Citrus Sinensis ID: 041463


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350------
NQTELRTLVLNKARISDTIPDWFWQLSLTLDELDVAYNELRGRVPNSLGFNFPATVDLSSNNFEGRLPLCIPKSIGNLKQLITLVISNNNLSGEIPLLFSNSSFLYILDMSNNSLSGSIPESIGSLRTLRFLVLRNNYLSGELPLSLKNCTFMESLDLGDNNLSGNIPAWIGASMPGLLHILDLSHNDLSGFIPPRVGNLSDMKVEPPKSVQHEGRLRVVTKGSERKYFTTLYLVNLLDLSSTNLSAEIPAELTSLVHLGTLNLSHNHLVGKIPEEIGNFEWLETLDLSKNKLSGSIPPSMASLIFMNHLNLSYNNLSGEIPNTNQFQTLNDPSIYEGNLALCGDPLPKKCPENGG
ccccccEEEcccccccccccHHHHHccccccEEEccccccEEccccccccccccEEEcccccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEccccccccccccEEEccccEEEEEccHHccccccccEEEcccccccccccccHHHHccccccEEEccccccccccccccccccccccccccccEEEEEEEEEEccccEEEccccccccEEEcccccccccccHHHHccccccccccccccccccccHHHHccccccEEcccccccccccHHHHccccccccccccccccEEccccccccccccccccccccccccccccccccccccc
ccccccEEEcccccccccccHHHHcccccccEEEcccccccccccHHccccccEEEEcccccccccccccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHcccccccEEEcccccccccccHHHHHccHHcccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccHHHcccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHcccccccHHHHHcccccccccccccccccccc
NQTELRTLVLNKArisdtipdwfWQLSLTLDELDVAYNElrgrvpnslgfnfpatvdlssnnfegrlplcipksigNLKQLITLVISnnnlsgeipllfsnsSFLYILDMsnnslsgsipesigsLRTLRFLVLRNNylsgelplslknctfmesldlgdnnlsgnipawigasmpgLLHILDLshndlsgfipprvgnlsdmkveppksvqhegrlrvvtkgserkYFTTLYLVNLLdlsstnlsaeipaELTSLVHLgtlnlshnhlvgkipeeignfewlETLDlsknklsgsippsmASLIFMNHLNLSynnlsgeipntnqfqtlndpsiyegnlalcgdplpkkcpengg
NQTELRTLVLnkarisdtipdwFWQLSLTLDELDVAYNELRGRVPNSLGFNFPATVDLSSNNFEGRLPLCIPKSIGNLKQLITLVISNNNLSGEIPLLFSNSSFLYILDMSNNSLSGSIPESIGSLRTLRFLVLRNNYLSGELPLSLKNCTFMESLDLGDNNLSGNIPAWIGASMPGLLHILDLSHNDLSGFIPPRVGNLSDMkveppksvqhegrlrvvtkgserkyFTTLYLVNLLDLSSTNLSAEIPAELTSLVHLGTLNLSHNHLVGKIPEEIGNFEWLETLDLSKNKLSGSIPPSMASLIFMNHLNLSYNNLSGEIPNTNQFQTLNDPSIYEGNLAlcgdplpkkcpengg
NQTELRTLVLNKARISDTIPDWFWQLSLTLDELDVAYNELRGRVPNSLGFNFPATVDLSSNNFEGRLPLCIPKSIGNLKQLITLVISNNNLSGEIPLLFSNSSFLYILDMSNNSLSGSIPESIGSLRTLRFLVLRNNYLSGELPLSLKNCTFMESLDLGDNNLSGNIPAWIGASMPGLLHILDLSHNDLSGFIPPRVGNLSDMKVEPPKSVQHEGRLRVVTKGSERKYFTTLYLVNLLDLSSTNLSAEIPAELTSLVHLGTLNLSHNHLVGKIPEEIGNFEWLETLDLSKNKLSGSIPPSMASLIFMNHLNLSYNNLSGEIPNTNQFQTLNDPSIYEGNLALCGDPLPKKCPENGG
******TLVLNKARISDTIPDWFWQLSLTLDELDVAYNELRGRVPNSLGFNFPATVDLSSNNFEGRLPLCIPKSIGNLKQLITLVISNNNLSGEIPLLFSNSSFLYILDMSNNSLSGSIPESIGSLRTLRFLVLRNNYLSGELPLSLKNCTFMESLDLGDNNLSGNIPAWIGASMPGLLHILDLSHNDLSGFIPPRV*******************LRVVTKGSERKYFTTLYLVNLLDLSSTNLSAEIPAELTSLVHLGTLNLSHNHLVGKIPEEIGNFEWLETLDLSKNKLSGSIPPSMASLIFMNHLNLSYNNLSGEIPNTNQFQTLNDPSIYEGNLALCG************
NQTELRTLVLNKARISDTIPDWFWQLSLTLDELDVAYNELRGRVPNSLGFNFPATVDLSSNNFEGRLPLCIPKSIGNLKQLITLVISNNNLSGEIPLLFSNSSFLYILDMSNNSLSGSIPESIGSLRTLRFLVLRNNYLSGELPLSLKNCTFMESLDLGDNNLSGNIPAWIGASMPGLLHILDLSHNDLSGFIPPRVGNLSDMKVEPPKSVQHEGRLRVVTKGSERKYFTTLYLVNLLDLSSTNLSAEIPAELTSLVHLGTLNLSHNHLVGKIPEEIGNFEWLETLDLSKNKLSGSIPPSMASLIFMNHLNLSYNNLSGEIPNTNQFQTLNDPSIYEGNLALCGDPL**K******
NQTELRTLVLNKARISDTIPDWFWQLSLTLDELDVAYNELRGRVPNSLGFNFPATVDLSSNNFEGRLPLCIPKSIGNLKQLITLVISNNNLSGEIPLLFSNSSFLYILDMSNNSLSGSIPESIGSLRTLRFLVLRNNYLSGELPLSLKNCTFMESLDLGDNNLSGNIPAWIGASMPGLLHILDLSHNDLSGFIPPRVGNLSDMKVEPPKSVQHEGRLRVVTKGSERKYFTTLYLVNLLDLSSTNLSAEIPAELTSLVHLGTLNLSHNHLVGKIPEEIGNFEWLETLDLSKNKLSGSIPPSMASLIFMNHLNLSYNNLSGEIPNTNQFQTLNDPSIYEGNLALCGDPLPKKCPENGG
*QTELRTLVLNKARISDTIPDWFWQLSLTLDELDVAYNELRGRVPNSLGFNFPATVDLSSNNFEGRLPLCIPKSIGNLKQLITLVISNNNLSGEIPLLFSNSSFLYILDMSNNSLSGSIPESIGSLRTLRFLVLRNNYLSGELPLSLKNCTFMESLDLGDNNLSGNIPAWIGASMPGLLHILDLSHNDLSGFIPPRVGNLSDMKVEPPKSVQHEGRLRVVTKGSERKYFTTLYLVNLLDLSSTNLSAEIPAELTSLVHLGTLNLSHNHLVGKIPEEIGNFEWLETLDLSKNKLSGSIPPSMASLIFMNHLNLSYNNLSGEIPNTNQFQTLNDPSIYEGNLALCGDPLPK*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NQTELRTLVLNKARISDTIPDWFWQLSLTLDELDVAYNELRGRVPNSLGFNFPATVDLSSNNFEGRLPLCIPKSIGNLKQLITLVISNNNLSGEIPLLFSNSSFLYILDMSNNSLSGSIPESIGSLRTLRFLVLRNNYLSGELPLSLKNCTFMESLDLGDNNLSGNIPAWIGASMPGLLHILDLSHNDLSGFIPPRVGNLSDMKVEPPKSVQHEGRLRVVTKGSERKYFTTLYLVNLLDLSSTNLSAEIPAELTSLVHLGTLNLSHNHLVGKIPEEIGNFEWLETLDLSKNKLSGSIPPSMASLIFMNHLNLSYNNLSGEIPNTNQFQTLNDPSIYEGNLALCGDPLPKKCPENGG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query356 2.2.26 [Sep-21-2011]
Q9LYN8 1192 Leucine-rich repeat recep no no 0.924 0.276 0.370 2e-42
Q9FL28 1173 LRR receptor-like serine/ no no 0.943 0.286 0.352 8e-41
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.960 0.283 0.331 3e-38
C0LGV1 1135 LRR receptor-like serine/ no no 0.845 0.265 0.357 7e-38
Q9LHP4 1141 Receptor-like protein kin no no 0.859 0.268 0.365 8e-38
O22476 1196 Protein BRASSINOSTEROID I no no 0.963 0.286 0.346 1e-37
Q8L899 1207 Systemin receptor SR160 O N/A no 0.960 0.283 0.329 2e-37
Q9SHI2 1101 Leucine-rich repeat recep no no 0.921 0.297 0.343 3e-37
Q9ZUI0 980 Putative leucine-rich rep no no 0.789 0.286 0.349 4e-37
Q9ZPS9 1143 Serine/threonine-protein no no 0.963 0.300 0.326 4e-37
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function desciption
 Score =  173 bits (439), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 140/378 (37%), Positives = 196/378 (51%), Gaps = 49/378 (12%)

