Citrus Sinensis ID: 041388
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 440 | ||||||
| 147812093 | 607 | hypothetical protein VITISV_040899 [Viti | 0.909 | 0.658 | 0.305 | 2e-36 | |
| 224114976 | 462 | predicted protein [Populus trichocarpa] | 0.927 | 0.883 | 0.279 | 2e-27 | |
| 8778383 | 451 | F16A14.1 [Arabidopsis thaliana] gi|46518 | 0.9 | 0.878 | 0.261 | 3e-24 | |
| 79343779 | 456 | F-box/FBD/LRR-repeat -containing protein | 0.9 | 0.868 | 0.261 | 3e-24 | |
| 15219959 | 449 | F-box/RNI-like/FBD-like domains-containi | 0.884 | 0.866 | 0.254 | 9e-23 | |
| 22328947 | 419 | F-box/FBD/LRR-repeat protein [Arabidopsi | 0.886 | 0.930 | 0.264 | 3e-22 | |
| 297844280 | 455 | F16A14.1 [Arabidopsis lyrata subsp. lyra | 0.909 | 0.879 | 0.260 | 8e-22 | |
| 297819758 | 426 | F-box family protein [Arabidopsis lyrata | 0.897 | 0.927 | 0.262 | 1e-21 | |
| 296086770 | 411 | unnamed protein product [Vitis vinifera] | 0.75 | 0.802 | 0.273 | 2e-21 | |
| 297844624 | 452 | F-box family protein [Arabidopsis lyrata | 0.909 | 0.884 | 0.248 | 3e-21 |
| >gi|147812093|emb|CAN74740.1| hypothetical protein VITISV_040899 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 160 bits (404), Expect = 2e-36, Method: Compositional matrix adjust.
Identities = 137/448 (30%), Positives = 207/448 (46%), Gaps = 48/448 (10%)
Query: 25 DRISSLPDSVLCHILSYIPTKHVVATSVIAKRWKNVWTAVPNLSFDDRLCLRPPASTYVP 84
D IS+LPD +LCHILS++PTK V TS+++KRW+ +W +VP L FDD L L P ST V
Sbjct: 10 DIISNLPDELLCHILSFLPTKFAVGTSILSKRWRYLWASVPILDFDDELWLNP--STLVE 67
Query: 85 LRG----FADFVHTVLLRTNPAKIGKFSLYCSRPTNLARFYDWIATALMREVGEIQLYLG 140
L F +FV VL + + I KF L R NL Y WI AL R V E+ L+L
Sbjct: 68 LEERIIMFQNFVDGVLRHSEVSCIKKFRL-GYRDNNLDSVYSWICIALERRVQELDLHLL 126
Query: 141 QQSRVELPEAIYSAACLKVLTLDSDFSIQVPSSGTCFPCVKILSVR-LENPNKSVTENLF 199
RVELP + L V+ L + +P++ P +K L ++ +E + + L
Sbjct: 127 IDWRVELPPMFFICKTLVVVKLSCALFLDIPTT-VWLPSLKALHLKSVEYSDDDSIQKLL 185
Query: 200 CSCPSLEELSVTCELHDDTPPPNLIISSATLKTCKLIVRSEDMLF----REVDYMLTITA 255
CP LEEL + E D+ N +S+ +LK ++ ++ + DY + + A
Sbjct: 186 SGCPVLEELVIEREERDNQWVVN--VSNPSLKILRIFFFTDGFAHPYEQEDQDYKVVVDA 243
Query: 256 PKLESLEIYSDLLGSFVMHDLHSLKIVKLDI-MHAEWAQVDPYRA--------IQLLAGI 306
P LE L I L + + DL SL +D+ +E + P+ +LL I
Sbjct: 244 PNLEYLSITDYLSKDYFVKDLPSLVKAFIDVEQDSEEFEESPHNGGISYHGPIYELLGRI 303
Query: 307 NSCKYLYLSAGIMSSVE---------LHRNGGRTDRMASTANRAKKLTELGKSCPAQEQF 357
++ K L L+ + S+ N R + + L S P E
Sbjct: 304 SNVKCLSLTGVTLDSLSGTIGDYKLPTFHNMTRLEFLFIGGFNWDFLPNFLHSSPNLEAL 363
Query: 358 -------------GWLESDFDVPHCLVHTVKNIEIKGVQGDEDERPLLKYLLQFAAAMEK 404
GWL VP CLV +K IEI+ + G++ E ++YLL+ A +++
Sbjct: 364 VIETGYTNELIPEGWLMP-LQVPACLVLHLKEIEIRRIVGEDYELEAVEYLLKNAEVLQQ 422
Query: 405 MLMWAKASVPKENRANLRESILQLPRAS 432
M + S + ++ +L LPR S
Sbjct: 423 MTIDCHESYMDQEFCVCKK-LLGLPRGS 449
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224114976|ref|XP_002316907.1| predicted protein [Populus trichocarpa] gi|222859972|gb|EEE97519.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|8778383|gb|AAF79391.1|AC068197_1 F16A14.1 [Arabidopsis thaliana] gi|46518457|gb|AAS99710.1| At1g13780 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|79343779|ref|NP_172833.2| F-box/FBD/LRR-repeat -containing protein [Arabidopsis thaliana] gi|75217965|sp|Q56XS8.1|FDL2_ARATH RecName: Full=F-box/FBD/LRR-repeat protein At1g13780 gi|62320538|dbj|BAD95126.1| hypothetical protein [Arabidopsis thaliana] gi|332190947|gb|AEE29068.1| F-box/FBD/LRR-repeat -containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15219959|ref|NP_173137.1| F-box/RNI-like/FBD-like domains-containing protein [Arabidopsis thaliana] gi|75263252|sp|Q9FZ52.1|FDL3_ARATH RecName: Full=F-box/FBD/LRR-repeat protein At1g16930 gi|9802769|gb|AAF99838.1|AC051629_5 Hypothetical protein [Arabidopsis thaliana] gi|332191402|gb|AEE29523.1| F-box/RNI-like/FBD-like domains-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|22328947|ref|NP_194364.2| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] gi|75244651|sp|Q8H1R7.1|FDL27_ARATH RecName: Full=F-box/FBD/LRR-repeat protein At4g26340 gi|23296372|gb|AAN13055.1| unknown protein [Arabidopsis thaliana] gi|332659787|gb|AEE85187.1| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297844280|ref|XP_002890021.1| F16A14.1 [Arabidopsis lyrata subsp. lyrata] gi|297335863|gb|EFH66280.1| F16A14.1 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|297819758|ref|XP_002877762.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297323600|gb|EFH54021.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|296086770|emb|CBI32919.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297844624|ref|XP_002890193.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297336035|gb|EFH66452.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 440 | ||||||
| TAIR|locus:2015681 | 449 | AT1G16930 "AT1G16930" [Arabido | 0.575 | 0.563 | 0.307 | 7.1e-27 | |
| TAIR|locus:2136834 | 419 | AT4G26340 "AT4G26340" [Arabido | 0.888 | 0.933 | 0.263 | 8.3e-27 | |
| TAIR|locus:2014859 | 456 | AT1G13780 "AT1G13780" [Arabido | 0.768 | 0.741 | 0.284 | 1.5e-26 | |
| TAIR|locus:2101674 | 427 | AT3G50710 "AT3G50710" [Arabido | 0.895 | 0.922 | 0.263 | 8e-26 | |
