Citrus Sinensis ID: 041426

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MDNDKLVKLRPFVRNFLKKASSMFEMYVCTMGTQCYATAAVKVLDSNSKYFNSRIIAQEDFKVKDRKNLDLVLSQERGTVILDDTESVWSDHTKNLKVVENMTTLGTKK
ccccEEEEEcccHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHcccccccccEEEEEccccccccccccccccccccEEEEEcccccHHcccccEEEEcccEEccccc
ccccEEEEcccHHHHHHHHHHHHHEEEEEcccHHHHHHHHHHHccccccccccEEEEccccccccccccccccccccEEEEEEccccccccccccEEEEEEEEcccccc
mdndklvklrPFVRNFLKKASSMFEMYVCTMGTQCYATAAVKVLDSnskyfnsriiaqedfkvkdrknlDLVLsqergtvilddtesvwsdhTKNLKVVENMTTLGTKK
mdndklvklrpfvRNFLKKASSMFEMYVCTMGTQCYATAAVKVLDSNSKYFNSRIiaqedfkvkdrknldlvlsqergtvilddtesvwsdhtknlkvvenmttlgtkk
MDNDKLVKLRPFVRNFLKKASSMFEMYVCTMGTQCYATAAVKVLDSNSKYFNSRIIAQEDFKVKDRKNLDLVLSQERGTVILDDTESVWSDHTKNLKVVENMTTLGTKK
******VKLRPFVRNFLKKASSMFEMYVCTMGTQCYATAAVKVLDSNSKYFNSRIIAQEDFKVKDRKNLDLVLSQERGTVILDDTESVWSDHTKNLKVV**********
*DNDKLVKLRPFVRNFLKKASSMFEMYVCTMGTQCYATAAVKVLDSNSKYFNSRIIAQEDFKVKDRKNLDLVLSQERGTVILDDTESVWSDHTKNLKVVENMTTLGTKK
MDNDKLVKLRPFVRNFLKKASSMFEMYVCTMGTQCYATAAVKVLDSNSKYFNSRIIAQEDFKVKDRKNLDLVLSQERGTVILDDTESVWSDHTKNLKVVENMTTLGTKK
MDNDKLVKLRPFVRNFLKKASSMFEMYVCTMGTQCYATAAVKVLDSNSKYFNSRIIAQEDFKVKDRKNLDLVLSQERGTVILDDTESVWSDHTKNLKVVENMTTLGT**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDNDKLVKLRPFVRNFLKKASSMFEMYVCTMGTQCYATAAVKVLDSNSKYFNSRIIAQEDFKVKDRKNLDLVLSQERGTVILDDTESVWSDHTKNLKVVENMTTLGTKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query109 2.2.26 [Sep-21-2011]
Q00IB6 440 RNA polymerase II C-termi yes no 0.871 0.215 0.505 7e-23
Q8LL04 1241 RNA polymerase II C-termi no no 0.853 0.074 0.405 8e-15
Q8SV03 411 RNA polymerase II subunit yes no 0.844 0.223 0.382 1e-10
Q9P376 723 RNA polymerase II subunit yes no 0.853 0.128 0.319 8e-09
Q03254 732 RNA polymerase II subunit yes no 0.853 0.127 0.319 2e-08
Q7TSG2 960 RNA polymerase II subunit yes no 0.733 0.083 0.310 2e-06
Q9Y5B0 961 RNA polymerase II subunit no no 0.733 0.083 0.310 2e-06
Q5XIK8465 CTD small phosphatase-lik no no 0.816 0.191 0.263 0.0003
Q8BG15465 CTD small phosphatase-lik no no 0.816 0.191 0.263 0.0003
Q05D32466 CTD small phosphatase-lik no no 0.816 0.190 0.263 0.0003
>sp|Q00IB6|CPL4_ARATH RNA polymerase II C-terminal domain phosphatase-like 4 OS=Arabidopsis thaliana GN=CPL4 PE=1 SV=1 Back     alignment and function desciption
 Score =  105 bits (262), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 48/95 (50%), Positives = 65/95 (68%)