Query: 1   NQTELRTLVLNKARISDTIPDWFWQLSLTLDELDVAYNELRGRVPNSLG-FNFPATVDLS 59
           N   L+ LVL+  +++  IP    +L+ +L  L++  N  +G++P  LG      T+DL 
Sbjct: 470 NAASLKRLVLSDNQLTGEIPREIGKLT-SLSVLNLNANMFQGKIPVELGDCTSLTTLDLG 528

Query: 60  SNNFEGRLPLCIPKSIGNLKQLITLVISNNNLSGEIP---------LLFSNSSFLY---I 107
           SNN +G+    IP  I  L QL  LV+S NNLSG IP         +   + SFL    I
Sbjct: 529 SNNLQGQ----IPDKITALAQLQCLVLSYNNLSGSIPSKPSAYFHQIEMPDLSFLQHHGI 584

Query: 108 LDMSNNSLSGSIPESIGSLRTLRFLVLRNNYLSGELPLSLKNCTFMESLDLGDNNLSGNI 167
            D+S N LSG IPE +G    L  + L NN+LSGE+P SL   T +  LDL  N L+G+I
Sbjct: 585 FDLSYNRLSGPIPEELGECLVLVEISLSNNHLSGEIPASLSRLTNLTILDLSGNALTGSI 644

Query: 168 PAWIGASMPGLLHILDLSHNDLSGFIPPRVG--------NLSDMKVEPPKSVQHEGRLRV 219
           P  +G S+   L  L+L++N L+G IP   G        NL+  K++ P      G L+ 
Sbjct: 645 PKEMGNSLK--LQGLNLANNQLNGHIPESFGLLGSLVKLNLTKNKLDGPVPASL-GNLKE 701

Query: 220 VTKGSERKYFTTLYLVNLLDLSSTNLSAEIPAELTSLVHLGTLNLSHNHLVGKIPEEIGN 279
           +T                +DLS  NLS E+ +EL+++  L  L +  N   G+IP E+GN
Sbjct: 702 LTH---------------MDLSFNNLSGELSSELSTMEKLVGLYIEQNKFTGEIPSELGN 746

Query: 280 FEWLETLDLSKNKLSGSIPPSMASLIFMNHLNLSYNNLSGEIPNTNQFQTLNDPS--IYE 337
              LE LD+S+N LSG IP  +  L  +  LNL+ NNL GE+P+    Q   DPS  +  
Sbjct: 747 LTQLEYLDVSENLLSGEIPTKICGLPNLEFLNLAKNNLRGEVPSDGVCQ---DPSKALLS 803

Query: 338 GNLALCGDPLPKKCPENG 355
           GN  LCG  +   C   G
Sbjct: 804 GNKELCGRVVGSDCKIEG 821




Receptor with a serine/threonine-protein kinase activity required for the specification of the correct number of male archesporial initials and for the subsequent specification of tapetal and middle cell layer identities. In seeds, required for enhancing cell size and the rate of embryonic development.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZUI0|Y2241_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130 OS=Arabidopsis thaliana GN=At2g24130 PE=3 SV=1 Back     alignment and function description
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query356
359488583 958 PREDICTED: LRR receptor-like serine/thre 0.997 0.370 0.573 1e-117
147789266 925 hypothetical protein VITISV_040339 [Viti 0.994 0.382 0.556 1e-113
359484185 990 PREDICTED: LRR receptor-like serine/thre 0.994 0.357 0.556 1e-112
359496394 602 PREDICTED: LOW QUALITY PROTEIN: leucine- 0.997 0.589 0.563 1e-112
255536933 471 serine-threonine protein kinase, plant-t 0.941 0.711 0.554 1e-108
359488639 1097 PREDICTED: LRR receptor-like serine/thre 0.983 0.319 0.545 1e-107
296090227 1102 unnamed protein product [Vitis vinifera] 0.983 0.317 0.545 1e-107
359496390 1113 PREDICTED: LRR receptor-like serine/thre 0.983 0.314 0.540 1e-106
359488641 1012 PREDICTED: LRR receptor-like serine/thre 0.985 0.346 0.529 1e-104
359488591 981 PREDICTED: probable leucine-rich repeat 0.985 0.357 0.525 1e-102
>gi|359488583|ref|XP_003633782.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 242/422 (57%), Positives = 283/422 (67%), Gaps = 67/422 (15%)

Query: 2   QTELRTLVLNKARISDTIPDWFWQLSLTLDELDVAYNELRGRVPNSLGFNFPATVDLSSN 61
           Q EL T+VLN A IS TIPDW W+L L L ELD+AYN+L GRVPNSL F++ A VDLSSN
Sbjct: 459 QNELTTIVLNNAGISGTIPDWLWKLDLQLSELDIAYNQLSGRVPNSLVFSYLANVDLSSN 518

Query: 62  NFEGRLPL------------------------------------------CIPKSIGNLK 79
            F+G LPL                                           IP S+G+L+
Sbjct: 519 LFDGPLPLWSSNVSTLYLRGNLFSGPIPQNIGQVMPILTDLDISWNSLNGSIPLSMGDLQ 578

Query: 80  QLITLVISNNNLSGEIPLLFSNSSFLYILDMSNNSLSGSIPESIGSLRTLRFLVLRNNYL 139
            LITLVISNNNLSGEIP  ++    LYI+DMSNNSLSG+IP S+GSL  LRFLVL NN L
Sbjct: 579 ALITLVISNNNLSGEIPQFWNKMPSLYIVDMSNNSLSGTIPRSLGSLTALRFLVLSNNNL 638

Query: 140 SGELPLSLKNCTFMESLDLGDNNLSGNIPAWIGASMPGL--------------------- 178
           SGELP  L+NC+ +ESLDLGDN  SGNIP+WIG SMP L                     
Sbjct: 639 SGELPSQLQNCSVLESLDLGDNKFSGNIPSWIGESMPSLLILALQSNFFSGNIPSEICAL 698

Query: 179 --LHILDLSHNDLSGFIPPRVGNLSDMKVEPPKS--VQHEGRLRVVTKGSERKYFTTLYL 234
             LHILDLSHN +SGFIPP  GNLS  K E       ++EGRL++V KG   +Y++TLYL
Sbjct: 699 SALHILDLSHNHVSGFIPPCFGNLSGFKSELSDDDLERYEGRLKLVAKGRALEYYSTLYL 758

Query: 235 VNLLDLSSTNLSAEIPAELTSLVHLGTLNLSHNHLVGKIPEEIGNFEWLETLDLSKNKLS 294
           VN LDLS+ +LS EIP ELTSL+ LGTLNLS N+L G IPE+IGN +WLETLDLSKNKLS
Sbjct: 759 VNSLDLSNNSLSGEIPIELTSLLKLGTLNLSSNNLGGNIPEKIGNLQWLETLDLSKNKLS 818

Query: 295 GSIPPSMASLIFMNHLNLSYNNLSGEIPNTNQFQTLNDPSIYEGNLALCGDPLPKKCPEN 354
           G IP SMAS+ F+ HLNL++NNLSG+IP  NQFQTL DPSIY+GNLALCG PL  +C +N
Sbjct: 819 GPIPMSMASITFLVHLNLAHNNLSGKIPTGNQFQTLIDPSIYQGNLALCGFPLTTECHDN 878

Query: 355 GG 356
            G
Sbjct: 879 NG 880




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147789266|emb|CAN71149.1| hypothetical protein VITISV_040339 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359484185|ref|XP_002273824.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496394|ref|XP_003635226.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like protein kinase PXL1-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|255536933|ref|XP_002509533.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223549432|gb|EEF50920.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359488639|ref|XP_003633795.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296090227|emb|CBI40046.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496390|ref|XP_002268557.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488641|ref|XP_003633796.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488591|ref|XP_003633783.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query356
TAIR|locus:2044767905 AT2G34930 "AT2G34930" [Arabido 0.938 0.369 0.386 4.2e-55
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.963 0.366 0.365 1.1e-44
TAIR|locus:2137296811 RLP46 "receptor like protein 4 0.949 0.416 0.340 2.2e-44
TAIR|locus:2005629 1140 AT1G75640 [Arabidopsis thalian 0.932 0.291 0.355 4e-44
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.946 0.287 0.353 5.4e-44
TAIR|locus:2182870 1192 EMS1 "EXCESS MICROSPOROCYTES1" 0.943 0.281 0.371 1.5e-43
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.926 0.290 0.362 1.7e-43
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.941 0.335 0.346 3.7e-41
TAIR|locus:2154344 1135 AT5G48940 [Arabidopsis thalian 0.859 0.269 0.362 3.9e-41
UNIPROTKB|Q5Z9N5 994 P0481E08.42 "Os06g0717200 prot 0.946 0.339 0.338 1.3e-40
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 574 (207.1 bits), Expect = 4.2e-55, P = 4.2e-55
 Identities = 145/375 (38%), Positives = 203/375 (54%)

Query:     4 ELRTLVLNKARISDTIPDWFWQLSLTLDELDVAYNELRGRVPNSLGFNFPAT--VDLSSN 61
             +L T+ L+      T P W    S    EL +  N   G +P ++    P    + L SN
Sbjct:   546 KLNTIDLSSNNFEGTFPLW----STNATELRLYENNFSGSLPQNIDVLMPRMEKIYLFSN 601

Query:    62 NFEGRLPLCIPKSIGNLKQLITLVISNNNLSGEIPLLFSNSSFLYILDMSNNSLSGSIPE 121
             +F G     IP S+  +  L  L +  N+ SG  P  +     L+ +D+S N+LSG IPE
Sbjct:   602 SFTGN----IPSSLCEVSGLQILSLRKNHFSGSFPKCWHRQFMLWGIDVSENNLSGEIPE 657

Query:   122 SIGSLRTLRFLVLRNNYLSGELPLSLKNCTFMESLDLGDNNLSGNIPAWIGA-------- 173
             S+G L +L  L+L  N L G++P SL+NC+ + ++DLG N L+G +P+W+G         
Sbjct:   658 SLGMLPSLSVLLLNQNSLEGKIPESLRNCSGLTNIDLGGNKLTGKLPSWVGKLSSLFMLR 717

Query:   174 ----SMPGL----------LHILDLSHNDLSGFIPPRVGNLSDMKVEPPKSVQHEGRLRV 219
                 S  G           L ILDLS N +SG IP  + NL+ +       V  +  + +
Sbjct:   718 LQSNSFTGQIPDDLCNVPNLRILDLSGNKISGPIPKCISNLTAIARGTNNEV-FQNLVFI 776

Query:   220 VTKGSERKYFTTLYLVNLLDLSSTNLSAEIPAELTSLVHLGTLNLSHNHLVGKIPEEIGN 279
             VT+   R+Y     + N ++LS  N+S EIP E+  L++L  LNLS N + G IPE+I  
Sbjct:   777 VTRA--REYEA---IANSINLSGNNISGEIPREILGLLYLRILNLSRNSMAGSIPEKISE 831

Query:   280 FEWLETLDLSKNKLSGSIPPSMASLIFMNHLNLSYNNLSGEIPNTNQFQTLNDPSIYEGN 339
                LETLDLSKNK SG+IP S A++  +  LNLS+N L G IP   +FQ   DPSIY GN
Sbjct:   832 LSRLETLDLSKNKFSGAIPQSFAAISSLQRLNLSFNKLEGSIPKLLKFQ---DPSIYIGN 888

Query:   340 LALCGDPLPKKCPEN 354
               LCG PLPKKCP++
Sbjct:   889 ELLCGKPLPKKCPKD 903


GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0005618 "cell wall" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP;IMP
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137296 RLP46 "receptor like protein 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005629 AT1G75640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182870 EMS1 "EXCESS MICROSPOROCYTES1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154344 AT5G48940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5Z9N5 P0481E08.42 "Os06g0717200 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query356
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-44
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-41
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-38
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-36
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-28
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  162 bits (411), Expect = 4e-44
 Identities = 122/346 (35%), Positives = 184/346 (53%), Gaps = 24/346 (6%)

Query: 3   TELRTLVLNKARISDTIPDWFWQLSLTLDELDVAYNELRGRVPNSLGFNFP--ATVDLSS 60
            +L +L L+   +S  IP+   QL   L+ L +  N   G++P +L  + P    + L S
Sbjct: 284 QKLISLDLSDNSLSGEIPELVIQLQ-NLEILHLFSNNFTGKIPVALT-SLPRLQVLQLWS 341

Query: 61  NNFEGRLPLCIPKSIGNLKQLITLVISNNNLSGEIPLLFSNSSFLYILDMSNNSLSGSIP 120
           N F G     IPK++G    L  L +S NNL+GEIP    +S  L+ L + +NSL G IP
Sbjct: 342 NKFSGE----IPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIP 397

Query: 121 ESIGSLRTLRFLVLRNNYLSGELPLSLKNCTFMESLDLGDNNLSGNI--PAWIGASMPGL 178
           +S+G+ R+LR + L++N  SGELP        +  LD+ +NNL G I    W    MP L
Sbjct: 398 KSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKW---DMPSL 454

Query: 179 LHILDLSHNDLSGFIPPRVGNLSDMKVEPPKSVQHEGRLRVVTKGSERKYFTTLYLVNLL 238
             +L L+ N   G +P   G+         K +++    R    G+  +   +L  +  L
Sbjct: 455 -QMLSLARNKFFGGLPDSFGS---------KRLENLDLSRNQFSGAVPRKLGSLSELMQL 504

Query: 239 DLSSTNLSAEIPAELTSLVHLGTLNLSHNHLVGKIPEEIGNFEWLETLDLSKNKLSGSIP 298
            LS   LS EIP EL+S   L +L+LSHN L G+IP        L  LDLS+N+LSG IP
Sbjct: 505 KLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIP 564

Query: 299 PSMASLIFMNHLNLSYNNLSGEIPNTNQFQTLNDPSIYEGNLALCG 344
            ++ ++  +  +N+S+N+L G +P+T  F  +N  ++  GN+ LCG
Sbjct: 565 KNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAV-AGNIDLCG 609


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 356
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.87
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.87
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.85
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.84
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.77
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.76
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.74
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.71
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.71
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.69
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.28
PLN03150623 hypothetical protein; Provisional 99.26
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.26
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.19
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.16
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.15
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.14
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.13
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.12
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.12
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.1
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.08
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.08
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.07
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.06
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.92
PLN03150623 hypothetical protein; Provisional 98.91
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.87
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.73
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.72
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.67
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.63
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.63
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.51
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.42
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.39
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.36
KOG4341483 consensus F-box protein containing LRR [General fu 98.35
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.28
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.18
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.18
KOG4341483 consensus F-box protein containing LRR [General fu 98.17
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.04
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.03
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.98
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.92
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.75
PRK15386426 type III secretion protein GogB; Provisional 97.73
PRK15386 426 type III secretion protein GogB; Provisional 97.7
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.69
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.09
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.86
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.83
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.83
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.83
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.79
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.46
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.38
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.36
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.93
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.59
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.37
KOG4308478 consensus LRR-containing protein [Function unknown 93.05
smart0037026 LRR Leucine-rich repeats, outliers. 92.91
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.91
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.85
KOG0473 326 consensus Leucine-rich repeat protein [Function un 91.73
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 91.39
KOG4308478 consensus LRR-containing protein [Function unknown 90.99
KOG0473 326 consensus Leucine-rich repeat protein [Function un 90.23
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 83.25
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.4e-34  Score=286.14  Aligned_cols=338  Identities=33%  Similarity=0.516  Sum_probs=217.8

Q ss_pred             CcccceEEEcccccccccCCchHHhhccCCcEeeccCCccCCcCCCCC-CCCCCcEEecCCCcccCcCCCCCCcccCCcc
Q 041463            1 NQTELRTLVLNKARISDTIPDWFWQLSLTLDELDVAYNELRGRVPNSL-GFNFPATVDLSSNNFEGRLPLCIPKSIGNLK   79 (356)
Q Consensus         1 ~l~~L~~L~l~~~~i~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~-~~~~L~~L~l~~n~~~~~~~~~~~~~~~~l~   79 (356)
                      ++++|++|++++|.+.+..|..+.++ ++|++|++++|.+.+..+..+ .+++|++|++++|.+.+.+    |..+..++
T Consensus       234 ~l~~L~~L~L~~n~l~~~~p~~l~~l-~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~----p~~~~~l~  308 (968)
T PLN00113        234 GLTSLNHLDLVYNNLTGPIPSSLGNL-KNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEI----PELVIQLQ  308 (968)
T ss_pred             cCCCCCEEECcCceeccccChhHhCC-CCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCC----ChhHcCCC
Confidence            35677778888777777777777766 677777777777766655555 4677777777777766533    34455566


Q ss_pred             cccEEecccccccccccccccCCCCCcEEEcccCcccccccccccCCCCCcEEEeeccccccccCccccCCC--------
Q 041463           80 QLITLVISNNNLSGEIPLLFSNSSFLYILDMSNNSLSGSIPESIGSLRTLRFLVLRNNYLSGELPLSLKNCT--------  151 (356)
Q Consensus        80 ~L~~L~l~~~~i~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~l~~~~~~~l~~l~--------  151 (356)
                      +|++|++++|.+.+..|..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|.+++..|..+..++        
T Consensus       309 ~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~  388 (968)
T PLN00113        309 NLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILF  388 (968)
T ss_pred             CCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECc
Confidence            666666666666655555666666666666666666555555555555666666665555544444444444        


Q ss_pred             ----------------CCcEEEecCCcccccCCchhhcccccceeEEEcccCcccccCCCCcCCCCCCcccCCCCCccCC
Q 041463          152 ----------------FMESLDLGDNNLSGNIPAWIGASMPGLLHILDLSHNDLSGFIPPRVGNLSDMKVEPPKSVQHEG  215 (356)
Q Consensus       152 ----------------~L~~L~l~~~~l~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~l~~L~~~~~~~~~~~~  215 (356)
                                      +|+.|++++|.+.+..|..+.. ++. ++.+++++|.+.+..+..+..+++|+.+....+...+
T Consensus       389 ~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~-l~~-L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~  466 (968)
T PLN00113        389 SNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTK-LPL-VYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFG  466 (968)
T ss_pred             CCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhc-CCC-CCEEECcCCcccCccChhhccCCCCcEEECcCceeee
Confidence                            4444444444444333333222 221 4555555555444444444444444443332221111


Q ss_pred             Ce---------eee------ecCCccccccccccccEEeecCCcccccCchhhhcccccCeEEccCCcCcCCCCcCcCCC
Q 041463          216 RL---------RVV------TKGSERKYFTTLYLVNLLDLSSTNLSAEIPAELTSLVHLGTLNLSHNHLVGKIPEEIGNF  280 (356)
Q Consensus       216 ~~---------~~~------~~~~~~~~~~~~~~L~~L~L~~~~l~~~~~~~~~~~~~L~~L~L~~n~i~~~~~~~~~~~  280 (356)
                      ..         ...      ..+..+..+..+++|+.|++++|.+.+..|..+..+++|++|++++|.+++.+|..+..+
T Consensus       467 ~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l  546 (968)
T PLN00113        467 GLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEM  546 (968)
T ss_pred             ecCcccccccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCc
Confidence            10         000      012223445667788888888888887788888888888888888888888888888888


Q ss_pred             CCccEEEccCCcccccCCccccCcCCCCEEEcccCcccccCCCCcccCcCCCccccccCccccCCC
Q 041463          281 EWLETLDLSKNKLSGSIPPSMASLIFMNHLNLSYNNLSGEIPNTNQFQTLNDPSIYEGNLALCGDP  346 (356)
Q Consensus       281 ~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~  346 (356)
                      ++|+.|++++|++.+.+|..+.+++.|+.+++++|++.+.+|....+..+.... +.+|+..||.+
T Consensus       547 ~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~-~~~n~~lc~~~  611 (968)
T PLN00113        547 PVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASA-VAGNIDLCGGD  611 (968)
T ss_pred             ccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhh-hcCCccccCCc
Confidence            888888888888888888888888888888998888888888887777776665 77888888754



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query356
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-39
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-39
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-22
3cig_A 697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 2e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 159 bits (403), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 141/414 (34%), Positives = 191/414 (46%), Gaps = 93/414 (22%) Query: 30 LDELDVAYNELRGRVPNSLGFNFPA---TVDLSSNNFEGRLPLCIPKSIGNLKQ-LITLV 85 L LD+++NE G +P SL N A T+DLSSNNF G + +P N K L L Sbjct: 345 LKVLDLSFNEFSGELPESLT-NLSASLLTLDLSSNNFSGPI---LPNLCQNPKNTLQELY 400 Query: 86 ISNNNLSGEIPLLFSNSSFLYILDMSNNSLSGSIPESIGSL------------------- 126 + NN +G+IP SN S L L +S N LSG+IP S+GSL Sbjct: 401 LQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ 460 Query: 127 -----RTLRFLVLRNNYLSGELPLSLKNCTFMESLDLGDNNLSGNIPAWIG--------- 172 +TL L+L N L+GE+P L NCT + + L +N L+G IP WIG Sbjct: 461 ELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILK 520 Query: 173 -------ASMPGLLH------ILDLSHNDLSGFIPPRVGNLSD----------------- 202 ++P L LDL+ N +G IP + S Sbjct: 521 LSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKN 580 Query: 203 --MKVEPP--------KSVQHEGRLRVVTK-----------GSERKYFTTLYLVNLLDLS 241 MK E + ++ E R+ T+ G F + LD+S Sbjct: 581 DGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMS 640 Query: 242 STNLSAEIPAELTSLVHLGTLNLSHNHLVGKIPEEIGNFEWLETLDLSKNKLSGSIPPSM 301 LS IP E+ S+ +L LNL HN + G IP+E+G+ L LDLS NKL G IP +M Sbjct: 641 YNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAM 700 Query: 302 ASLIFMNHLNLSYNNLSGEIPNTNQFQTLNDPSIYEGNLALCGDPLPKKCPENG 355 ++L + ++LS NNLSG IP QF+T P+ + N LCG PLP+ P N Sbjct: 701 SALTMLTEIDLSNNNLSGPIPEMGQFETF-PPAKFLNNPGLCGYPLPRCDPSNA 753
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query356
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-93
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-76
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-66
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-61
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-59
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-57
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-55
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-49
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-43
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-81
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-40
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-38
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-36
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-35
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-34
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-28
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-25
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-22
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-39
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-38
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-37
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-37
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-37
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-37
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-32
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-31
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-30
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-29
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-23
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-34
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-32
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-32
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-31
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-30
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-26
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-34
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-32
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-31
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-29
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-28
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-28
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-25
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-25
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-18
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-17
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-09
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-19
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-17
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-23
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-13
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-18
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-20
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-19
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-19
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-17
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-14
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-09
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-19
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-19
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-17
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-17
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-16
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-15
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-18
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-13
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-08
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-12
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-07
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-12
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-08
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-10
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-08
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  293 bits (753), Expect = 2e-93
 Identities = 116/377 (30%), Positives = 167/377 (44%), Gaps = 37/377 (9%)

Query: 1   NQTELRTLVLNKARISDTIPDWFWQLSLTLDELDVAYNELRGRVPNSLGFNFPA--TVDL 58
            +  L+ L L     +  IP      S  L  L +++N L G +P+SLG +      + L
Sbjct: 392 PKNTLQELYLQNNGFTGKIPPTLSNCS-ELVSLHLSFNYLSGTIPSSLG-SLSKLRDLKL 449

Query: 59  SSNNFEGRLPLC--------------------IPKSIGNLKQLITLVISNNNLSGEIPLL 98
             N  EG +P                      IP  + N   L  + +SNN L+GEIP  
Sbjct: 450 WLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKW 509

Query: 99  FSNSSFLYILDMSNNSLSGSIPESIGSLRTLRFLVLRNNYLSGELPLSLKNCTFMESLDL 158
                 L IL +SNNS SG+IP  +G  R+L +L L  N  +G +P ++       S  +
Sbjct: 510 IGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQ----SGKI 565

Query: 159 GDNNLSGNIPAWIGASMPGLLHILDLSHNDLSGFIPPRVGNLSDMKVEPPKSVQHEGRLR 218
             N ++G    +I             +  +  G    ++  LS        S        
Sbjct: 566 AANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRV------ 619

Query: 219 VVTKGSERKYFTTLYLVNLLDLSSTNLSAEIPAELTSLVHLGTLNLSHNHLVGKIPEEIG 278
               G     F     +  LD+S   LS  IP E+ S+ +L  LNL HN + G IP+E+G
Sbjct: 620 --YGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVG 677

Query: 279 NFEWLETLDLSKNKLSGSIPPSMASLIFMNHLNLSYNNLSGEIPNTNQFQTLNDPSIYEG 338
           +   L  LDLS NKL G IP +M++L  +  ++LS NNLSG IP   QF+T   P+ +  
Sbjct: 678 DLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFP-PAKFLN 736

Query: 339 NLALCGDPLPKKCPENG 355
           N  LCG PLP+  P N 
Sbjct: 737 NPGLCGYPLPRCDPSNA 753


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query356
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.98
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.86
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.73
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.71
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.71
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.68
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.66
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.64
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.61
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.55
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.53
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.52
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.45
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.4
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.38
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.35
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.33
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.33
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.26
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.1
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.1
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.99
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.93
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.78
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.77
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.63
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.61
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.55
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.5
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.43
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.42
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.27
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.96
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.65
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.11
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.01
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.8e-42  Score=333.94  Aligned_cols=346  Identities=37%  Similarity=0.580  Sum_probs=263.5

Q ss_pred             cccceEEEcccccccccCCchHHhhccCCcEeeccCCccCCcCCCCC-C--CCCCcEEecCCCcccCcCCCCCCcccCCc
Q 041463            2 QTELRTLVLNKARISDTIPDWFWQLSLTLDELDVAYNELRGRVPNSL-G--FNFPATVDLSSNNFEGRLPLCIPKSIGNL   78 (356)
Q Consensus         2 l~~L~~L~l~~~~i~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~-~--~~~L~~L~l~~n~~~~~~~~~~~~~~~~l   78 (356)
                      +++|++|++++|.+++.+|..+..+.++|++|++++|.+.+..+..+ .  +++|++|++++|.+++.    +|..+..+
T Consensus       342 l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~----~p~~l~~l  417 (768)
T 3rgz_A          342 MRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGK----IPPTLSNC  417 (768)
T ss_dssp             CTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEE----CCGGGGGC
T ss_pred             CCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccc----cCHHHhcC
Confidence            45667777777776666666666652267777777666665444444 2  56677777777776653    34566777


Q ss_pred             ccccEEecccccccccccccccCCCCCcEEEcccCcccccccccccCCCCCcEEEeeccccccccCccccCCCCCcEEEe
Q 041463           79 KQLITLVISNNNLSGEIPLLFSNSSFLYILDMSNNSLSGSIPESIGSLRTLRFLVLRNNYLSGELPLSLKNCTFMESLDL  158 (356)
Q Consensus        79 ~~L~~L~l~~~~i~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~l~~~~~~~l~~l~~L~~L~l  158 (356)
                      ++|++|++++|.+.+..|..+..+++|++|++++|.+.+..|..+..+++|++|++++|.+++..|..+..+++|+.|++
T Consensus       418 ~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L  497 (768)
T 3rgz_A          418 SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISL  497 (768)
T ss_dssp             TTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEEC
T ss_pred             CCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEc
Confidence            78888888888777777777777777888888877777677777777777777777777777777777777777777777


Q ss_pred             cCCcccccCCchhhcccccceeEEEcccCcccccCCCCcCCCCCCcccCCCCCccCCCeee-------------------
Q 041463          159 GDNNLSGNIPAWIGASMPGLLHILDLSHNDLSGFIPPRVGNLSDMKVEPPKSVQHEGRLRV-------------------  219 (356)
Q Consensus       159 ~~~~l~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~l~~L~~~~~~~~~~~~~~~~-------------------  219 (356)
                      ++|.+.+..|.++.. ++. |+.|++++|.+.+.+|..+..+++|+.+........+.++.                   
T Consensus       498 ~~N~l~~~~p~~~~~-l~~-L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~  575 (768)
T 3rgz_A          498 SNNRLTGEIPKWIGR-LEN-LAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRY  575 (768)
T ss_dssp             CSSCCCSCCCGGGGG-CTT-CCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEE
T ss_pred             cCCccCCcCChHHhc-CCC-CCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccc
Confidence            777777667766654 333 77777777777777777777777766644433222211110                   


Q ss_pred             -------------------------------------------eecCCccccccccccccEEeecCCcccccCchhhhcc
Q 041463          220 -------------------------------------------VTKGSERKYFTTLYLVNLLDLSSTNLSAEIPAELTSL  256 (356)
Q Consensus       220 -------------------------------------------~~~~~~~~~~~~~~~L~~L~L~~~~l~~~~~~~~~~~  256 (356)
                                                                 ...+..+..+..+++|+.|++++|.+.+..|..+..+
T Consensus       576 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l  655 (768)
T 3rgz_A          576 VYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSM  655 (768)
T ss_dssp             EEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGC
T ss_pred             cccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhcc
Confidence                                                       0011122345667899999999999999999999999


Q ss_pred             cccCeEEccCCcCcCCCCcCcCCCCCccEEEccCCcccccCCccccCcCCCCEEEcccCcccccCCCCcccCcCCCcccc
Q 041463          257 VHLGTLNLSHNHLVGKIPEEIGNFEWLETLDLSKNKLSGSIPPSMASLIFMNHLNLSYNNLSGEIPNTNQFQTLNDPSIY  336 (356)
Q Consensus       257 ~~L~~L~L~~n~i~~~~~~~~~~~~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~l~~l~~~~~~  336 (356)
                      +.|+.|+|++|.+++.+|..++.+++|+.|+|++|++++.+|..++.++.|++|++++|+++|.+|....++.+.... |
T Consensus       656 ~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~-~  734 (768)
T 3rgz_A          656 PYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAK-F  734 (768)
T ss_dssp             TTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGG-G
T ss_pred             ccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHH-h
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999888887 8


Q ss_pred             ccCccccCCCCCCCCCCCC
Q 041463          337 EGNLALCGDPLPKKCPENG  355 (356)
Q Consensus       337 ~~~~~~~~~~~~~~c~~~~  355 (356)
                      .+|+.+||.|.. .|+..+
T Consensus       735 ~gN~~Lcg~~l~-~C~~~~  752 (768)
T 3rgz_A          735 LNNPGLCGYPLP-RCDPSN  752 (768)
T ss_dssp             CSCTEEESTTSC-CCCSCC
T ss_pred             cCCchhcCCCCc-CCCCCc
Confidence            999999999988 888764



>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 356
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-20
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-11
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-04
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.003
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-09
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 9e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 3e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 6e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 9e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 87.5 bits (215), Expect = 4e-20
 Identities = 82/294 (27%), Positives = 121/294 (41%), Gaps = 39/294 (13%)

Query: 57  DLSSNNFEGRLPLCIPKSIGNLKQLITLVISNN-NLSGEIPLLFSNSSFLYILDMSNNSL 115
           DLS  N     P  IP S+ NL  L  L I    NL G IP   +  + L+ L +++ ++
Sbjct: 56  DLSGLNLPKPYP--IPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNV 113

Query: 116 SGSIPESIGSLRTLRFLVLRNNYLSGELPLSLKNCTFMESLDLGDNNLSGNIPAWIGASM 175
           SG+IP+ +  ++TL  L    N LSG LP S+ +   +  +    N +SG IP   G+  
Sbjct: 114 SGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFS 173

Query: 176 PGLLHILDLSHNDLSGFIPPRVGNLSDMKVEPPKSVQHEGRLRVVTKGSERKYFTTLYLV 235
             L   + +S N L+G I                                    T   L 
Sbjct: 174 K-LFTSMTISRNRLTGKI----------------------------------PPTFANLN 198

Query: 236 NLLDLSSTNLSAEIPAELTSLVHLGTLNLSHNHLVGKIPEEIGNFEWLETLDLSKNKLSG 295
                 S N+     + L              + +     ++G  + L  LDL  N++ G
Sbjct: 199 LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYG 258

Query: 296 SIPPSMASLIFMNHLNLSYNNLSGEIPNTNQFQTLNDPSIYEGNLALCGDPLPK 349
           ++P  +  L F++ LN+S+NNL GEIP     Q   D S Y  N  LCG PLP 
Sbjct: 259 TLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRF-DVSAYANNKCLCGSPLPA 311


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query356
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.82
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.65
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.65
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.64
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.64
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.54
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.52
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.51
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.3
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.29
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.16
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.19
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.16
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.11
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.75
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.47
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.21
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.97  E-value=5.2e-31  Score=227.43  Aligned_cols=260  Identities=33%  Similarity=0.534  Sum_probs=224.3

Q ss_pred             CCCcEEecCCCcccCcCCCCCCcccCCcccccEEeccc-ccccccccccccCCCCCcEEEcccCcccccccccccCCCCC
Q 041463           51 NFPATVDLSSNNFEGRLPLCIPKSIGNLKQLITLVISN-NNLSGEIPLLFSNSSFLYILDMSNNSLSGSIPESIGSLRTL  129 (356)
Q Consensus        51 ~~L~~L~l~~n~~~~~~~~~~~~~~~~l~~L~~L~l~~-~~i~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L  129 (356)
                      .+++.|+++++.+.+.+  .+|..+..+++|++|++++ |.+.+.+|..|.++++|++|++++|.+....+..+..+.+|
T Consensus        50 ~~v~~L~L~~~~l~g~~--~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L  127 (313)
T d1ogqa_          50 YRVNNLDLSGLNLPKPY--PIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTL  127 (313)
T ss_dssp             CCEEEEEEECCCCSSCE--ECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTC
T ss_pred             EEEEEEECCCCCCCCCC--CCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhh
Confidence            46899999999887642  2567899999999999987 68888899999999999999999999998888888889999


Q ss_pred             cEEEeeccccccccCccccCCCCCcEEEecCCcccccCCchhhcccccceeEEEcccCcccccCCCCcCCCCCCcccCCC
Q 041463          130 RFLVLRNNYLSGELPLSLKNCTFMESLDLGDNNLSGNIPAWIGASMPGLLHILDLSHNDLSGFIPPRVGNLSDMKVEPPK  209 (356)
Q Consensus       130 ~~L~l~~~~l~~~~~~~l~~l~~L~~L~l~~~~l~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~l~~L~~~~~~  209 (356)
                      +++++++|.+...+|..+..++.++.+++++|.+.+.+|..+.. +...++.+++++|.+.+..+..+..+.        
T Consensus       128 ~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~-l~~l~~~l~~~~n~l~~~~~~~~~~l~--------  198 (313)
T d1ogqa_         128 VTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGS-FSKLFTSMTISRNRLTGKIPPTFANLN--------  198 (313)
T ss_dssp             CEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGC-CCTTCCEEECCSSEEEEECCGGGGGCC--------
T ss_pred             cccccccccccccCchhhccCcccceeecccccccccccccccc-ccccccccccccccccccccccccccc--------
Confidence            99999999988888999999999999999999998888877655 344468899999988776665544332        


Q ss_pred             CCccCCCeeeeecCCccccccccccccEEeecCCcccccCchhhhcccccCeEEccCCcCcCCCCcCcCCCCCccEEEcc
Q 041463          210 SVQHEGRLRVVTKGSERKYFTTLYLVNLLDLSSTNLSAEIPAELTSLVHLGTLNLSHNHLVGKIPEEIGNFEWLETLDLS  289 (356)
Q Consensus       210 ~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~L~~~~l~~~~~~~~~~~~~L~~L~L~~n~i~~~~~~~~~~~~~L~~L~L~  289 (356)
                                               ...+++..+...+..+..+..+++++.+++.++.+.+. +..+..+++|+.|+++
T Consensus       199 -------------------------~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~-~~~~~~~~~L~~L~Ls  252 (313)
T d1ogqa_         199 -------------------------LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFD-LGKVGLSKNLNGLDLR  252 (313)
T ss_dssp             -------------------------CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCB-GGGCCCCTTCCEEECC
T ss_pred             -------------------------cccccccccccccccccccccccccccccccccccccc-ccccccccccccccCc
Confidence                                     23488888888888888888899999999999998854 4467889999999999


Q ss_pred             CCcccccCCccccCcCCCCEEEcccCcccccCCCCcccCcCCCccccccCccccCCCCC
Q 041463          290 KNKLSGSIPPSMASLIFMNHLNLSYNNLSGEIPNTNQFQTLNDPSIYEGNLALCGDPLP  348 (356)
Q Consensus       290 ~n~i~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~  348 (356)
                      +|++++.+|..++++++|++|+|++|+++|.+|....++.|+.++ +.+|..+||.|..
T Consensus       253 ~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~-l~~N~~l~g~plp  310 (313)
T d1ogqa_         253 NNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSA-YANNKCLCGSPLP  310 (313)
T ss_dssp             SSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGG-TCSSSEEESTTSS
T ss_pred             cCeecccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHH-hCCCccccCCCCC
Confidence            999999999999999999999999999999999998999999998 8899999999865



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure