSTVYNYDNPIFRDVVSTGTPAAG------------------------DNVTI- 439

Query: 175 TCHKKR-------AWFVHCHLDHHQSWAMQMAFIVKNDRCAKAKMLPPLCELYKLC 223
                R        WF+HCH+D H      +              +P       LC
Sbjct: 440 -----RFDTNNPGPWFLHCHIDFHLEGGFAVVMAEDTPDVKAVNPVPQ--AWSDLC 488

PyMOL of 3pxl

>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Length = 552	Back alignment and structure

>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Length = 552	Back alignment and structure

>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Length = 503	Back alignment and structure

>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Length = 495	Back alignment and structure

>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Length = 559	Back alignment and structure

>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Length = 559	Back alignment and structure

>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Length = 521	Back alignment and structure

>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Length = 534	Back alignment and structure

>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Length = 534	Back alignment and structure

>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Length = 580	Back alignment and structure

>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Length = 580	Back alignment and structure

>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Length = 448	Back alignment and structure

>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Length = 534	Back alignment and structure

>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Length = 339	Back alignment and structure

>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Length = 451	Back alignment and structure

>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Length = 513	Back alignment and structure

>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Length = 318	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		226
3sqr_A		580	Laccase; multicopper oxidase, glycosylation, oxido	100.0
1aoz_A		552	Ascorbate oxidase; oxidoreductase(oxygen acceptor)	100.0
3pxl_A		499	Laccase; 4-copper protein, metal-binding, oxidored	100.0
1zpu_A		534	Iron transport multicopper oxidase FET3; ferroxida	100.0
3t6v_A		495	Laccase; beta barrel, oxidoreductase; HET: CBS; 2.	100.0
2q9o_A		559	Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct	100.0
1v10_A		521	Laccase; multicopper blue oxidase, oxidase; 1.7A {	100.0
1hfu_A		503	Laccase 1; oxidoreductase, blue multi-copper oxida	100.0
2xu9_A		439	Laccase; oxidoreductase, multicopper oxidases; 1.5	100.0
3gyr_A		612	PHS, phenoxazinone synthase; metalloprotein, lacca	100.0
3abg_A		534	Bilirubin oxidase; cleavage on PAIR of basic resid	100.0
3aw5_A		448	Multicopper oxidase; beta barrel, oxidoreductase;	99.97
2uxt_A		451	Protein SUFI, SUFI; oxidoreductase, periplasmic, c	99.97
2wsd_A		513	Spore coat protein A; oxidoreductase, multi-copper	99.97
3zx1_A		481	Oxidoreductase, putative; laccase, metallo-oxidase	99.96
2g23_A		612	PHS, phenoxazinone synthase; copper, metalloprotei	99.95
3od3_A		488	Blue copper oxidase CUEO; multicopper oxidase, Cu(	99.93
2dv6_A		447	Nitrite reductase; electron transfer, reduction, d	99.88
3cg8_A		343	Laccase; oxidoreductase, multicopper blue protein;	99.85
3t9w_A		299	Small laccase, multi-copper oxidase; two-domain co	99.84
3tas_A		313	Small laccase, multi-copper oxidase; two-domain la	99.84
3kw8_A		276	Laccase, putative copper oxidase; two-domain lacca	99.82
3gdc_A		288	Multicopper oxidase; beta sandwich, plasmid, oxido	99.82
2zwn_A		339	Two-domain type laccase; muticopper oxidase, oxido	99.8
2j5w_A		1065	Ceruloplasmin, ferroxidase; oxidoreductase, plasma	99.79
3g5w_A		318	Multicopper oxidase type 1; two domain, laccase, n	99.76
1sdd_B		647	Coagulation factor V; copper-binding protein, cofa	99.66
2r7e_B		770	Coagulation factor VIII; ceruloplasmin fold, cuppe	99.62
1sdd_A		306	Coagulation factor V; copper-binding protein, cofa	99.6
2r7e_A		742	Coagulation factor VIII; ceruloplasmin fold, cuppe	99.51
2r7e_A		742	Coagulation factor VIII; ceruloplasmin fold, cuppe	99.51
1kbv_A		327	ANIA, major outer membrane protein PAN 1; ANIA[NO2	99.41
2bw4_A		340	Copper-containing nitrite reductase; oxidoreductas	99.38
1mzy_A		333	Copper-containing nitrite reductase; mutant M182T,	99.28
2j5w_A		1065	Ceruloplasmin, ferroxidase; oxidoreductase, plasma	99.16
2zoo_A		442	Probable nitrite reductase; electron transfer, ele	99.13
2aan_A		139	Auracyanin A; cupredoxin fold, electron transport;	99.05
3gdc_A		288	Multicopper oxidase; beta sandwich, plasmid, oxido	99.03
2zoo_A		442	Probable nitrite reductase; electron transfer, ele	99.03
1oe1_A		336	Dissimilatory copper-containing nitrite reductase;	99.0
3cvb_A		105	Plastocyanin; cupredoxin, SELF assembly, copper, e	99.0
2dv6_A		447	Nitrite reductase; electron transfer, reduction, d	98.94
1kbv_A		327	ANIA, major outer membrane protein PAN 1; ANIA[NO2	98.73
1oe1_A		336	Dissimilatory copper-containing nitrite reductase;	98.64
2gim_A		106	Plastocyanin; beta sheet, Cu, helix, electron tran	98.61
1qhq_A		140	Protein (auracyanin); electron transfer, cupredoxi	98.6
1mzy_A		333	Copper-containing nitrite reductase; mutant M182T,	98.51
3g5w_A		318	Multicopper oxidase type 1; two domain, laccase, n	98.5
2bw4_A		340	Copper-containing nitrite reductase; oxidoreductas	98.38
3kw8_A		276	Laccase, putative copper oxidase; two-domain lacca	98.38
1aoz_A		552	Ascorbate oxidase; oxidoreductase(oxygen acceptor)	98.32
2plt_A		98	Plastocyanin; electron transport; 1.50A {Chlamydom	98.27
1bxv_A		91	Plastocyanin; copper protein, electron transfer; 1	98.26
2zwn_A		339	Two-domain type laccase; muticopper oxidase, oxido	98.26
1v10_A		521	Laccase; multicopper blue oxidase, oxidase; 1.7A {	98.24
1pcs_A		98	Plastocyanin; electron transport; 2.15A {Synechocy	98.24
3tas_A		313	Small laccase, multi-copper oxidase; two-domain la	98.23
1iby_A		112	Nitrosocyanin; RED copper, cupredoxin, beta hairpi	98.21
2q9o_A		559	Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct	98.17
1sdd_A		306	Coagulation factor V; copper-binding protein, cofa	98.14
3cg8_A		343	Laccase; oxidoreductase, multicopper blue protein;	98.14
1hfu_A		503	Laccase 1; oxidoreductase, blue multi-copper oxida	98.14
3t6v_A		495	Laccase; beta barrel, oxidoreductase; HET: CBS; 2.	98.12
3pxl_A		499	Laccase; 4-copper protein, metal-binding, oxidored	98.1
3t9w_A		299	Small laccase, multi-copper oxidase; two-domain co	98.1
1b3i_A		97	PETE protein, protein (plastocyanin); electron tra	98.04
3sqr_A		580	Laccase; multicopper oxidase, glycosylation, oxido	98.04
2uxt_A		451	Protein SUFI, SUFI; oxidoreductase, periplasmic, c	97.99
1zpu_A		534	Iron transport multicopper oxidase FET3; ferroxida	97.99
4hci_A		100	Cupredoxin 1; structural genomics, niaid, national	97.98
3od3_A		488	Blue copper oxidase CUEO; multicopper oxidase, Cu(	97.96
3zx1_A		481	Oxidoreductase, putative; laccase, metallo-oxidase	97.94
1byp_A		99	Protein (plastocyanin); electron transfer, photosy	97.92
3aw5_A		448	Multicopper oxidase; beta barrel, oxidoreductase;	97.87
2xu9_A		439	Laccase; oxidoreductase, multicopper oxidases; 1.5	97.83
2cal_A		154	Rusticyanin; iron respiratory electron transport c	97.81
1kdj_A		102	Plastocyanin; electron transfer, photosystem, PAI-	97.78
1sdd_B		647	Coagulation factor V; copper-binding protein, cofa	97.7
2r7e_B		770	Coagulation factor VIII; ceruloplasmin fold, cuppe	97.69
1fwx_A		595	Nitrous oxide reductase; beta-propeller domain, cu	97.64
1plc_A		99	Plastocyanin; electron transport; 1.33A {Populus n	97.6
3abg_A		534	Bilirubin oxidase; cleavage on PAIR of basic resid	97.47
2ov0_A		105	Amicyanin; beta-sandwich, electron transport; 0.75	97.29
2g23_A		612	PHS, phenoxazinone synthase; copper, metalloprotei	97.13
2wsd_A		513	Spore coat protein A; oxidoreductase, multi-copper	97.06
3gyr_A		612	PHS, phenoxazinone synthase; metalloprotein, lacca	96.79
1iuz_A		98	Plastocyanin; electron transport; 1.60A {Ulva pert	96.39
3tu6_A		127	Pseudoazurin (blue copper protein); cupredoxins, b	96.16
3ef4_A		124	Pseudoazurin, blue copper protein; electron transf	95.83
1id2_A		106	Amicyanin; beta barrel, type-1 blue copper protein	95.75
3erx_A		123	Pseudoazurin; copper protein, high-resolution, E t	95.75
3c75_A		132	Amicyanin; copper proteins, electron transfer comp	95.22
3sbq_A		638	Nitrous-oxide reductase; beta-propeller, cupredoxi	94.78
1paz_A		123	Pseudoazurin precursor; electron transfer(cupropro	94.68
1pmy_A		123	Pseudoazurin; electron transfer(cuproprotein); 1.5	94.32
3ay2_A		167	Lipid modified azurin protein; beta sandwich, bact	93.96
2cua_A		135	Protein (CUA); CUA center, electron transport; 1.6	93.85
1cuo_A		129	Protein (azurin ISO-2); beta barrel, periplasmic,	92.99
3s8f_B		168	Cytochrome C oxidase subunit 2; complex IV, respir	89.16
2ux6_A		122	Pseudoazurin; type-1 copper, metal-binding, redox	88.43
2ccw_A		129	Azurin II, AZN-2; electron transport (cuproprotein	88.23
1nwp_A		128	Azurin; electron transport, cupredoxin, electron t	86.44
2iaa_C		128	Azurin; quinoprotein, tryptophan tryptophylquinone	86.41

>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada}	Back alignment and structure

Probab=100.00  E-value=5.2e-42  Score=331.04  Aligned_cols=193  Identities=24%  Similarity=0.459  Sum_probs=150.4

Q ss_pred             CEEeccCceEEEEEEeCCCCCeeEEEEEeccCCCccCCCCCceEEEEEecCCCC---CCCC-C------------C-C--
Q 041358            1 YLTISPGQIIDVLIKANQIPNKYYMSAKAHSSATDVYDDNTTTTAIVQYEGLYP---SSKT-P------------L-P--   61 (226)
Q Consensus         1 ~l~I~pGQRydVLV~a~~~pg~Y~ira~~~~~~~~~~~~~~~~~AILrY~g~~p---~~~~-~------------l-P--   61 (226)
                      .|.|++||||||||++++++|+||||+.+...|.. ...+..++|||+|.++..   .+++ .            | |  
T Consensus       302 ~l~i~pGqRydVlv~a~~~~g~Y~i~a~~~~~~~~-~~~~~~~~aiL~Y~~~~~~~P~~~~~~~~~~~~~~~~~~L~P~~  380 (580)
T 3sqr_A          302 TLLIGIGQRYDVIVEANAAADNYWIRGNWGTTCST-NNEAANATGILRYDSSSIANPTSVGTTPRGTCEDEPVASLVPHL  380 (580)
T ss_dssp             SEEECTTCEEEEEEECCSCSSEEEEECCCCTTTSC-BTTGGGCEEEEESSTTCCCCCCCCCCCCCCCSCCSCGGGCCBSS
T ss_pred             EEEEccceEEEEEEEeCCCCCeEEEEEecccccCc-cCCCCceEEEEEECCCCCCCCCCCCCCccchhhcccccccccCC
Confidence            47899999999999999989999999998766532 123457899999987531   1111 0            0 0  


Q ss_pred             C--CCC-------------------CCCCc-----------------------ceEEEee----cCCEEEEEEEcCCCCC
Q 041358           62 N--LPS-------------------YDDTK-----------------------ASVKVLE----YNTAVEIVFQGTDLLA   93 (226)
Q Consensus        62 ~--~p~-------------------~~d~~-----------------------~~~~~~~----~g~~v~iv~~n~~~~~   93 (226)
                      +  .|.                   +|...                       .+++.++    .|++|||+|+|.+.. 
T Consensus       381 ~~~~~~~~~~~~~l~~~~~~~~~w~iN~~s~~~~~~~P~L~~~~~g~~~~~~~~~~~~~~~~~~~~~~VeiVi~n~~~~-  459 (580)
T 3sqr_A          381 ALDVGGYSLVDEQVSSAFTNYFTWTINSSSLLLDWSSPTTLKIFNNETIFPTEYNVVALEQTNANEEWVVYVIEDLTGF-  459 (580)
T ss_dssp             CCBCCSEEEEEEEEEEEESSSEEEEETTBCCCCCTTSCHHHHHHTTCCCCCGGGCEEEECC----CCEEEEEEEECSSS-
T ss_pred             CCCCCCccceEEEEEeccCCceeEEECCEecccCCCCCchhhhhcCCccCCCCcceeecccccCCCcEEEEEEeCCCcc-
Confidence            0  010                   01000                       0134443    699999999998532 


Q ss_pred             CcCcceeecCceEEEEecCCCCCCCccccccCCCCCCCccceEEcCCCCCCCCCCCCCcccchhhhhhhccccceeEEEE
Q 041358           94 GTDHPMHLHGYSFYVVGGGFGNFDRAKDAKRFNFVEPSLQNTIMVPKNVNGPKTFKCPKITCHEQALIHMNMCLHAWVLT  173 (226)
Q Consensus        94 ~~~HP~HlHG~~f~vv~~g~g~~~~~~~~~~~n~~~p~~rDtv~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i  173 (226)
                      ...||||||||+||||++|.|.|+++.+...+|+.+|++|||+.|+++                           ||++|
T Consensus       460 ~~~HP~HLHGh~F~vv~~g~G~f~~~~~~~~~nl~nP~~rDTv~v~~~---------------------------g~~~i  512 (580)
T 3sqr_A          460 GIWHPIHLHGHDFFIVAQETDVFNSDESPAKFNLVNPPRRDVAALPGN---------------------------GYLAI  512 (580)
T ss_dssp             CCCEEEEESSCCEEEEEEESSCCCTTTSGGGCCCBSCCEESEEEECTT---------------------------SEEEE
T ss_pred             ccceeeEecCceEEEEecCCCccCccccccccccCCCceeeEEEeCCC---------------------------ceEEE
Confidence            579999999999999999999999877677899999999999999999                           99999


Q ss_pred             E-eCCCCeeEEEeecchhhhhccceeEEEEEcCcccccccCCCchhHhhccc
Q 041358          174 D-TCHKKRAWFVHCHLDHHQSWAMQMAFIVKNDRCAKAKMLPPLCELYKLCH  224 (226)
Q Consensus       174 r-~adnpG~W~~HCHi~~H~~~Gm~~~~~v~~~~~~~~~~~~~p~~~~~~~~  224 (226)
                      | ++||||+|+||||++||+++||+++|+|++++..  ++.++|.++...|.
T Consensus       513 rf~adNPG~W~~HCHi~~H~~~Gm~~~~~e~~~~i~--~~~~~~~~~~~~C~  562 (580)
T 3sqr_A          513 AFKLDNPGSWLLHCHIAWHASEGLAMQFVESQSSIA--VKMTDTAIFEDTCA  562 (580)
T ss_dssp             EEESCSCEEEEEEECSHHHHHTTCEEEEEESGGGCC--CCHHHHHHHHHHHH
T ss_pred             EEEcCCCeeeEEEECcHHHhhCCCcEEEEECHHHHh--hccCCcHHHHHhhH
Confidence            9 9999999999999999999999999999876543  33347888888775

PyMOL of 3sqr

>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A*	Back alignment and structure

>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A*	Back alignment and structure

>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A*	Back alignment and structure

>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A*	Back alignment and structure

>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3	Back alignment and structure

>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A*	Back alignment and structure

>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A	Back alignment and structure

>3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus}	Back alignment and structure

>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A*	Back alignment and structure

>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum}	Back alignment and structure

>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A	Back alignment and structure

>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A	Back alignment and structure

>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp}	Back alignment and structure

>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ...	Back alignment and structure

>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans}	Back alignment and structure

>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor}	Back alignment and structure

>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP}	Back alignment and structure

>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A*	Back alignment and structure

>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A*	Back alignment and structure

>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP}	Back alignment and structure

>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes}	Back alignment and structure

>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A*	Back alignment and structure

>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea}	Back alignment and structure

>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2	Back alignment and structure

>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B*	Back alignment and structure

>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3	Back alignment and structure

>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A*	Back alignment and structure

>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A*	Back alignment and structure

>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A	Back alignment and structure

>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ...	Back alignment and structure

>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A	Back alignment and structure

>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A*	Back alignment and structure

>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis}	Back alignment and structure

>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus}	Back alignment and structure

>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP}	Back alignment and structure

>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis}	Back alignment and structure

>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ...	Back alignment and structure

>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A	Back alignment and structure

>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans}	Back alignment and structure

>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A	Back alignment and structure

>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ...	Back alignment and structure

>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A	Back alignment and structure

>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A	Back alignment and structure

>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A	Back alignment and structure

>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea}	Back alignment and structure

>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ...	Back alignment and structure

>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A*	Back alignment and structure

>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A*	Back alignment and structure

>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1	Back alignment and structure

>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A	Back alignment and structure

>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes}	Back alignment and structure

>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3	Back alignment and structure

>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A	Back alignment and structure

>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A*	Back alignment and structure

>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A	Back alignment and structure

>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A*	Back alignment and structure

>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3	Back alignment and structure

>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor}	Back alignment and structure

>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A*	Back alignment and structure

>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A*	Back alignment and structure

>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A*	Back alignment and structure

>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP}	Back alignment and structure

>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A*	Back alignment and structure

>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada}	Back alignment and structure

>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A	Back alignment and structure

>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A	Back alignment and structure

>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ...	Back alignment and structure

>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp}	Back alignment and structure

>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A	Back alignment and structure

>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum}	Back alignment and structure

>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A	Back alignment and structure

>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A	Back alignment and structure

>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A	Back alignment and structure

>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2	Back alignment and structure

>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B*	Back alignment and structure

>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A	Back alignment and structure

>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A	Back alignment and structure

>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A*	Back alignment and structure

>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ...	Back alignment and structure

>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A	Back alignment and structure

>3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus}	Back alignment and structure

>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A	Back alignment and structure

>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti}	Back alignment and structure

>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0	Back alignment and structure

>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1	Back alignment and structure

>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A	Back alignment and structure

>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus}	Back alignment and structure

>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A	Back alignment and structure

>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A*	Back alignment and structure

>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1	Back alignment and structure

>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae}	Back alignment and structure

>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B*	Back alignment and structure

>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A	Back alignment and structure

>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ...	Back alignment and structure

>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A	Back alignment and structure

>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A	Back alignment and structure

>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A	Back alignment and structure

>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		226
d1aoza3		214	b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (C	1e-14
d2q9oa3		216	b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyce	4e-14
d1gyca3		199	b.6.1.3 (A:301-499) Laccase {Trametes versicolor,	2e-11
d1gska3		154	b.6.1.3 (A:357-510) Spore coat protein A, CotA {Ba	5e-11
d1hfua3		200	b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Copr	1e-10
d1v10a3		190	b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus	2e-10
d1aoza2		209	b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (C	3e-09
d2q9oa2		181	b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyce	5e-09
d1v10a2		168	b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus	5e-08
d1gyca2		170	b.6.1.3 (A:131-300) Laccase {Trametes versicolor,	1e-07
d1hfua2		172	b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Copr	3e-07
d1kv7a3		181	b.6.1.3 (A:336-516) multi-copper oxidase CueO {Esc	4e-07
d2j5wa2		145	b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sap	5e-04
d1kv7a2		165	b.6.1.3 (A:171-335) multi-copper oxidase CueO {Esc	9e-04
d1kcwa2		146	b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sap	0.001
d1sddb2		139	b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (B	0.002
d2j5wa5		149	b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sa	0.003

>d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Length = 214	Back information, alignment and structure


class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Multidomain cupredoxins
domain: Ascorbate oxidase
species: Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]

 Score = 68.0 bits (165), Expect = 1e-14
 Identities = 32/180 (17%), Positives = 59/180 (32%), Gaps = 36/180 (20%)

Query: 30  HSSATDVYDDNTTTTAIVQYEGLYPSSKTPLPNLPSYDDTKASVKVLEYNTAVEIVFQGT 89
             +    +D N       +         TP  N  +       V   +    V+++ Q  
Sbjct: 43  KYNLLHAFDQNP----PPEVFPEDYDIDTPPTNEKTRIGN--GVYQFKIGEVVDVILQNA 96

Query: 90  DLLAGTD---HPMHLHGYSFYVVGGGFGNFDRAKDAKRFNFVEPSLQNTIMVPKNVNGPK 146
           +++       HP HLHG+ F+V+G G G F   +++   N   P L+NT+++        
Sbjct: 97  NMMKENLSETHPWHLHGHDFWVLGYGDGKFSAEEESS-LNLKNPPLRNTVVIFPY----- 150

Query: 147 TFKCPKITCHEQALIHMNMCLHAWVLTDTCHKKRAWFVHCHLDHHQSWAMQMAFIVKNDR 206
                                    +         W  HCH++ H    M + F    ++
Sbjct: 151 ---------------------GWTAIRFVADNPGVWAFHCHIEPHLHMGMGVVFAEGVEK 189

PyMOL of d1aoza3

>d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} Length = 216	Back information, alignment and structure

>d1gyca3 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Length = 199	Back information, alignment and structure

>d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Length = 154	Back information, alignment and structure

>d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Length = 200	Back information, alignment and structure

>d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus [TaxId: 219653]} Length = 190	Back information, alignment and structure

>d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Length = 209	Back information, alignment and structure

>d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} Length = 181	Back information, alignment and structure

>d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]} Length = 168	Back information, alignment and structure

>d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Length = 170	Back information, alignment and structure

>d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Length = 172	Back information, alignment and structure

>d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Length = 181	Back information, alignment and structure

>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 145	Back information, alignment and structure

>d1kv7a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Length = 165	Back information, alignment and structure

>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 146	Back information, alignment and structure

>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 139	Back information, alignment and structure

>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 149	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		226
d1aoza3		214	Ascorbate oxidase {Zucchini (Cucurbita pepo var. m	100.0
d1hfua3		200	Laccase {Inky cap fungus (Coprinus cinereus) [TaxI	99.96
d1gyca3		199	Laccase {Trametes versicolor, laccase 2 [TaxId: 53	99.96
d1v10a3		190	Laccase {Rigidoporus lignosus [TaxId: 219653]}	99.96
d2q9oa3		216	Laccase {Melanocarpus albomyces [TaxId: 204285]}	99.96
d1gska3		154	Spore coat protein A, CotA {Bacillus subtilis [Tax	99.94
d1kv7a3		181	multi-copper oxidase CueO {Escherichia coli [TaxId	99.89
d2j5wa5		149	Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]}	99.85
d1sddb2		139	Coagulation factor V {Cow (Bos taurus) [TaxId: 991	99.82
d2j5wa2		145	Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]}	99.79
d1kcwa2		146	Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]}	99.78
d1kbva2		151	Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani	99.77
d1sdda2		116	Coagulation factor V {Cow (Bos taurus) [TaxId: 991	99.71
d2bw4a2		173	Nitrite reductase, NIR {Alcaligenes xylosoxidans [	99.61
d1e30a_		153	Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920	99.49
d1oe1a2		177	Nitrite reductase, NIR {Alcaligenes xylosoxidans [	99.49
d1aoza1		129	Ascorbate oxidase {Zucchini (Cucurbita pepo var. m	99.39
d2q9oa1		162	Laccase {Melanocarpus albomyces [TaxId: 204285]}	99.22
d2q9oa2		181	Laccase {Melanocarpus albomyces [TaxId: 204285]}	99.18
d2bw4a1		157	Nitrite reductase, NIR {Alcaligenes xylosoxidans [	99.18
d1mzya1		153	Nitrite reductase, NIR {Rhodobacter sphaeroides [T	99.17
d1gyca2		170	Laccase {Trametes versicolor, laccase 2 [TaxId: 53	99.17
d1v10a2		168	Laccase {Rigidoporus lignosus [TaxId: 219653]}	99.15
d1hfua2		172	Laccase {Inky cap fungus (Coprinus cinereus) [TaxI	99.14
d1kbva1		151	Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani	99.1
d1oe2a1		159	Nitrite reductase, NIR {Alcaligenes xylosoxidans [	99.09
d1hfua1		131	Laccase {Inky cap fungus (Coprinus cinereus) [TaxI	98.97
d1gyca1		130	Laccase {Trametes versicolor, laccase 2 [TaxId: 53	98.97
d2j5wa1		192	Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]}	98.95
d1kv7a1		140	multi-copper oxidase CueO {Escherichia coli [TaxId	98.9
d1qhqa_		139	Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]	98.9
d1aoza2		209	Ascorbate oxidase {Zucchini (Cucurbita pepo var. m	98.89
d1v10a1		136	Laccase {Rigidoporus lignosus [TaxId: 219653]}	98.8
d1ibya_		112	Red copper protein nitrosocyanin {Nitrosomonas eur	98.79
d1sdda1		180	Coagulation factor V {Cow (Bos taurus) [TaxId: 991	98.53
d1fwxa1		132	Nitrous oxide reductase, C-terminal domain {Paraco	98.36
d2j5wa3		207	Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]}	98.19
d2j5wa4		179	Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]}	98.05
d1gska1		181	Spore coat protein A, CotA {Bacillus subtilis [Tax	98.04
d1qnia1		131	Nitrous oxide reductase, C-terminal domain {Pseudo	97.88
d1gska2		174	Spore coat protein A, CotA {Bacillus subtilis [Tax	97.5
d1v10a2		168	Laccase {Rigidoporus lignosus [TaxId: 219653]}	97.48
d1kv7a2		165	multi-copper oxidase CueO {Escherichia coli [TaxId	97.35
d1hfua2		172	Laccase {Inky cap fungus (Coprinus cinereus) [TaxI	97.2
d1aoza2		209	Ascorbate oxidase {Zucchini (Cucurbita pepo var. m	97.19
d2q9oa2		181	Laccase {Melanocarpus albomyces [TaxId: 204285]}	97.05
d1gyca2		170	Laccase {Trametes versicolor, laccase 2 [TaxId: 53	97.04
d2q5ba1		105	Plastocyanin {Cyanobacterium (Phormidium laminosum	96.92
d2plta_		98	Plastocyanin {Green alga (Chlamydomonas reinhardti	96.71
d2cuaa_		122	Cytochrome c oxidase {Thermus thermophilus, ba3 ty	96.46
d1pcsa_		98	Plastocyanin {Cyanobacterium (Synechocystis sp.),	96.38
d1bxua_		91	Plastocyanin {Cyanobacterium (Synechocystis sp.),	96.36
d1mzya2		178	Nitrite reductase, NIR {Rhodobacter sphaeroides [T	95.42
d1jzga_		128	Azurin {Pseudomonas aeruginosa [TaxId: 287]}	94.98
d1iuza_		98	Plastocyanin {Ulva pertusa, a sea lettuce [TaxId:	94.91
d2jxma1		97	Plastocyanin {Photosynthetic prokaryote (Prochloro	94.87
d1nwpa_		128	Azurin {Pseudomonas putida [TaxId: 303]}	94.85
d1cuoa_		129	Azurin {Methylomonas sp. j [TaxId: 32038]}	94.78
d2cj3a1		105	Plastocyanin {Anabaena variabilis [TaxId: 1172]}	94.64
d1bqka_		124	Pseudoazurin {Achromobacter cycloclastes [TaxId: 2	94.51
d1sddb1		67	Coagulation factor V {Cow (Bos taurus) [TaxId: 991	94.51
d1plca_		99	Plastocyanin {Poplar (Populus nigra), variant ital	93.92
d2ccwa1		129	Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d	93.77
d1adwa_		123	Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236	93.55
d1kv7a2		165	multi-copper oxidase CueO {Escherichia coli [TaxId	93.48
d1pmya_		123	Pseudoazurin {Methylobacterium extorquens, strain	93.4
d1paza_		120	Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta	91.95
d1kdja_		102	Plastocyanin {Fern (Adiantum capillus-veneris) [Ta	91.85
d2ov0a1		105	Amicyanin {Paracoccus denitrificans [TaxId: 266]}	91.02
d1gska2		174	Spore coat protein A, CotA {Bacillus subtilis [Tax	90.32
d1id2a_		106	Amicyanin {Paracoccus versutus (Thiobacillus versu	85.8
d1bypa_		99	Plastocyanin {White campion (Silene pratensis) [Ta	80.8

>d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]}	Back information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Multidomain cupredoxins
domain: Ascorbate oxidase
species: Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]

Probab=100.00  E-value=8.4e-34  Score=241.42  Aligned_cols=121  Identities=24%  Similarity=0.491  Sum_probs=107.1

Q ss_pred             eEEEeecCCEEEEEEEcCCCC---CCcCcceeecCceEEEEecCCCCCCCccccccCCCCCCCccceEEcCCCCCCCCCC
Q 041358           72 SVKVLEYNTAVEIVFQGTDLL---AGTDHPMHLHGYSFYVVGGGFGNFDRAKDAKRFNFVEPSLQNTIMVPKNVNGPKTF  148 (226)
Q Consensus        72 ~~~~~~~g~~v~iv~~n~~~~---~~~~HP~HlHG~~f~vv~~g~g~~~~~~~~~~~n~~~p~~rDtv~v~~~~~~~~~~  148 (226)
                      .++.+++|++|||+|+|.+..   ....||||||||+|||+++|.|.|+... ...+|+.+|.+|||+.|+++       
T Consensus        79 ~v~~~~~g~~veivl~n~~~~~~~~~~~HP~HlHG~~F~vl~~~~g~~~~~~-~~~~n~~~p~~rDTv~v~~g-------  150 (214)
T d1aoza3          79 GVYQFKIGEVVDVILQNANMMKENLSETHPWHLHGHDFWVLGYGDGKFSAEE-ESSLNLKNPPLRNTVVIFPY-------  150 (214)
T ss_dssp             CCEEECTTCEEEEEEEECCCSSTTCCCCEEEEETTCCEEEEEEEESSCCGGG-GGGSCCSSCCEESEEEECTT-------
T ss_pred             eeEEecCCCEEEEEEeccccccCCCCCCcceEeecceeEEeccCCCcccccc-cccccccCCceecCcccCCC-------
Confidence            489999999999999997532   2457999999999999999999888654 45689999999999999999       


Q ss_pred             CCCcccchhhhhhhccccceeEEEEE-eCCCCeeEEEeecchhhhhccceeEEEEEcCcccccccCCCchhHhhcccC
Q 041358          149 KCPKITCHEQALIHMNMCLHAWVLTD-TCHKKRAWFVHCHLDHHQSWAMQMAFIVKNDRCAKAKMLPPLCELYKLCHK  225 (226)
Q Consensus       149 ~~~~~~~~~~~~~~~~~~~~~~~~ir-~adnpG~W~~HCHi~~H~~~Gm~~~~~v~~~~~~~~~~~~~p~~~~~~~~~  225 (226)
                                          +|++|| ++||||.|+||||+++|++.||+++|+|..     +++.++|.+++.||..
T Consensus       151 --------------------~~~~ir~~adnpG~w~~HCH~~~H~~~GM~~~~~v~~-----~~~~~~P~~~~~cg~~  203 (214)
T d1aoza3         151 --------------------GWTAIRFVADNPGVWAFHCHIEPHLHMGMGVVFAEGV-----EKVGRIPTKALACGGT  203 (214)
T ss_dssp             --------------------EEEEEEEECCSCEEEEEEESSHHHHHTTCEEEEEECG-----GGCCCCCHHHHSSHHH
T ss_pred             --------------------ceEEEEEecCCCeeEEEEECcHHHHhCcCcEEEEEcc-----ccccCCCccccccccc
Confidence                                999999 999999999999999999999999999874     3556789999999864

PyMOL of d1aoza3

>d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]}	Back information, alignment and structure

>d1gyca3 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]}	Back information, alignment and structure

>d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus [TaxId: 219653]}	Back information, alignment and structure

>d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]}	Back information, alignment and structure

>d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]}	Back information, alignment and structure

>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2bw4a2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}	Back information, alignment and structure

>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]}	Back information, alignment and structure

>d1oe1a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}	Back information, alignment and structure

>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]}	Back information, alignment and structure

>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]}	Back information, alignment and structure

>d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]}	Back information, alignment and structure

>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}	Back information, alignment and structure

>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

>d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]}	Back information, alignment and structure

>d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]}	Back information, alignment and structure

>d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]}	Back information, alignment and structure

>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]}	Back information, alignment and structure

>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}	Back information, alignment and structure

>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]}	Back information, alignment and structure

>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]}	Back information, alignment and structure

>d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]}	Back information, alignment and structure

>d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]}	Back information, alignment and structure

>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]}	Back information, alignment and structure

>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]}	Back information, alignment and structure

>d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]}	Back information, alignment and structure

>d1gska2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]}	Back information, alignment and structure

>d1kv7a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]}	Back information, alignment and structure

>d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]}	Back information, alignment and structure

>d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]}	Back information, alignment and structure

>d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]}	Back information, alignment and structure

>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]}	Back information, alignment and structure

>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}	Back information, alignment and structure

>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]}	Back information, alignment and structure

>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]}	Back information, alignment and structure

>d1mzya2 b.6.1.3 (A:194-371) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]}	Back information, alignment and structure

>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]}	Back information, alignment and structure

>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]}	Back information, alignment and structure

>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]}	Back information, alignment and structure

>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]}	Back information, alignment and structure

>d1sddb1 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]}	Back information, alignment and structure

>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]}	Back information, alignment and structure

>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]}	Back information, alignment and structure

>d1kv7a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]}	Back information, alignment and structure

>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]}	Back information, alignment and structure

>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]}	Back information, alignment and structure

>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1gska2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]}	Back information, alignment and structure

>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]}	Back information, alignment and structure