Query: 6   LVKLRPFVRNFLKKASSMFEMYVCTMGTQCYATAAVKVLDSNSKYFNSRIIAQEDFKVKD 65
           + KLRPFV +FLK+AS MF MY+ TMG + YA    K+LD   +YF  R+I+++D  V+ 
Sbjct: 176 MTKLRPFVHSFLKEASEMFVMYIYTMGDRNYARQMAKLLDPKGEYFGDRVISRDDGTVRH 235

Query: 66  RKNLDLVLSQERGTVILDDTESVWSDHTKNLKVVE 100
            K+LD+VL QE   +ILDDTE+ W  H  NL V+E
Sbjct: 236 EKSLDVVLGQESAVLILDDTENAWPKHKDNLIVIE 270
Processively dephosphorylates 'Ser-2' and/or 'Ser-5' of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit (RPB1). This promotes the activity of RNA polymerase II (By similarity). Required for normal plant growth.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 6
>sp|Q8LL04|CPL3_ARATH RNA polymerase II C-terminal domain phosphatase-like 3 OS=Arabidopsis thaliana GN=CPL3 PE=1 SV=2 Back     alignment and function description
>sp|Q8SV03|FCP1_ENCCU RNA polymerase II subunit A C-terminal domain phosphatase OS=Encephalitozoon cuniculi (strain GB-M1) GN=FCP1 PE=1 SV=1 Back     alignment and function description
>sp|Q9P376|FCP1_SCHPO RNA polymerase II subunit A C-terminal domain phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fcp1 PE=1 SV=1 Back     alignment and function description
>sp|Q03254|FCP1_YEAST RNA polymerase II subunit A C-terminal domain phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCP1 PE=1 SV=1 Back     alignment and function description
>sp|Q7TSG2|CTDP1_MOUSE RNA polymerase II subunit A C-terminal domain phosphatase OS=Mus musculus GN=Ctdp1 PE=1 SV=1 Back     alignment and function description
>sp|Q9Y5B0|CTDP1_HUMAN RNA polymerase II subunit A C-terminal domain phosphatase OS=Homo sapiens GN=CTDP1 PE=1 SV=3 Back     alignment and function description
>sp|Q5XIK8|CTSL2_RAT CTD small phosphatase-like protein 2 OS=Rattus norvegicus GN=Ctdspl2 PE=2 SV=1 Back     alignment and function description
>sp|Q8BG15|CTSL2_MOUSE CTD small phosphatase-like protein 2 OS=Mus musculus GN=Ctdspl2 PE=1 SV=1 Back     alignment and function description
>sp|Q05D32|CTSL2_HUMAN CTD small phosphatase-like protein 2 OS=Homo sapiens GN=CTDSPL2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
356564913 442 PREDICTED: RNA polymerase II C-terminal 0.935 0.230 0.490 1e-22
255570505 478 RNA polymerase II ctd phosphatase, putat 0.871 0.198 0.505 2e-22
356498756 428 PREDICTED: RNA polymerase II C-terminal 0.935 0.238 0.490 2e-22
297793317 1006 hypothetical protein ARALYDRAFT_332090 [ 0.871 0.094 0.515 3e-22
296088193 638 unnamed protein product [Vitis vinifera] 0.871 0.148 0.536 3e-22
296090640 264 unnamed protein product [Vitis vinifera] 0.871 0.359 0.536 4e-22
359494894 278 PREDICTED: RNA polymerase II C-terminal 0.871 0.341 0.536 4e-22
147774299 641 hypothetical protein VITISV_002430 [Viti 0.871 0.148 0.536 4e-22
359497210 278 PREDICTED: RNA polymerase II C-terminal 0.871 0.341 0.536 4e-22
224142399 312 predicted protein [Populus trichocarpa] 0.871 0.304 0.505 5e-22
>gi|356564913|ref|XP_003550691.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 4-like [Glycine max] Back     alignment and taxonomy information
 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 68/102 (66%)

Query: 6   LVKLRPFVRNFLKKASSMFEMYVCTMGTQCYATAAVKVLDSNSKYFNSRIIAQEDFKVKD 65
           + KLRPFVR FLK+AS MFEMY+ TMG + YA    K+LD   +YFN+++I+++D   K 
Sbjct: 190 MTKLRPFVRPFLKEASEMFEMYIYTMGDRPYALEMAKLLDPQGEYFNAKVISRDDGTQKH 249