| TAIR|locus:2037578 | 458 | AT1G78750 "AT1G78750" [Arabido | 0.586 | 0.563 | 0.320 | 3e-23 | |
| TAIR|locus:2101635 | 448 | AT3G44810 [Arabidopsis thalian | 0.665 | 0.654 | 0.292 | 3.1e-23 | |
| TAIR|locus:2075372 | 472 | AT3G03040 "AT3G03040" [Arabido | 0.563 | 0.525 | 0.337 | 7.9e-23 | |
| TAIR|locus:2085013 | 532 | AT3G42770 "AT3G42770" [Arabido | 0.909 | 0.751 | 0.276 | 8.2e-23 | |
| TAIR|locus:2162499 | 443 | AT5G22670 "AT5G22670" [Arabido | 0.568 | 0.564 | 0.317 | 1.2e-22 | |
| TAIR|locus:2081408 | 427 | AT3G44060 "AT3G44060" [Arabido | 0.645 | 0.665 | 0.305 | 1.5e-22 |
| TAIR|locus:2015681 AT1G16930 "AT1G16930" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 292 (107.8 bits), Expect = 7.1e-27, Sum P(2) = 7.1e-27
Identities = 85/276 (30%), Positives = 140/276 (50%)
Query: 18 KTNRGNADRISSLPDSVLCHILSYIPTKHVVATSVIAKRWKNVWTAVPNLSFDDRLCLRP 77
K + N+DRIS+LPDS+LC ILS + TK V TSV++KRW+N+W VP L D P
Sbjct: 8 KEKQRNSDRISNLPDSLLCQILSDLSTKESVCTSVLSKRWRNLWLHVPVLDLDSNNF--P 65
Query: 78 PASTYVPLRGFADFVHTVLLRTNPAKIGKFSL-YCSRPTNLARFYDWIATALMREVGEIQ 136
+V FV+ L N + +F L Y + +RF WI + R V
Sbjct: 66 DDDVFV------SFVNRFLGSENEQHLERFKLIYEVNEHDASRFKSWINAVIKRRVCHFN 119
Query: 137 LYL---GQQSRVELPEAIYSAACLKVLTLDS-DFSIQVPSSGTCFPCVKILSVRLENPNK 192
++ V++P ++YS C +++ L ++ P S PCVKI+ + + +
Sbjct: 120 VHNEVDDDDELVKMPLSLYS--CERLVNLQLYRVALDHPES-VSLPCVKIMHLDMVKYDA 176
Query: 193 SVT-ENLFCSCPSLEELSVTCELHDDTPPPNLIISSATLKTCKLIVRSEDMLFREVDYML 251
T E L CP LEEL++ + +D + + S +LK+ K + SE + ++++
Sbjct: 177 DSTLEILISGCPVLEELTIVRDPNDSLEV--VCVRSQSLKSFK--IDSER--YESQNHVV 230
Query: 252 TITAPKLESLEIYSDLLGSFVMHDLHSLKIVKLDIM 287
TI AP+LE + + SF++H++ V +D++
Sbjct: 231 TIDAPRLEYMNLCDHRSDSFIIHNIGPFAKVDIDVI 266
|
|
| TAIR|locus:2136834 AT4G26340 "AT4G26340" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2014859 AT1G13780 "AT1G13780" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2101674 AT3G50710 "AT3G50710" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2037578 AT1G78750 "AT1G78750" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2101635 AT3G44810 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075372 AT3G03040 "AT3G03040" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2085013 AT3G42770 "AT3G42770" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162499 AT5G22670 "AT5G22670" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2081408 AT3G44060 "AT3G44060" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 440 | |||
| pfam00646 | 48 | pfam00646, F-box, F-box domain | 5e-05 | |
| pfam08387 | 51 | pfam08387, FBD, FBD | 4e-04 | |
| smart00579 | 72 | smart00579, FBD, domain in FBox and BRCT domain co | 0.002 |
| >gnl|CDD|201368 pfam00646, F-box, F-box domain | Back alignment and domain information |
|---|
Score = 40.3 bits (95), Expect = 5e-05
Identities = 12/48 (25%), Positives = 25/48 (52%)
Query: 25 DRISSLPDSVLCHILSYIPTKHVVATSVIAKRWKNVWTAVPNLSFDDR 72
+ LPD +L ILS + K ++ S+++KRW+++ ++
Sbjct: 1 FSLLDLPDDLLLEILSRLDPKDLLRLSLVSKRWRSLVDSLKLWKKRLL 48
|
This domain is approximately 50 amino acids long, and is usually found in the N-terminal half of a variety of proteins. Two motifs that are commonly found associated with the F-box domain are the leucine rich repeats (LRRs; pfam00560 and pfam07723) and the WD repeat (pfam00400). The F-box domain has a role in mediating protein-protein interactions in a variety of contexts, such as polyubiquitination, transcription elongation, centromere binding and translational repression. Length = 48 |
| >gnl|CDD|203925 pfam08387, FBD, FBD | Back alignment and domain information |
|---|
| >gnl|CDD|214730 smart00579, FBD, domain in FBox and BRCT domain containing plant proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 440 | |||
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.54 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.5 | |
| smart00579 | 72 | FBD domain in FBox and BRCT domain containing plan | 99.45 | |
| PF08387 | 51 | FBD: FBD; InterPro: IPR013596 This region is found | 99.05 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 98.68 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.3 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.2 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.1 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.1 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.93 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.76 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.57 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.54 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.38 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.34 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.32 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 97.31 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.13 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.12 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 97.0 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 96.97 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 96.79 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 96.34 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 96.27 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 96.19 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 95.84 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 95.66 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 95.48 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 95.47 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 95.42 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 95.41 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 95.39 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 95.05 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 94.94 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 94.86 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 94.75 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 94.43 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 94.33 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 93.95 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 93.54 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 92.41 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 92.25 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 91.96 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 91.61 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 91.31 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 90.01 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 89.37 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 88.43 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 88.33 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 87.94 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 87.52 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 87.43 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 86.39 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 85.62 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 84.88 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 84.56 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 83.98 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 83.4 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 82.31 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 82.17 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 81.06 |
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.54 E-value=2.1e-16 Score=140.67 Aligned_cols=218 Identities=20% Similarity=0.221 Sum_probs=139.3
Q ss_pred CCCCChHHHHHHhcCCCchhhhhhhccccchHHHhccC---CeeEeecCCCCCCCCCCCCCcchHHHHHHHHHhcCCCCc
Q 041388 27 ISSLPDSVLCHILSYIPTKHVVATSVIAKRWKNVWTAV---PNLSFDDRLCLRPPASTYVPLRGFADFVHTVLLRTNPAK 103 (440)
Q Consensus 27 is~LPd~lL~~Ils~L~~~d~~rts~lsrrWr~lw~~~---~~l~~~~~~~~~~~~~~~~~~~~~~~~v~~~L~~~~~~~ 103 (440)
...|||||+..||+.|+.+++.+.+.|||||+++-..- ..+++.... ... + +...+.++ +
T Consensus 98 ~~slpDEill~IFs~L~kk~LL~~~~VC~Rfyr~~~de~lW~~lDl~~r~---------i~p----~-~l~~l~~r---g 160 (419)
T KOG2120|consen 98 WDSLPDEILLGIFSCLCKKELLKVSGVCKRFYRLASDESLWQTLDLTGRN---------IHP----D-VLGRLLSR---G 160 (419)
T ss_pred cccCCHHHHHHHHHhccHHHHHHHHHHHHHHhhccccccceeeeccCCCc---------cCh----h-HHHHHHhC---C
Confidence 57899999999999999999999999999999753321 123332222 011 1 22233333 3
Q ss_pred eeeEEEEeeCCCChhhHHHHHHHHHcCCcEEEEEEEccCceeecCccccccccccEEEecCCccccCCC--Ccccccccc
Q 041388 104 IGKFSLYCSRPTNLARFYDWIATALMREVGEIQLYLGQQSRVELPEAIYSAACLKVLTLDSDFSIQVPS--SGTCFPCVK 181 (440)
Q Consensus 104 v~~l~l~~~~~~~~~~~~~wi~~~~~~~l~~L~l~~~~~~~~~lp~~l~~~~~L~~L~L~~~~~l~~~~--~~~~~~~L~ 181 (440)
|..|++.-....+ ..++..... .+.+++++++....-....+-..+..|++|+.|+|. +..++++- ..+.-.+|+
T Consensus 161 V~v~Rlar~~~~~-prlae~~~~-frsRlq~lDLS~s~it~stl~~iLs~C~kLk~lSlE-g~~LdD~I~~~iAkN~~L~ 237 (419)
T KOG2120|consen 161 VIVFRLARSFMDQ-PRLAEHFSP-FRSRLQHLDLSNSVITVSTLHGILSQCSKLKNLSLE-GLRLDDPIVNTIAKNSNLV 237 (419)
T ss_pred eEEEEcchhhhcC-chhhhhhhh-hhhhhHHhhcchhheeHHHHHHHHHHHHhhhhcccc-ccccCcHHHHHHhccccce
Confidence 5555555322222 222222222 223688888865322222333445569999999999 88887764 234457899
Q ss_pred eEEEE-EE-eCCCcchhhhhccCCCcceEEEeeeeCCCCCCCcEEe--cccccceeEEEeecccccccccccEEEEecCC
Q 041388 182 ILSVR-LE-NPNKSVTENLFCSCPSLEELSVTCELHDDTPPPNLII--SSATLKTCKLIVRSEDMLFREVDYMLTITAPK 257 (440)
Q Consensus 182 ~L~L~-~~-~~~~~~l~~lls~cp~Le~L~L~~c~~~~~~~~~l~i--~~~~L~~L~i~~~~~~~~~~~~~~~l~~~~p~ 257 (440)
.|+|. +. ++ +.+++.++++|..|.+|+|..|....-. ....+ .+++|+.|++. +|-+.-+......+.-.+|+
T Consensus 238 ~lnlsm~sG~t-~n~~~ll~~scs~L~~LNlsWc~l~~~~-Vtv~V~hise~l~~LNls-G~rrnl~~sh~~tL~~rcp~ 314 (419)
T KOG2120|consen 238 RLNLSMCSGFT-ENALQLLLSSCSRLDELNLSWCFLFTEK-VTVAVAHISETLTQLNLS-GYRRNLQKSHLSTLVRRCPN 314 (419)
T ss_pred eeccccccccc-hhHHHHHHHhhhhHhhcCchHhhccchh-hhHHHhhhchhhhhhhhh-hhHhhhhhhHHHHHHHhCCc
Confidence 99999 54 66 8889999999999999999999531110 11122 35899999999 87322111112334456899
Q ss_pred ceEEEEeccc
Q 041388 258 LESLEIYSDL 267 (440)
Q Consensus 258 L~~L~~~~~~ 267 (440)
|..|+++++.
T Consensus 315 l~~LDLSD~v 324 (419)
T KOG2120|consen 315 LVHLDLSDSV 324 (419)
T ss_pred eeeecccccc
Confidence 9999998764
|
|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >smart00579 FBD domain in FBox and BRCT domain containing plant proteins | Back alignment and domain information |
|---|
| >PF08387 FBD: FBD; InterPro: IPR013596 This region is found in F-box (IPR001810 from INTERPRO) and other domain containing plant proteins; it is repeated in two family members | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 440 | |||
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 3e-04 |
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 | Back alignment and structure |
|---|
Score = 37.6 bits (88), Expect = 3e-04
Identities = 14/54 (25%), Positives = 21/54 (38%), Gaps = 7/54 (12%)
Query: 20 NRGNADRISSLPDSVLCHILSYIPTKHVVATSVIAKRWKNVWTAVPNLSFDDRL 73
SLPD +L I S + ++ S + KRW L+ D+ L
Sbjct: 2 ENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWY-------RLASDESL 48
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 440 | |||
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.78 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.76 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.57 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.87 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.8 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.74 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.73 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 98.72 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.7 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.63 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.62 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.61 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.56 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.49 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.47 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.44 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.41 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.4 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.39 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.39 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.36 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.35 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.34 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.34 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.33 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.32 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.3 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.3 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.29 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.29 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.29 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.28 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.27 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.26 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.25 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.24 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.24 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.24 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.24 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.23 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.23 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.22 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.21 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.21 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.19 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.16 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.15 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.15 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.14 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.14 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.13 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.13 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.13 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.1 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.1 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.09 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.08 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.06 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.04 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.04 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.03 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 98.02 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.99 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.99 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.99 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.97 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.97 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.96 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.95 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.95 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.94 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 97.94 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 97.94 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.93 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.92 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.92 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.91 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.9 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.88 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.86 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.86 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.83 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.83 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.8 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.8 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.8 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 97.79 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.78 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.77 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.77 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.75 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.72 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.71 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.7 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.68 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.68 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.67 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.65 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.65 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.58 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.57 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.56 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.5 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 97.48 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 97.47 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.47 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.4 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.35 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.34 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.33 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.26 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.25 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.25 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.23 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.17 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.16 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 97.15 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.13 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.11 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.07 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.03 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 96.91 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 96.87 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 96.82 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 96.81 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 96.79 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 96.75 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 96.74 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 96.72 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 96.67 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 96.67 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 96.44 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 96.37 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 96.31 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 96.28 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 96.18 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 96.15 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 95.59 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 95.59 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 95.52 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 95.47 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 95.29 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 95.22 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 95.18 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 94.87 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 94.82 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 94.44 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 94.42 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 94.15 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 92.87 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 92.8 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 92.47 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 92.43 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 92.08 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 91.84 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 91.73 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 87.87 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 85.18 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 81.41 |
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
Probab=99.78 E-value=7.1e-20 Score=188.79 Aligned_cols=36 Identities=22% Similarity=0.480 Sum_probs=33.1
Q ss_pred CCCChHHHHHHhcCC-CchhhhhhhccccchHHHhcc
Q 041388 28 SSLPDSVLCHILSYI-PTKHVVATSVIAKRWKNVWTA 63 (440)
Q Consensus 28 s~LPd~lL~~Ils~L-~~~d~~rts~lsrrWr~lw~~ 63 (440)
++||||++.+||+|| +.+|+++++.|||||++++..
T Consensus 14 ~~LPdeil~~I~~~L~~~~d~~~~s~vck~W~~~~~~ 50 (592)
T 3ogk_B 14 VATVDDVIEQVMTYITDPKDRDSASLVCRRWFKIDSE 50 (592)
T ss_dssp CCCGGGTHHHHHTTCCCHHHHHHHTTSCHHHHHHHHH
T ss_pred CCCCHHHHHHHHHhcCCHHHHHHHHHHhHHHHHhhhc
Confidence 489999999999999 799999999999999998643
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 440 | ||||
| d1nexb1 | 100 | a.158.1.1 (B:270-369) Cdc4 F-box and linker domain | 2e-06 | |
| d2ovrb1 | 102 | a.158.1.1 (B:2263-2364) F-box/WD repeat-containing | 2e-06 | |
| d1fs1a1 | 41 | a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ | 0.002 |
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: F-box domain superfamily: F-box domain family: F-box domain domain: Cdc4 F-box and linker domains species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 43.9 bits (103), Expect = 2e-06
Identities = 10/52 (19%), Positives = 25/52 (48%), Gaps = 2/52 (3%)
Query: 25 DRISSLPDSVLCHILSYIPTKHVVATSVIAKRWKNVWTAVPNLSFDDRLCLR 76
D I+SLP + I +Y+ + ++ + +++ W + +L +L +
Sbjct: 4 DLITSLPFEISLKIFNYLQFEDIINSLGVSQNWNKIIRKSTSLW--KKLLIS 53
|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 440 | |||
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 98.98 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.74 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.64 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 98.62 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.49 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.33 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.21 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.2 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.88 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.87 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.85 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.84 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.78 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.77 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.59 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.51 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.41 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.29 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.25 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.24 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.21 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 97.15 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 96.97 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 96.97 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 96.88 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 96.78 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 96.71 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.63 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 96.59 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 96.4 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 95.83 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 95.06 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 95.01 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 94.89 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 93.31 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 92.46 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 90.62 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 90.19 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 87.19 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 86.57 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 86.04 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 82.74 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 82.02 |
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: F-box domain superfamily: F-box domain family: F-box domain domain: Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.98 E-value=1.1e-10 Score=71.96 Aligned_cols=35 Identities=31% Similarity=0.481 Sum_probs=32.8
Q ss_pred CCCCChHHHHHHhcCCCchhhhhhhccccchHHHh
Q 041388 27 ISSLPDSVLCHILSYIPTKHVVATSVIAKRWKNVW 61 (440)
Q Consensus 27 is~LPd~lL~~Ils~L~~~d~~rts~lsrrWr~lw 61 (440)
++.||+||+.+||++||.+|+++++.|||+|+++.
T Consensus 1 f~~LP~eil~~If~~L~~~dl~~~~~Vcr~w~~l~ 35 (41)
T d1fs1a1 1 WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLA 35 (41)
T ss_dssp CCSSCHHHHHHHHTTSCGGGHHHHHTTCHHHHHHH
T ss_pred CCcCCHHHHHHHHHcCCHHHHHHHHHHHHHHHHHh
Confidence 36899999999999999999999999999999865
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|