Query: 66  RKNLDLVLSQERGTVILDDTESVWSDHTKNLKVVENMTTLGT 107
           +K LD+VL QE   +ILDDTE  W  H  NL ++E     G+
Sbjct: 250 QKGLDVVLGQESAVIILDDTEHAWMKHKDNLILMERYHFFGS 291

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255570505|ref|XP_002526210.1| RNA polymerase II ctd phosphatase, putative [Ricinus communis] gi|223534449|gb|EEF36151.1| RNA polymerase II ctd phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356498756|ref|XP_003518215.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 4-like [Glycine max] Back     alignment and taxonomy information
>gi|297793317|ref|XP_002864543.1| hypothetical protein ARALYDRAFT_332090 [Arabidopsis lyrata subsp. lyrata] gi|297310378|gb|EFH40802.1| hypothetical protein ARALYDRAFT_332090 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|296088193|emb|CBI35709.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|296090640|emb|CBI41034.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359494894|ref|XP_003634864.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147774299|emb|CAN76945.1| hypothetical protein VITISV_002430 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359497210|ref|XP_003635453.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224142399|ref|XP_002324546.1| predicted protein [Populus trichocarpa] gi|222865980|gb|EEF03111.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
TAIR|locus:4010714056 440 CPL4 "C-terminal domain phosph 0.871 0.215 0.505 3.3e-21
TAIR|locus:2090467296 AT3G17550 [Arabidopsis thalian 0.862 0.317 0.5 3.9e-21
TAIR|locus:2045044277 AT2G04930 [Arabidopsis thalian 0.834 0.328 0.483 2.1e-20
TAIR|locus:2012943 342 AT1G20320 [Arabidopsis thalian 0.862 0.274 0.489 3.5e-20
TAIR|locus:4515103095307 AT3G19595 [Arabidopsis thalian 0.816 0.289 0.472 1.7e-18
TAIR|locus:2162565306 AT5G54210 [Arabidopsis thalian 0.816 0.290 0.494 2.8e-18
TAIR|locus:2154458302 AT5G23470 [Arabidopsis thalian 0.944 0.341 0.438 7.5e-18
TAIR|locus:2056256302 AT2G02290 [Arabidopsis thalian 0.834 0.301 0.430 1.8e-15
TAIR|locus:2194656221 AT1G43600 [Arabidopsis thalian 0.816 0.402 0.417 2.6e-15
TAIR|locus:2194666255 AT1G43610 [Arabidopsis thalian 0.816 0.349 0.417 2.6e-15
TAIR|locus:4010714056 CPL4 "C-terminal domain phosphatase-like 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 253 (94.1 bits), Expect = 3.3e-21, P = 3.3e-21
 Identities = 48/95 (50%), Positives = 65/95 (68%)

Query:     6 LVKLRPFVRNFLKKASSMFEMYVCTMGTQCYATAAVKVLDSNSKYFNSRIIAQEDFKVKD 65
             + KLRPFV +FLK+AS MF MY+ TMG + YA    K+LD   +YF  R+I+++D  V+ 
Sbjct:   176 MTKLRPFVHSFLKEASEMFVMYIYTMGDRNYARQMAKLLDPKGEYFGDRVISRDDGTVRH 235

Query:    66 RKNLDLVLSQERGTVILDDTESVWSDHTKNLKVVE 100
              K+LD+VL QE   +ILDDTE+ W  H  NL V+E
Sbjct:   236 EKSLDVVLGQESAVLILDDTENAWPKHKDNLIVIE 270
GO:0004721 "phosphoprotein phosphatase activity" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IEA;IDA
GO:0008022 "protein C-terminus binding" evidence=IPI
GO:0009651 "response to salt stress" evidence=IEP
TAIR|locus:2090467 AT3G17550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045044 AT2G04930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012943 AT1G20320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515103095 AT3G19595 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162565 AT5G54210 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154458 AT5G23470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056256 AT2G02290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2194656 AT1G43600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2194666 AT1G43610 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.30.691
3rd Layer3.1.3.16LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
TIGR02250156 TIGR02250, FCP1_euk, FCP1-like phosphatase, phosph 3e-36
smart00577148 smart00577, CPDc, catalytic domain of ctd-like pho 3e-27
pfam03031153 pfam03031, NIF, NLI interacting factor-like phosph 3e-18
TIGR02251162 TIGR02251, HIF-SF_euk, Dullard-like phosphatase do 1e-09
COG5190 390 COG5190, FCP1, TFIIF-interacting CTD phosphatases, 1e-04
>gnl|CDD|131304 TIGR02250, FCP1_euk, FCP1-like phosphatase, phosphatase domain Back     alignment and domain information 
 Score =  120 bits (302), Expect = 3e-36
 Identities = 44/96 (45%), Positives = 62/96 (64%), Gaps = 1/96 (1%)

Query: 6   LVKLRPFVRNFLKKASSMFEMYVCTMGTQCYATAAVKVLDSNSKYFNSRIIAQEDFKVKD 65
           L KLRPF+  FLK+AS ++EM+V TMGT+ YA A  K++D + KYF  RII++++     
Sbjct: 56  LTKLRPFLHEFLKEASKLYEMHVYTMGTRAYAQAIAKLIDPDGKYFGDRIISRDESGSPH 115

Query: 66  RKNL-DLVLSQERGTVILDDTESVWSDHTKNLKVVE 100
            K+L  L  + E   VI+DD E VW  H +NL  +E
Sbjct: 116 TKSLLRLFPADESMVVIIDDREDVWPWHKRNLIQIE 151

This model represents the phosphatase domain of the humanRNA polymerase II subunit A C-terminal domain phosphatase (FCP1, ) and closely related phosphatases from eukaryotes including plants, fungi and slime mold. This domain is a member of the haloacid dehalogenase (HAD) superfamily by virtue of a conserved set of three catalytic motifs and a conserved fold as predicted by PSIPRED. The third motif in this family is distinctive (hhhhDDppphW). This domain is classified as a "Class III" HAD, since there is no large "cap" domain found between motifs 1 and 2 or motifs 2 and 3.This domain is related to domains found in the human NLI interacting factor-like phosphatases, and together both are detected by the pfam03031. Length = 156
>gnl|CDD|214729 smart00577, CPDc, catalytic domain of ctd-like phosphatases Back     alignment and domain information
>gnl|CDD|217328 pfam03031, NIF, NLI interacting factor-like phosphatase Back     alignment and domain information
>gnl|CDD|233801 TIGR02251, HIF-SF_euk, Dullard-like phosphatase domain Back     alignment and domain information
>gnl|CDD|227517 COG5190, FCP1, TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 109
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 100.0
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 99.96
KOG1605262 consensus TFIIF-interacting CTD phosphatase, inclu 99.96
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 99.96
KOG0323 635 consensus TFIIF-interacting CTD phosphatases, incl 99.95
TIGR02245195 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase 99.91
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 99.85
KOG2832393 consensus TFIIF-interacting CTD phosphatase, inclu 99.83
COG5190390 FCP1 TFIIF-interacting CTD phosphatases, including 99.78
COG5190 390 FCP1 TFIIF-interacting CTD phosphatases, including 99.16
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 97.73
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 97.68
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 97.52
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 97.47
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 97.44
PRK09449224 dUMP phosphatase; Provisional 97.37
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 97.36
PLN02770248 haloacid dehalogenase-like hydrolase family protei 97.29
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 97.27
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 97.24
PRK14988224 GMP/IMP nucleotidase; Provisional 97.22
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 97.22
PRK13288214 pyrophosphatase PpaX; Provisional 97.21
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 97.2
PRK10563221 6-phosphogluconate phosphatase; Provisional 97.18
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 97.17
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 97.15
PRK13222226 phosphoglycolate phosphatase; Provisional 97.13
PRK11587218 putative phosphatase; Provisional 96.95
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 96.93
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 96.9
PRK13226229 phosphoglycolate phosphatase; Provisional 96.87
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 96.87
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 96.8
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 96.8
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 96.8
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 96.8
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 96.78
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 96.73
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 96.65
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 96.64
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 96.59
PLN02575381 haloacid dehalogenase-like hydrolase 96.58
PRK13223272 phosphoglycolate phosphatase; Provisional 96.58
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 96.58
COG0637221 Predicted phosphatase/phosphohexomutase [General f 96.57
PLN02779286 haloacid dehalogenase-like hydrolase family protei 96.57
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 96.56
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 96.55
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 96.53
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 96.51
PRK13225273 phosphoglycolate phosphatase; Provisional 96.4
PRK13582205 thrH phosphoserine phosphatase; Provisional 96.35
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 96.32
PLN02940 382 riboflavin kinase 96.32
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 96.29
PHA02530300 pseT polynucleotide kinase; Provisional 96.28
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 96.19
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 96.13
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 95.96
PHA02597197 30.2 hypothetical protein; Provisional 95.96
TIGR01684301 viral_ppase viral phosphatase. These proteins also 95.87
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 95.87
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 95.69
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 95.6
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 95.48
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 95.48
PHA03398303 viral phosphatase superfamily protein; Provisional 95.39
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 95.35
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 95.28
COG4996164 Predicted phosphatase [General function prediction 95.22
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 95.15
COG0546220 Gph Predicted phosphatases [General function predi 94.78
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 94.58
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 94.56
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 94.54
KOG3109244 consensus Haloacid dehalogenase-like hydrolase [Ge 94.53
PRK10748238 flavin mononucleotide phosphatase; Provisional 94.36
PLN02811220 hydrolase 94.33
PF06941191 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol 94.02
TIGR02244343 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd 93.74
PLN02954224 phosphoserine phosphatase 93.64
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 93.33
PRK06769173 hypothetical protein; Validated 93.23
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 93.19
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 92.42
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 91.24
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 90.16
TIGR01459 242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 89.7
PRK11590211 hypothetical protein; Provisional 89.34
PF05152297 DUF705: Protein of unknown function (DUF705); Inte 87.71
COG4359220 Uncharacterized conserved protein [Function unknow 87.52
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 87.07
PF05761 448 5_nucleotid: 5' nucleotidase family; InterPro: IPR 86.79
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 85.88
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 85.76
COG4502180 5'(3')-deoxyribonucleotidase [Nucleotide transport 84.26
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 83.78
KOG1615227 consensus Phosphoserine phosphatase [Amino acid tr 82.68
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 82.64
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 82.29
PRK11133322 serB phosphoserine phosphatase; Provisional 82.03
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 81.3
PRK08238 479 hypothetical protein; Validated 81.04
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information 
Probab=100.00  E-value=1.3e-33  Score=198.14  Aligned_cols=103  Identities=42%  Similarity=0.640  Sum_probs=97.2

Q ss_pred             cceeEEECccHHHHHHHhhcCccEEEEeCCchhhHHHHHHHhcCCCCcccceEEeecCCCCCceeccCc-CCCCCCcEEE
Q 041426            3 NDKLVKLRPFVRNFLKKASSMFEMYVCTMGTQCYATAAVKVLDSNSKYFNSRIIAQEDFKVKDRKNLDL-VLSQERGTVI   81 (109)
Q Consensus         3 ~~~~v~~RP~~~~FL~~l~~~fei~i~T~~~~~YA~~i~~~lDp~~~~f~~r~~~r~~~~~~~~KdL~~-l~~~~~~vii   81 (109)
                      ...++++|||+.+||++|++.||++|||+++++||++|++.|||.+.+|++|+++|++|...++|||+. ++++++++||
T Consensus        53 ~~~~v~~rPgv~efL~~l~~~yel~I~T~~~~~yA~~vl~~ldp~~~~F~~ri~~rd~~~~~~~KdL~~i~~~d~~~vvi  132 (156)
T TIGR02250        53 MWYLTKLRPFLHEFLKEASKLYEMHVYTMGTRAYAQAIAKLIDPDGKYFGDRIISRDESGSPHTKSLLRLFPADESMVVI  132 (156)
T ss_pred             eEEEEEECCCHHHHHHHHHhhcEEEEEeCCcHHHHHHHHHHhCcCCCeeccEEEEeccCCCCccccHHHHcCCCcccEEE
Confidence            357899999999999999999999999999999999999999999989999999988888779999954 5889999999


Q ss_pred             EcCCchhhccCCCCeEEeCccccc
Q 041426           82 LDDTESVWSDHTKNLKVVENMTTL  105 (109)
Q Consensus        82 vDd~~~~~~~~~~N~i~i~~~~~~  105 (109)
                      |||+|++|..||+|+|+|+||.||
T Consensus       133 vDd~~~~~~~~~~N~i~i~~~~~f  156 (156)
T TIGR02250       133 IDDREDVWPWHKRNLIQIEPYNYF  156 (156)
T ss_pred             EeCCHHHhhcCccCEEEeCCcccC
Confidence            999999999999999999999998

This domain is related to domains found in the human NLI interacting factor-like phosphatases, and together both are detected by the Pfam model pfam03031.
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>KOG1605 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>KOG2832 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] Back     alignment and domain information
>COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG4996 Predicted phosphatase [General function prediction only] Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins Back     alignment and domain information
>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>PF05761 5_nucleotid: 5' nucleotidase family; InterPro: IPR008380 This family includes a 5'-nucleotidase, 3 Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>COG4502 5'(3')-deoxyribonucleotidase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
3ef0_A 372 The Structure Of Fcp1, An Essential Rna Polymerase 7e-11
3ef1_A 442 The Structure Of Fcp1, An Essential Rna Polymerase 5e-10
>pdb|3EF0|A Chain A, The Structure Of Fcp1, An Essential Rna Polymerase Ii Ctd Phosphatase Length = 372 Back     alignment and structure 
Iteration: 1

 Score = 62.0 bits (149), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
Query: 7   VKLRPFVRNFLKKASSMFEMYVCTMGTQCYATAAVKVLDSNSKYFNSRIIAQEDFKVKDR 66
           +K RP +  FL+K S ++E+++ TMGT+ YA    K++D   K F  R+++++D     +
Sbjct: 74  IKFRPGLAQFLQKISELYELHIYTMGTKAYAKEVAKIIDPTGKLFQDRVLSRDDSGSLAQ 133
Query: 67  KNLDLVLSQERG-TVILDDTESVWSDHTKNLKVV 99
           K+L  +   +    V++DD   VW  +   +KVV
Sbjct: 134 KSLRRLFPCDTSMVVVIDDRGDVWDWNPNLIKVV 167
>pdb|3EF1|A Chain A, The Structure Of Fcp1, An Essential Rna Polymerase Ii Ctd Phosphatase Length = 442 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 3e-23
3ef1_A 442 RNA polymerase II subunit A C-terminal domain phos 6e-22
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 1e-11
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 2e-09
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 6e-09
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 2e-05
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Length = 372 Back     alignment and structure
 Score = 90.6 bits (224), Expect = 3e-23
 Identities = 30/95 (31%), Positives = 54/95 (56%), Gaps = 1/95 (1%)

Query: 6   LVKLRPFVRNFLKKASSMFEMYVCTMGTQCYATAAVKVLDSNSKYFNSRIIAQEDFKVKD 65
            +K RP +  FL+K S ++E+++ TMGT+ YA    K++D   K F  R+++++D     
Sbjct: 73  YIKFRPGLAQFLQKISELYELHIYTMGTKAYAKEVAKIIDPTGKLFQDRVLSRDDSGSLA 132

Query: 66  RKNLDLVLSQE-RGTVILDDTESVWSDHTKNLKVV 99
           +K+L  +   +    V++DD   VW  +   +KVV
Sbjct: 133 QKSLRRLFPCDTSMVVVIDDRGDVWDWNPNLIKVV 167
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442 Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Length = 204 Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Length = 195 Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Length = 181 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Length = 320 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
3ef1_A 442 RNA polymerase II subunit A C-terminal domain phos 100.0
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 99.98
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 99.97
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 99.94
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 99.93
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 99.92
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 97.5
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 97.45
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 97.38
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 97.34
3ib6_A189 Uncharacterized protein; structural genomics, unkn 97.34
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 97.33
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 97.33
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 97.31
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 97.3
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 97.25
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 97.24
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 97.23
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 97.21
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 97.2
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 97.2
3sd7_A240 Putative phosphatase; structural genomics, haloaci 97.19
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 97.17
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 97.14
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 97.13
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 97.13
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 97.11
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 97.04
2hsz_A243 Novel predicted phosphatase; structural genomics, 97.04
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 97.03
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 97.01
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 97.01
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 96.97
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 96.96
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 96.92
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 96.92
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 96.92
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 96.91
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 96.89
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 96.88
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 96.84
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 96.76
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 96.76
3fvv_A232 Uncharacterized protein; unknown function, structu 96.72
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 96.71
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 96.67
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 96.66
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 96.54
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 96.54
1te2_A226 Putative phosphatase; structural genomics, phospha 96.53
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 96.51
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 96.49
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 96.43
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 96.41
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 96.39
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 96.3
2zg6_A220 Putative uncharacterized protein ST2620, probable 96.29
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 96.29
2p11_A231 Hypothetical protein; putative haloacid dehalogena 96.27
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 96.24
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 96.23
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 96.16
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 96.12
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 96.06
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 96.01
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 96.0
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 95.97
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 95.75
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 95.54
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 95.53
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 95.52
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 95.49
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 95.42
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 95.32
2o2x_A218 Hypothetical protein; structural genomics, joint c 95.28
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 95.27
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 95.12
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 95.06
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 95.03
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 94.89
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 94.81
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 93.79
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 94.76
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 94.66
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 94.57
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 94.57
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 94.57
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 94.55
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 94.46
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 94.39
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 94.22
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 93.72
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 92.85
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 92.07
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 91.26
4gxt_A385 A conserved functionally unknown protein; structur 90.76
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 89.2
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 88.52
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 87.61
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 86.86
2jc9_A 555 Cytosolic purine 5'-nucleotidase; cytosolic 5-prim 85.52
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 85.45
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 84.8
3mmz_A176 Putative HAD family hydrolase; structural genomics 84.15
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 83.45
3mn1_A189 Probable YRBI family phosphatase; structural genom 82.02
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=3.6e-34  Score=226.75  Aligned_cols=104  Identities=29%  Similarity=0.478  Sum_probs=98.5

Q ss_pred             cceeEEECccHHHHHHHhhcCccEEEEeCCchhhHHHHHHHhcCCCCcccceEEeecCCCCCceeccCcC-CCCCCcEEE
Q 041426            3 NDKLVKLRPFVRNFLKKASSMFEMYVCTMGTQCYATAAVKVLDSNSKYFNSRIIAQEDFKVKDRKNLDLV-LSQERGTVI   81 (109)
Q Consensus         3 ~~~~v~~RP~~~~FL~~l~~~fei~i~T~~~~~YA~~i~~~lDp~~~~f~~r~~~r~~~~~~~~KdL~~l-~~~~~~vii   81 (109)
                      ..+||++|||+++||++|+++|||+|||+|.+.||++|++.|||++.+|++|+++|++|...++|||+.| ++++++|||
T Consensus        78 ~~~~V~~RPgl~eFL~~ls~~yEivIfTas~~~YA~~Vl~~LDp~~~~f~~Rl~sRd~cg~~~~KdL~~ll~rdl~~vvI  157 (442)
T 3ef1_A           78 SCYYIKFRPGLAQFLQKISELYELHIYTMGTKAYAKEVAKIIDPTGKLFQDRVLSRDDSGSLAQKSLRRLFPCDTSMVVV  157 (442)
T ss_dssp             EEEEEEECTTHHHHHHHHTTTEEEEEECSSCHHHHHHHHHHHCTTSTTTTTCEECTTTSSCSSCCCGGGTCSSCCTTEEE
T ss_pred             eEEEEEeCCCHHHHHHHHhCCcEEEEEcCCCHHHHHHHHHHhccCCccccceEEEecCCCCceeeehHHhcCCCcceEEE
Confidence            3699999999999999999999999999999999999999999999999999998888876689999965 999999999


Q ss_pred             EcCCchhhccCCCCeEEeCccccccc
Q 041426           82 LDDTESVWSDHTKNLKVVENMTTLGT  107 (109)
Q Consensus        82 vDd~~~~~~~~~~N~i~i~~~~~~~~  107 (109)
                      |||+|.+|..|| |+|+|+||+||..
T Consensus       158 IDd~p~~~~~~p-N~I~I~~~~fF~~  182 (442)
T 3ef1_A          158 IDDRGDVWDWNP-NLIKVVPYEFFVG  182 (442)
T ss_dssp             EESCSGGGTTCT-TEEECCCCCCSTT
T ss_pred             EECCHHHhCCCC-CEEEcCCccccCC
Confidence            999999999997 9999999999975
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>2jc9_A Cytosolic purine 5'-nucleotidase; cytosolic 5-prime nucleotidase II, GMP-IMP specific nucleotidase, CN-II, NT5C2, hydrolase, polymorphism; HET: ADN; 1.5A {Homo sapiens} PDB: 2j2c_A* 2xje_A* 2xjf_A* 2jcm_A* 2xcw_A* 2xcv_A* 2xcx_A 2xjb_A* 2xjc_A* 2xjd_A* Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 109
d1ta0a_181 c.108.1.16 (A:) Carboxy-terminal domain RNA polyme 8e-16
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 181 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NLI interacting factor-like phosphatase
domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 67.0 bits (163), Expect = 8e-16
 Identities = 22/97 (22%), Positives = 38/97 (39%), Gaps = 1/97 (1%)

Query: 1   MDNDKLVKLRPFVRNFLKKASSMFEMYVCTMGTQCYATAAVKVLDSNSKYFNSRIIAQED 60
           + +   V  RP V  FL++   +FE  + T     YA     +LD    +          
Sbjct: 48  VVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCV 107

Query: 61  F-KVKDRKNLDLVLSQERGTVILDDTESVWSDHTKNL 96
           F +    K+L  +    R  +ILD++ + +  H  N 
Sbjct: 108 FHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNA 144

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 99.97
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 97.68
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 97.68
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 97.67
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 97.63
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 97.58
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 97.49
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 97.48
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 97.42
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 97.41
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 97.01
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 97.0
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 96.98
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 96.81
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 96.77
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 95.7
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 95.6
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 95.4
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 95.28
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 94.41
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 94.39
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 94.11
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 93.54
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 93.47
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 91.69
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 90.82
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 89.59
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NLI interacting factor-like phosphatase
domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=1.5e-32  Score=193.22  Aligned_cols=102  Identities=24%  Similarity=0.287  Sum_probs=91.0

Q ss_pred             ceeEEECccHHHHHHHhhcCccEEEEeCCchhhHHHHHHHhcCCCCcccceEEeecCCCC--CceeccCcCCCCCCcEEE
Q 041426            4 DKLVKLRPFVRNFLKKASSMFEMYVCTMGTQCYATAAVKVLDSNSKYFNSRIIAQEDFKV--KDRKNLDLVLSQERGTVI   81 (109)
Q Consensus         4 ~~~v~~RP~~~~FL~~l~~~fei~i~T~~~~~YA~~i~~~lDp~~~~f~~r~~~r~~~~~--~~~KdL~~l~~~~~~vii   81 (109)
                      .++|++|||+++||++++++|||+|||+|+++||++|++.|||++. |..++++.+|...  .++|||+.+++++++|||
T Consensus        51 ~~~v~~RP~l~eFL~~l~~~yei~I~Ta~~~~YA~~il~~ldp~~~-~~~~~~r~~c~~~~~~~~KdL~~l~~~l~~vvi  129 (181)
T d1ta0a_          51 QVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGA-FRARLFRESCVFHRGNYVKDLSRLGRDLRRVLI  129 (181)
T ss_dssp             EEEEEECTTHHHHHHHHHHHSEEEEECSSCHHHHHHHHHHHCSSCC-EEEEECGGGSEEETTEEECCGGGSCSCGGGEEE
T ss_pred             eeEEecCCCHHHHHHHHHhceEEEEEcCCcHHHHHHHHHHhccCCc-eeEEEEeeeeeecCCcccccHhhcCCCHHHeEE
Confidence            5799999999999999999999999999999999999999999975 5566666555433  378999999999999999


Q ss_pred             EcCCchhhccCCCCeEEeCcccccc
Q 041426           82 LDDTESVWSDHTKNLKVVENMTTLG  106 (109)
Q Consensus        82 vDd~~~~~~~~~~N~i~i~~~~~~~  106 (109)
                      |||++.+|..||+|+|+|++|..-+
T Consensus       130 vDd~~~~~~~~~~N~I~I~~f~~~~  154 (181)
T d1ta0a_         130 LDNSPASYVFHPDNAVPVASWFDNM  154 (181)
T ss_dssp             ECSCGGGGTTCGGGBCCCCCCSSCT
T ss_pred             EcCChhhhhcCccCeeEecCcCCCC
Confidence            9999999999999999999997543
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure