Citrus Sinensis ID: 041485

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
DWKTLNKLIFFFKMASNNRSIGVALDFSKGSKLALKWAIDNLLEKGDTLYIIHIKLPQGDESRNLLWSDTGSPLIPLEEFRDQEVMKQYEVDLDQDVLDMLDAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLDSLVMGSRGLGTIQRVLLGSVSNHVLANASCPVTIVKDPSAAHGI
cccccccHHEEccccccccEEEEEEcccHHHHHHHHHHHHHHHccccEEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccHHHHHHHHHHccccEEEEcccccccccccEEccHHHHHHccccccEEEEccccccccc
cHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHHHHHcccccEEEEEEEccccccccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEEEccHHHHHHHHHHHccccEEEEEcccccHHHEEEEccccHHHHccccccEEEEEcccccccc
DWKTLNKLIFFFKMASNNRSIGVALDFSKGSKLALKWAIDNLLEKGDTLYIIHIklpqgdesrnllwsdtgsplipleefrdqEVMKQYEVDLDQDVLDMLDAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLDSlvmgsrglgTIQRVLLGSVSnhvlanascpvtivkdpsaahgi
DWKTLNKLIFFFKMASNNRSIGVALDFSKGSKLALKWAIDNLLEKGDTLYIIHIKlpqgdesrnlLWSDTGSPLIPLEEFRDQEVMKQYEVDLDQDVLDMLDAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLDSLVMGSRGLGTIQRVLLGSVSNHVlanascpvtivkdpsaahgi
DWKTLNKLIFFFKMASNNRSIGVALDFSKGSKLALKWAIDNLLEKGDTLYIIHIKLPQGDESRNLLWSDTGSPLIPLEEFRDQEVMKQYEvdldqdvldmldAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLDSLVMGSRGLGTIQRVLLGSVSNHVLANASCPVTIVKDPSAAHGI
***TLNKLIFFFKMASNNRSIGVALDFSKGSKLALKWAIDNLLEKGDTLYIIHIKLPQGDESRNLLWSDTGSPLIPLEEFRDQEVMKQYEVDLDQDVLDMLDAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLDSLVMGSRGLGTIQRVLLGSVSNHVLANASCPVTIV*********
***T*NKLIFF*KMASNNRSIGVALDFSKGSKLALKWAIDNLLEKGDTLYIIHIKLPQGDESRNLLWSDTGSPLIPLEEFRDQEVMKQYEVDLDQDVLDMLDAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLDSLVMGSRGLGTIQRVLLGSVSNHVLANASCPVT***********
DWKTLNKLIFFFKMASNNRSIGVALDFSKGSKLALKWAIDNLLEKGDTLYIIHIKLPQGDESRNLLWSDTGSPLIPLEEFRDQEVMKQYEVDLDQDVLDMLDAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLDSLVMGSRGLGTIQRVLLGSVSNHVLANASCPVTIVKDPSAAHGI
DWKTLNKLIFFFKMASNNRSIGVALDFSKGSKLALKWAIDNLLEKGDTLYIIHIKLPQGDESRNLLWSDTGSPLIPLEEFRDQEVMKQYEVDLDQDVLDMLDAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLDSLVMGSRGLGTIQRVLLGSVSNHVLANASCPVTIVKDP******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DWKTLNKLIFFFKMASNNRSIGVALDFSKGSKLALKWAIDNLLEKGDTLYIIHIKLPQGDESRNLLWSDTGSPLIPLEEFRDQEVMKQYEVDLDQDVLDMLDAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLDSLVMGSRGLGTIQRVLLGSVSNHVLANASCPVTIVKDPSAAHGI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query179 2.2.26 [Sep-21-2011]
Q8LGG8175 Universal stress protein no no 0.837 0.857 0.273 4e-10
Q57951170 Universal stress protein yes no 0.569 0.6 0.303 7e-08
P74897137 Universal stress protein N/A no 0.324 0.423 0.413 2e-05
P87132601 Uncharacterized protein C yes no 0.737 0.219 0.263 7e-05
P42297148 Universal stress protein yes no 0.776 0.939 0.289 0.0002
P72745108 Universal stress protein N/A no 0.502 0.833 0.301 0.0002
O74782307 Universal stress protein no no 0.793 0.462 0.239 0.0003
O53472 294 Universal stress protein yes no 0.497 0.302 0.291 0.0006
>sp|Q8LGG8|USPAL_ARATH Universal stress protein A-like protein OS=Arabidopsis thaliana GN=At3g01520 PE=1 SV=2 Back     alignment and function desciption
 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 79/161 (49%), Gaps = 11/161 (6%)

Query: 14  MASNNRSIGVALDFSKGSKLALKWAIDNLLEKGDT---LYIIHIKLPQGDESRNLLWSDT 70
           +A N  +I    + S   K A +W ++ ++    +   + ++H+++   D      + D 
Sbjct: 10  VAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVVDEDG-----FDDV 64

Query: 71  GSPLIPLEEFRDQEVMKQYEVDLDQDVLDMLDAASKQKHVSVVAKLYWGDARDKLCEAVE 130
            S     E+FRD   M+Q        +L+       +  V   A +  GD +D +C+ V+
Sbjct: 65  DSIYASPEDFRD---MRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVICQEVK 121

Query: 131 AMKLDSLVMGSRGLGTIQRVLLGSVSNHVLANASCPVTIVK 171
            ++ D LV+GSRGLG  Q+V +G+VS   + +A CPV  +K
Sbjct: 122 RVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIK 162

Arabidopsis thaliana (taxid: 3702)
>sp|Q57951|Y531_METJA Universal stress protein MJ0531 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0531 PE=3 SV=1 Back     alignment and function description
>sp|P74897|YQA3_THEAQ Universal stress protein in QAH/OAS sulfhydrylase 3'region OS=Thermus aquaticus PE=3 SV=1 Back     alignment and function description
>sp|P87132|YFK5_SCHPO Uncharacterized protein C167.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC167.05 PE=1 SV=2 Back     alignment and function description
>sp|P42297|YXIE_BACSU Universal stress protein YxiE OS=Bacillus subtilis (strain 168) GN=yxiE PE=3 SV=1 Back     alignment and function description
>sp|P72745|Y1101_SYNY3 Universal stress protein Slr1101 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1101 PE=3 SV=1 Back     alignment and function description
>sp|O74782|YGBA_SCHPO Universal stress protein A family protein C25B2.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC25B2.10 PE=1 SV=1 Back     alignment and function description
>sp|O53472|Y2026_MYCTU Universal stress protein Rv2026c/MT2085 OS=Mycobacterium tuberculosis GN=Rv2026c PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query179
166203457164 universal stress protein 1 [Gossypium ar 0.910 0.993 0.719 2e-64
388521995164 unknown [Lotus japonicus] 0.877 0.957 0.745 5e-64
388510432164 unknown [Lotus japonicus] 0.877 0.957 0.738 2e-63
255558896164 conserved hypothetical protein [Ricinus 0.910 0.993 0.713 2e-63
351722253164 uncharacterized protein LOC100499728 [Gl 0.899 0.981 0.726 3e-63
351723895164 uncharacterized protein LOC100306505 [Gl 0.899 0.981 0.726 8e-63
225434754164 PREDICTED: universal stress protein A-li 0.910 0.993 0.695 1e-62
225440536164 PREDICTED: universal stress protein A-li 0.882 0.963 0.715 4e-61
388514697164 unknown [Medicago truncatula] 0.899 0.981 0.697 5e-59
351721446164 uncharacterized protein LOC100499951 [Gl 0.899 0.981 0.652 9e-58
>gi|166203457|gb|ABY84681.1| universal stress protein 1 [Gossypium arboreum] gi|169248110|gb|ACA51838.1| universal stress protein 1 [Gossypium arboreum] Back     alignment and taxonomy information
 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/164 (71%), Positives = 142/164 (86%), Gaps = 1/164 (0%)

Query: 16  SNNRSIGVALDFSKGSKLALKWAIDNLLEKGDTLYIIHIKLPQGDESRNLLWSDTGSPLI 75
           + +R IGVA+DFSKGSK ALKW IDNL++KGDTLY+IH+K  Q DESR LLWS TGSPLI
Sbjct: 2   TKDRQIGVAMDFSKGSKAALKWTIDNLVDKGDTLYLIHVKPNQSDESRKLLWSTTGSPLI 61

Query: 76  PLEEFRDQEVMKQYEVDLDQDVLDMLDAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLD 135
           PL EFR++EVMK YEV+ D ++LD++D AS QK  ++VAK+YWGDARDK+CE+VE +KLD
Sbjct: 62  PLSEFREKEVMKHYEVEPDPEILDLVDIASGQKQGTLVAKIYWGDARDKICESVEDLKLD 121

Query: 136 SLVMGSRGLGTIQRVLLGSVSNHVLANASCPVTIVKDPSAAHGI 179
            LVMGSRGLGTIQRVL+GSVSN+V+ NA+CPVTIVKDPS AHG 
Sbjct: 122 CLVMGSRGLGTIQRVLIGSVSNYVMVNATCPVTIVKDPS-AHGF 164

Source: Gossypium arboreum

Species: Gossypium arboreum

Genus: Gossypium

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|388521995|gb|AFK49059.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|388510432|gb|AFK43282.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255558896|ref|XP_002520471.1| conserved hypothetical protein [Ricinus communis] gi|223540313|gb|EEF41884.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|351722253|ref|NP_001235190.1| uncharacterized protein LOC100499728 [Glycine max] gi|255626103|gb|ACU13396.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|351723895|ref|NP_001236015.1| uncharacterized protein LOC100306505 [Glycine max] gi|255628729|gb|ACU14709.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225434754|ref|XP_002281607.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera] gi|297745982|emb|CBI16038.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225440536|ref|XP_002275745.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera] gi|147866185|emb|CAN81966.1| hypothetical protein VITISV_034082 [Vitis vinifera] gi|297740283|emb|CBI30465.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388514697|gb|AFK45410.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|351721446|ref|NP_001238489.1| uncharacterized protein LOC100499951 [Glycine max] gi|255627933|gb|ACU14311.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query179
TAIR|locus:2084525160 AT3G53990 "AT3G53990" [Arabido 0.860 0.962 0.589 2.1e-45
TAIR|locus:2086102163 AT3G17020 "AT3G17020" [Arabido 0.871 0.957 0.490 2.7e-36
TAIR|locus:2097755201 AT3G03270 [Arabidopsis thalian 0.731 0.651 0.526 3.6e-34
TAIR|locus:2096089162 AT3G62550 "AT3G62550" [Arabido 0.832 0.919 0.312 9.8e-16
TAIR|locus:2024291171 AT1G09740 "AT1G09740" [Arabido 0.821 0.859 0.341 2.6e-15
TAIR|locus:2199282160 AT1G68300 "AT1G68300" [Arabido 0.312 0.35 0.482 1.9e-14
TAIR|locus:2147319242 PHOS32 "AT5G54430" [Arabidopsi 0.877 0.648 0.304 2.3e-14
TAIR|locus:2200036242 AT1G11360 [Arabidopsis thalian 0.888 0.657 0.296 3e-14
TAIR|locus:2081531226 AT3G11930 "AT3G11930" [Arabido 0.737 0.584 0.313 1.8e-13
TAIR|locus:2076381204 AT3G58450 "AT3G58450" [Arabido 0.821 0.720 0.304 2.7e-13
TAIR|locus:2084525 AT3G53990 "AT3G53990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 477 (173.0 bits), Expect = 2.1e-45, P = 2.1e-45
 Identities = 92/156 (58%), Positives = 119/156 (76%)

Query:    18 NRSIGVALDFSKGSKLALKWAIDNLLEKGDTLYIIHIKLP-QGDESRNLLWSDTGSPLIP 76
             +R+IG+A+DFS+ SK ALKWAI+NL +KGDT+YIIH  LP  GDESRN LW  +GSPLIP
Sbjct:     4 DRNIGIAMDFSESSKNALKWAIENLADKGDTIYIIHT-LPLSGDESRNSLWFKSGSPLIP 62

Query:    77 LEEFRDQEVMKQYEXXXXXXXXXXXXAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLDS 136
             L EFR+ E+M++Y               S+QK V VV KLYWGDAR+KL +AV+ +KLDS
Sbjct:    63 LAEFREPEIMEKYGVKTDIACLDMLDTGSRQKEVHVVTKLYWGDAREKLVDAVKDLKLDS 122

Query:   137 LVMGSRGLGTIQRVLLGSVSNHVLANASCPVTIVKD 172
             +VMGSRGL  +QR+++GSVS+ V+ +A CPVT+VKD
Sbjct:   123 IVMGSRGLSALQRIIMGSVSSFVIQHAPCPVTVVKD 158
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0009409 "response to cold" evidence=IEP
GO:0009506 "plasmodesma" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2086102 AT3G17020 "AT3G17020" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097755 AT3G03270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096089 AT3G62550 "AT3G62550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024291 AT1G09740 "AT1G09740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199282 AT1G68300 "AT1G68300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147319 PHOS32 "AT5G54430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200036 AT1G11360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081531 AT3G11930 "AT3G11930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076381 AT3G58450 "AT3G58450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query179
pfam00582139 pfam00582, Usp, Universal stress protein family 4e-28
cd00293130 cd00293, USP_Like, Usp: Universal stress protein f 4e-27
COG0589154 COG0589, UspA, Universal stress protein UspA and r 8e-18
cd01989146 cd01989, STK_N, The N-terminal domain of Eukaryoti 3e-10
>gnl|CDD|216006 pfam00582, Usp, Universal stress protein family Back     alignment and domain information 
 Score =  101 bits (254), Expect = 4e-28
 Identities = 45/154 (29%), Positives = 74/154 (48%), Gaps = 16/154 (10%)

Query: 18  NRSIGVALDFSKGSKLALKWAIDNLLEKGDTLYIIHIKLPQGDESRNLLWSDTGSPLIPL 77
            + I VA+D S+ S+ AL+WA++    +G  L ++H+      +      +         
Sbjct: 2   YKRILVAVDGSEESERALEWALELAKRRGAELILLHVI-----DPEPSGAASEALEEEEE 56

Query: 78  EEFRDQEVMKQYEVDLDQDVLDMLDAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLDSL 137
           EE  ++E              + L AA++   V V   +  GD  + + E  E    D +
Sbjct: 57  EELEEEE-----------AEAEALAAAAEAGGVVVEVVVRGGDPAEAILEVAEEEDADLI 105

Query: 138 VMGSRGLGTIQRVLLGSVSNHVLANASCPVTIVK 171
           VMGSRG   ++R+LLGSV+  VL +A CPV +V+
Sbjct: 106 VMGSRGRSGLRRLLLGSVAEKVLRHAPCPVLVVR 139

The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity. Length = 139
>gnl|CDD|238182 cd00293, USP_Like, Usp: Universal stress protein family Back     alignment and domain information
>gnl|CDD|223662 COG0589, UspA, Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|238947 cd01989, STK_N, The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 179
PRK15456142 universal stress protein UspG; Provisional 99.94
PRK15005144 universal stress protein F; Provisional 99.94
PRK09982142 universal stress protein UspD; Provisional 99.94
cd01989146 STK_N The N-terminal domain of Eukaryotic Serine T 99.94
PRK15118144 universal stress global response regulator UspA; P 99.92
PRK10116142 universal stress protein UspC; Provisional 99.92
PF00582140 Usp: Universal stress protein family; InterPro: IP 99.92
cd01988132 Na_H_Antiporter_C The C-terminal domain of a subfa 99.91
PRK11175 305 universal stress protein UspE; Provisional 99.9
cd01987124 USP_OKCHK USP domain is located between the N-term 99.89
PRK11175305 universal stress protein UspE; Provisional 99.86
cd00293130 USP_Like Usp: Universal stress protein family. The 99.84
COG0589154 UspA Universal stress protein UspA and related nuc 99.82
PRK12652 357 putative monovalent cation/H+ antiporter subunit E 99.64
PRK10490 895 sensor protein KdpD; Provisional 99.44
COG2205 890 KdpD Osmosensitive K+ channel histidine kinase [Si 99.39
cd0198486 AANH_like Adenine nucleotide alpha hydrolases supe 98.51
PLN03159 832 cation/H(+) antiporter 15; Provisional 97.86
TIGR02432189 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t 97.5
PF01171182 ATP_bind_3: PP-loop family; InterPro: IPR011063 Th 97.37
PLN03159832 cation/H(+) antiporter 15; Provisional 97.36
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of 97.07
PRK10696258 tRNA 2-thiocytidine biosynthesis protein TtcA; Pro 97.02
PRK12342 254 hypothetical protein; Provisional 96.54
COG0037 298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle 96.45
PRK03359 256 putative electron transfer flavoprotein FixA; Revi 96.38
PF01012164 ETF: Electron transfer flavoprotein domain; InterP 96.28
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine n 96.22
COG2086 260 FixA Electron transfer flavoprotein, beta subunit 96.14
COG0041162 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m 95.03
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 95.01
PRK05253 301 sulfate adenylyltransferase subunit 2; Provisional 94.56
TIGR01162156 purE phosphoribosylaminoimidazole carboxylase, Pur 94.24
PRK10660 436 tilS tRNA(Ile)-lysidine synthetase; Provisional 93.57
PRK14665 360 mnmA tRNA-specific 2-thiouridylase MnmA; Provision 93.08
cd01985181 ETF The electron transfer flavoprotein (ETF) serve 92.94
TIGR00591 454 phr2 photolyase PhrII. All proteins in this family 92.87
TIGR02039 294 CysD sulfate adenylyltransferase, small subunit. I 92.7
PRK10867 433 signal recognition particle protein; Provisional 92.37
PRK13820 394 argininosuccinate synthase; Provisional 92.18
COG0299200 PurN Folate-dependent phosphoribosylglycinamide fo 92.11
PF00731150 AIRC: AIR carboxylase; InterPro: IPR000031 Phospho 91.68
PF00875165 DNA_photolyase: DNA photolyase from Prosite.; Inte 91.33
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 91.29
TIGR00268252 conserved hypothetical protein TIGR00268. The N-te 90.93
cd01713173 PAPS_reductase This domain is found in phosphoaden 90.68
PRK12563 312 sulfate adenylyltransferase subunit 2; Provisional 90.52
TIGR00959 428 ffh signal recognition particle protein. This mode 89.88
PRK07313182 phosphopantothenoylcysteine decarboxylase; Validat 89.78
PRK06027286 purU formyltetrahydrofolate deformylase; Reviewed 89.26
PRK05579 399 bifunctional phosphopantothenoylcysteine decarboxy 88.89
PRK13982 475 bifunctional SbtC-like/phosphopantothenoylcysteine 88.65
KOG1467556 consensus Translation initiation factor 2B, delta 88.31
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 88.22
PLN02948577 phosphoribosylaminoimidazole carboxylase 88.2
TIGR00655280 PurU formyltetrahydrofolate deformylase. This mode 88.13
cd01990202 Alpha_ANH_like_I This is a subfamily of Adenine nu 87.58
TIGR03556 471 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 87.42
cd01995169 ExsB ExsB is a transcription regulator related pro 87.01
TIGR02765 429 crypto_DASH cryptochrome, DASH family. Photolyases 86.94
PRK13010289 purU formyltetrahydrofolate deformylase; Reviewed 86.62
TIGR02852187 spore_dpaB dipicolinic acid synthetase, B subunit. 86.14
COG1606 269 ATP-utilizing enzymes of the PP-loop superfamily [ 86.0
TIGR0085395 pts-lac PTS system, lactose/cellobiose family IIB 85.99
cd0556599 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of en 85.23
PRK09590104 celB cellobiose phosphotransferase system IIB comp 84.78
PRK14664 362 tRNA-specific 2-thiouridylase MnmA; Provisional 84.27
TIGR02113177 coaC_strep phosphopantothenoylcysteine decarboxyla 83.9
KOG1650769 consensus Predicted K+/H+-antiporter [Inorganic io 83.78
COG1927 277 Mtd Coenzyme F420-dependent N(5),N(10)-methenyltet 82.7
cd0556496 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lic 81.93
), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02844">PF02844100 GARS_N: Phosphoribosylglycinamide synthetase, N do 81.85
PF02601 319 Exonuc_VII_L: Exonuclease VII, large subunit; Inte 81.54
PLN00200 404 argininosuccinate synthase; Provisional 81.18
PLN02331207 phosphoribosylglycinamide formyltransferase 80.89
TIGR00032 394 argG argininosuccinate synthase. argG in bacteria, 80.89
PRK11070 575 ssDNA exonuclease RecJ; Provisional 80.75
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 80.41
PRK13011286 formyltetrahydrofolate deformylase; Reviewed 80.23
>PRK15456 universal stress protein UspG; Provisional Back     alignment and domain information 
Probab=99.94  E-value=1.1e-25  Score=153.97  Aligned_cols=139  Identities=20%  Similarity=0.248  Sum_probs=106.1

Q ss_pred             CCeEEEeecCCc--cHHHHHHHHHHHhcCCCCEEEEEEEeCCCCCcccccccCCCCCCCCCchhhhhHHHHHHhhhhhhH
Q 041485           18 NRSIGVALDFSK--GSKLALKWAIDNLLEKGDTLYIIHIKLPQGDESRNLLWSDTGSPLIPLEEFRDQEVMKQYEVDLDQ   95 (179)
Q Consensus        18 ~~~ILv~vd~s~--~s~~al~~a~~la~~~~~~l~ll~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   95 (179)
                      |++||||+|+|+  .+..|+++|..+|+.. ++++++|+.++.....    .   ....   ...   +...+...+..+
T Consensus         2 ~~~ILv~vD~S~~~~s~~al~~A~~la~~~-~~l~llhv~~~~~~~~----~---~~~~---~~~---~~~~~~~~~~~~   67 (142)
T PRK15456          2 YKTIIMPVDVFEMELSDKAVRHAEFLAQDD-GVIHLLHVLPGSASLS----L---HRFA---ADV---RRFEEHLQHEAE   67 (142)
T ss_pred             CccEEEeccCCchhHHHHHHHHHHHHHhcC-CeEEEEEEecCccccc----c---cccc---cch---hhHHHHHHHHHH
Confidence            699999999994  8999999999999874 6999999987642110    0   0000   010   112222233344


Q ss_pred             HHHHHHHHHhhcCCceEEEEEeccChhHHHHHHHHhCCCCEEEEecCCCcccccccccchhHHHhhcCCCCEEEEc
Q 041485           96 DVLDMLDAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLDSLVMGSRGLGTIQRVLLGSVSNHVLANASCPVTIVK  171 (179)
Q Consensus        96 ~~~~~~~~~~~~~~~~~~~~~~~g~~~~~i~~~a~~~~~dlvVlg~~~~~~~~~~~~gs~~~~il~~~~~pVlvv~  171 (179)
                      +.++.+.+.+...+.++++++..|++.+.|.+++++.++||||||+++++ +.++++||++++++++++||||+||
T Consensus        68 ~~l~~~~~~~~~~~~~v~~~v~~G~~~~~I~~~a~~~~~DLIVmG~~g~~-~~~~llGS~a~~v~~~a~~pVLvV~  142 (142)
T PRK15456         68 ERLQTMVSHFTIDPSRIKQHVRFGSVRDEVNELAEELGADVVVIGSRNPS-ISTHLLGSNASSVIRHANLPVLVVR  142 (142)
T ss_pred             HHHHHHHHHhCCCCcceEEEEcCCChHHHHHHHHhhcCCCEEEEcCCCCC-ccceecCccHHHHHHcCCCCEEEeC
Confidence            55555555555557788888999999999999999999999999999976 7778999999999999999999986

>PRK15005 universal stress protein F; Provisional Back     alignment and domain information
>PRK09982 universal stress protein UspD; Provisional Back     alignment and domain information
>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>PRK15118 universal stress global response regulator UspA; Provisional Back     alignment and domain information
>PRK10116 universal stress protein UspC; Provisional Back     alignment and domain information
>PF00582 Usp: Universal stress protein family; InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents Back     alignment and domain information
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd00293 USP_Like Usp: Universal stress protein family Back     alignment and domain information
>COG0589 UspA Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK12652 putative monovalent cation/H+ antiporter subunit E; Reviewed Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain Back     alignment and domain information
>PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional Back     alignment and domain information
>PRK12342 hypothetical protein; Provisional Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK03359 putative electron transfer flavoprotein FixA; Reviewed Back     alignment and domain information
>PF01012 ETF: Electron transfer flavoprotein domain; InterPro: IPR014730 Electron transfer flavoproteins (ETFs) serve as specific electron acceptors for primary dehydrogenases, transferring the electrons to terminal respiratory systems Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>COG2086 FixA Electron transfer flavoprotein, beta subunit [Energy production and conversion] Back     alignment and domain information
>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>PRK14665 mnmA tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>cd01985 ETF The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>TIGR00591 phr2 photolyase PhrII Back     alignment and domain information
>TIGR02039 CysD sulfate adenylyltransferase, small subunit Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>COG0299 PurN Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00731 AIRC: AIR carboxylase; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>PF00875 DNA_photolyase: DNA photolyase from Prosite Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00268 conserved hypothetical protein TIGR00268 Back     alignment and domain information
>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>PRK12563 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK07313 phosphopantothenoylcysteine decarboxylase; Validated Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>KOG1467 consensus Translation initiation factor 2B, delta subunit (eIF-2Bdelta/GCD2) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>TIGR03556 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 8-HDF type Back     alignment and domain information
>cd01995 ExsB ExsB is a transcription regulator related protein Back     alignment and domain information
>TIGR02765 crypto_DASH cryptochrome, DASH family Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>TIGR02852 spore_dpaB dipicolinic acid synthetase, B subunit Back     alignment and domain information
>COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>TIGR00853 pts-lac PTS system, lactose/cellobiose family IIB component Back     alignment and domain information
>cd05565 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of enzyme II (EII) of the lactose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) found in Firmicutes as well as Actinobacteria Back     alignment and domain information
>PRK09590 celB cellobiose phosphotransferase system IIB component; Reviewed Back     alignment and domain information
>PRK14664 tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>TIGR02113 coaC_strep phosphopantothenoylcysteine decarboxylase, streptococcal Back     alignment and domain information
>KOG1650 consensus Predicted K+/H+-antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1927 Mtd Coenzyme F420-dependent N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd05564 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>PF02844 GARS_N: Phosphoribosylglycinamide synthetase, N domain; InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PF02601 Exonuc_VII_L: Exonuclease VII, large subunit; InterPro: IPR020579 Exonuclease VII 3 Back     alignment and domain information
>PLN00200 argininosuccinate synthase; Provisional Back     alignment and domain information
>PLN02331 phosphoribosylglycinamide formyltransferase Back     alignment and domain information
>TIGR00032 argG argininosuccinate synthase Back     alignment and domain information
>PRK11070 ssDNA exonuclease RecJ; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query179
2gm3_A175 Crystal Structure Of An Universal Stress Protein Fa 6e-10
1wjg_A137 Crystal Structure Of A Probable Atp Binding Protein 7e-07
>pdb|2GM3|A Chain A, Crystal Structure Of An Universal Stress Protein Family Protein From Arabidopsis Thaliana At3g01520 With Amp Bound Length = 175 Back     alignment and structure 
Iteration: 1

 Score = 60.1 bits (144), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 75/161 (46%), Gaps = 11/161 (6%)
Query: 14  MASNNRSIGVALDFSKGSKLALKWAIDNLLEKGDT---LYIIHIKLPQGDESRNLLWSDT 70
           +A N  +I    + S   K A +W ++ ++    +   + ++H+++   D      + D 
Sbjct: 10  VAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVVDEDG-----FDDV 64
Query: 71  GSPLIPLEEFRDQEVMKQYEXXXXXXXXXXXXAASKQKHVSVVAKLYWGDARDKLCEAVE 130
            S     E+FRD    +Q                  +  V   A +  GD +D +C+ V+
Sbjct: 65  DSIYASPEDFRD---XRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVICQEVK 121
Query: 131 AMKLDSLVMGSRGLGTIQRVLLGSVSNHVLANASCPVTIVK 171
            ++ D LV+GSRGLG  Q+V +G+VS   + +A CPV  +K
Sbjct: 122 RVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVXTIK 162
>pdb|1WJG|A Chain A, Crystal Structure Of A Probable Atp Binding Protein From Thermus Themophilus Hb8 Length = 137 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query179
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 3e-43
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 1e-30
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 1e-28
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 3e-27
3s3t_A146 Nucleotide-binding protein, universal stress PROT 5e-26
2z08_A137 Universal stress protein family; uncharacterized c 2e-25
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 3e-25
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 2e-24
3dlo_A155 Universal stress protein; unknown function, struct 5e-23
3tnj_A150 Universal stress protein (USP); structural genomic 7e-21
3loq_A294 Universal stress protein; structural genomics, PSI 1e-20
3loq_A 294 Universal stress protein; structural genomics, PSI 3e-20
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 2e-20
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 1e-15
3fg9_A156 Protein of universal stress protein USPA family; A 2e-19
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 6e-19
3fdx_A143 Putative filament protein / universal stress PROT; 2e-18
3ab8_A 268 Putative uncharacterized protein TTHA0350; tandem- 5e-17
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 8e-14
3olq_A319 Universal stress protein E; structural genomics, P 3e-15
3olq_A 319 Universal stress protein E; structural genomics, P 3e-15
3mt0_A290 Uncharacterized protein PA1789; structural genomic 8e-12
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 2e-10
1q77_A138 Hypothetical protein AQ_178; structural genomics, 6e-06
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Length = 175 Back     alignment and structure
 Score =  141 bits (356), Expect = 3e-43
 Identities = 44/172 (25%), Positives = 80/172 (46%), Gaps = 20/172 (11%)

Query: 15  ASNNRSIGVALDFSKG---------SKLALKWAIDNLLEKGDT---LYIIHIKLPQGDES 62
            S    + VA++ S            K A +W ++ ++    +   + ++H+++   D  
Sbjct: 2   GSEPTKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVVDEDG- 60

Query: 63  RNLLWSDTGSPLIPLEEFRDQEVMKQYEVDLDQDVLDMLDAASKQKHVSVVAKLYWGDAR 122
               + D  S     E+FRD   M+Q        +L+       +  V   A +  GD +
Sbjct: 61  ----FDDVDSIYASPEDFRD---MRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPK 113

Query: 123 DKLCEAVEAMKLDSLVMGSRGLGTIQRVLLGSVSNHVLANASCPVTIVKDPS 174
           D +C+ V+ ++ D LV+GSRGLG  Q+V +G+VS   + +A CPV  +K  +
Sbjct: 114 DVICQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIKRNA 165
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Length = 138 Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Length = 163 Back     alignment and structure
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Length = 162 Back     alignment and structure
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} Length = 146 Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Length = 137 Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Length = 170 Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} Length = 147 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Length = 155 Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Length = 150 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Length = 156 Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Length = 141 Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Length = 143 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Length = 138 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query179
3s3t_A146 Nucleotide-binding protein, universal stress PROT 99.96
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 99.95
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 99.95
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 99.95
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 99.94
3tnj_A150 Universal stress protein (USP); structural genomic 99.94
3fg9_A156 Protein of universal stress protein USPA family; A 99.94
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 99.94
3dlo_A155 Universal stress protein; unknown function, struct 99.94
2z08_A137 Universal stress protein family; uncharacterized c 99.93
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 99.93
3fdx_A143 Putative filament protein / universal stress PROT; 99.93
3olq_A 319 Universal stress protein E; structural genomics, P 99.91
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 99.91
3loq_A 294 Universal stress protein; structural genomics, PSI 99.89
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 99.89
3ab8_A 268 Putative uncharacterized protein TTHA0350; tandem- 99.88
3mt0_A290 Uncharacterized protein PA1789; structural genomic 99.88
1q77_A138 Hypothetical protein AQ_178; structural genomics, 99.88
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.88
3olq_A319 Universal stress protein E; structural genomics, P 99.87
3loq_A294 Universal stress protein; structural genomics, PSI 99.87
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.86
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 99.81
2iel_A138 Hypothetical protein TT0030; TT0030,thermus thermo 97.21
3a2k_A 464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, 97.08
1wy5_A 317 TILS, hypothetical UPF0072 protein AQ_1887; N-type 97.06
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 95.15
4grd_A173 N5-CAIR mutase, phosphoribosylaminoimidazole carbo 94.11
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 94.03
1zun_A 325 Sulfate adenylyltransferase subunit 2; beta barrel 93.91
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; 93.85
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 93.84
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 93.74
2xry_A 482 Deoxyribodipyrimidine photolyase; DNA damage, DNA 93.63
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 93.4
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 93.32
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; 93.3
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 93.03
1ni5_A 433 Putative cell cycle protein MESJ; structural genom 92.78
1efv_B255 Electron transfer flavoprotein; electron transport 92.76
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; structur 92.73
1efp_B252 ETF, protein (electron transfer flavoprotein); ele 92.58
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 92.42
1o97_C 264 Electron transferring flavoprotein beta-subunit; F 92.31
3ih5_A217 Electron transfer flavoprotein alpha-subunit; alph 92.25
3kcq_A215 Phosphoribosylglycinamide formyltransferase; struc 91.56
3tqr_A215 Phosphoribosylglycinamide formyltransferase; purin 91.13
3umv_A 506 Deoxyribodipyrimidine photo-lyase; CPD cyclobutane 90.86
3p9x_A211 Phosphoribosylglycinamide formyltransferase; struc 90.66
3g40_A294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 89.3
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 88.36
2wq7_A 543 RE11660P; lyase-DNA complex, DNA repair, DNA lesio 87.86
1sur_A215 PAPS reductase; assimilatory sulfate reduction, 3- 87.46
2oq2_A261 Phosphoadenosine phosphosulfate reductase; sulfate 87.32
1k92_A 455 Argininosuccinate synthase, argininosuccinate SY; 87.07
2der_A 380 TRNA-specific 2-thiouridylase MNMA; protein-RNA co 86.47
2wsi_A 306 FAD synthetase; transferase, nucleotidyltransferas 85.66
2h31_A425 Multifunctional protein ADE2; alpha-beta-alpha, li 85.57
3o1l_A302 Formyltetrahydrofolate deformylase; structural gen 85.49
4ds3_A209 Phosphoribosylglycinamide formyltransferase; struc 85.46
3lou_A292 Formyltetrahydrofolate deformylase; structural gen 84.89
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 84.43
2hma_A 376 Probable tRNA (5-methylaminomethyl-2-thiouridylat 84.17
3n0v_A286 Formyltetrahydrofolate deformylase; formyl transfe 83.65
3da8_A215 Probable 5'-phosphoribosylglycinamide formyltransf 83.15
2nz2_A 413 Argininosuccinate synthase; amino-acid biosynthesi 83.01
3bl5_A219 Queuosine biosynthesis protein QUEC; PREQ1 biosynt 81.79
3tvs_A 538 Cryptochrome-1; circadian clock light entrainment, 81.41
1np7_A 489 DNA photolyase; protein with FAD cofactor; HET: DN 80.32
1iv0_A98 Hypothetical protein; rnaseh-like, YQGF, structura 80.23
3nbm_A108 PTS system, lactose-specific IIBC components; PTS_ 80.08
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 Back     alignment and structure
Probab=99.96  E-value=7e-28  Score=164.14  Aligned_cols=140  Identities=16%  Similarity=0.221  Sum_probs=118.3

Q ss_pred             CCeEEEeecCCccHHHHHHHHHHHhcCCCCEEEEEEEeCCCCCcccccccCCCCCCCCCchhhhhHHHHHHhhhhhhHHH
Q 041485           18 NRSIGVALDFSKGSKLALKWAIDNLLEKGDTLYIIHIKLPQGDESRNLLWSDTGSPLIPLEEFRDQEVMKQYEVDLDQDV   97 (179)
Q Consensus        18 ~~~ILv~vd~s~~s~~al~~a~~la~~~~~~l~ll~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   97 (179)
                      +++|||++|+|+.+..++++|+.+|+..+++++++|+.+......              ...........+...+..++.
T Consensus         5 ~~~ILv~~D~s~~s~~al~~A~~la~~~~a~l~ll~v~~~~~~~~--------------~~~~~~~~~~~~~~~~~~~~~   70 (146)
T 3s3t_A            5 YTNILVPVDSSDAAQAAFTEAVNIAQRHQANLTALYVVDDSAYHT--------------PALDPVLSELLDAEAAHAKDA   70 (146)
T ss_dssp             CCEEEEECCSSHHHHHHHHHHHHHHHHHTCEEEEEEEEECCCCCC--------------GGGHHHHHHHHHHHHHHHHHH
T ss_pred             cceEEEEcCCCHHHHHHHHHHHHHHHhcCCEEEEEEEecCccccc--------------cccccccHHHHHHHHHHHHHH
Confidence            799999999999999999999999999999999999988764211              000001122333444556777


Q ss_pred             HHHHHHHhhcCCc-eEEEEEeccChhHHHHH-HHHhCCCCEEEEecCCCcccccccccchhHHHhhcCCCCEEEEc
Q 041485           98 LDMLDAASKQKHV-SVVAKLYWGDARDKLCE-AVEAMKLDSLVMGSRGLGTIQRVLLGSVSNHVLANASCPVTIVK  171 (179)
Q Consensus        98 ~~~~~~~~~~~~~-~~~~~~~~g~~~~~i~~-~a~~~~~dlvVlg~~~~~~~~~~~~gs~~~~il~~~~~pVlvv~  171 (179)
                      ++.+.+.+.+.|+ ++++.+..|++.+.|++ ++++.++||||||+++++.+.++++||++++++++++||||+||
T Consensus        71 l~~~~~~~~~~g~~~~~~~~~~g~~~~~I~~~~a~~~~~dliV~G~~~~~~~~~~~~Gs~~~~vl~~~~~pVlvV~  146 (146)
T 3s3t_A           71 MRQRQQFVATTSAPNLKTEISYGIPKHTIEDYAKQHPEIDLIVLGATGTNSPHRVAVGSTTSYVVDHAPCNVIVIR  146 (146)
T ss_dssp             HHHHHHHHTTSSCCCCEEEEEEECHHHHHHHHHHHSTTCCEEEEESCCSSCTTTCSSCHHHHHHHHHCSSEEEEEC
T ss_pred             HHHHHHHHHhcCCcceEEEEecCChHHHHHHHHHhhcCCCEEEECCCCCCCcceEEEcchHHHHhccCCCCEEEeC
Confidence            8888888888899 99999999999999999 99999999999999999999999999999999999999999997
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Back     alignment and structure
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Back     alignment and structure
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>2iel_A Hypothetical protein TT0030; TT0030,thermus thermophilus, structural genomics, PSI, protein structure initiative; 1.60A {Thermus thermophilus} SCOP: c.26.2.4 Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Back     alignment and structure
>4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Back     alignment and structure
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A* Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Back     alignment and structure
>2xry_A Deoxyribodipyrimidine photolyase; DNA damage, DNA repair; HET: FAD; 1.50A {Methanosarcina mazei} PDB: 2xrz_A* Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Back     alignment and structure
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0 Back     alignment and structure
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Back     alignment and structure
>1efv_B Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 PDB: 1t9g_S* 2a1u_B* 2a1t_S* Back     alignment and structure
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Back     alignment and structure
>1efp_B ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Back     alignment and structure
>1o97_C Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 PDB: 1o95_C* 1o96_A* 1o94_C* 3clr_C* 3cls_C* 3clt_C* 3clu_C* Back     alignment and structure
>3ih5_A Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural center for infectious disease, ssgcid; 2.20A {Anaplasma phagocytophilum} SCOP: c.65.1.0 Back     alignment and structure
>3tqr_A Phosphoribosylglycinamide formyltransferase; purines, pyrimidines, nucleosides, nucleotides; HET: NHE; 1.97A {Coxiella burnetii} SCOP: c.65.1.0 Back     alignment and structure
>3umv_A Deoxyribodipyrimidine photo-lyase; CPD cyclobutane pyrimidine dimers, UV damaged DNA, DNA repai flavoprotein; HET: FAD; 1.71A {Oryza sativa japonica group} Back     alignment and structure
>3p9x_A Phosphoribosylglycinamide formyltransferase; structural genomics, PSI-biology, protein STRU initiative; 1.90A {Bacillus halodurans} Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>2wq7_A RE11660P; lyase-DNA complex, DNA repair, DNA lesion, lyase; HET: TDY Z FAD; 2.00A {Drosophila melanogaster} PDB: 2wb2_A* 2wq6_A* 3cvu_A* 3cvv_A* 3cvy_A* 3cvw_A* 3cvx_A* Back     alignment and structure
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Back     alignment and structure
>2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>1k92_A Argininosuccinate synthase, argininosuccinate SY; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A* Back     alignment and structure
>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A* Back     alignment and structure
>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>4ds3_A Phosphoribosylglycinamide formyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.85A {Brucella melitensis BV} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>2hma_A Probable tRNA (5-methylaminomethyl-2-thiouridylat methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* Back     alignment and structure
>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, ST genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens} Back     alignment and structure
>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis} Back     alignment and structure
>1np7_A DNA photolyase; protein with FAD cofactor; HET: DNA FAD; 1.90A {Synechocystis SP} SCOP: a.99.1.1 c.28.1.1 Back     alignment and structure
>1iv0_A Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus} SCOP: c.55.3.8 Back     alignment and structure
>3nbm_A PTS system, lactose-specific IIBC components; PTS_IIB_LACTOSE, phosphoenolpyruvate:carbohydrate system, P- phosphorylation; HET: MSE; 1.30A {Streptococcus pneumoniae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 179
d2gm3a1171 c.26.2.4 (A:5-175) Putative ethylene-responsive pr 1e-26
d1mjha_160 c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archa 3e-26
d1tq8a_147 c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobac 2e-19
d2z3va1135 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 { 2e-19
d1jmva_140 c.26.2.4 (A:) Universal stress protein A, UspA {Ha 6e-15
d1q77a_138 c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex 6e-11
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 171 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: Putative ethylene-responsive protein AT3g01520/F4P13 7
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 97.6 bits (242), Expect = 1e-26
 Identities = 43/166 (25%), Positives = 79/166 (47%), Gaps = 20/166 (12%)

Query: 21  IGVALDFS---------KGSKLALKWAIDNLLEKGDT---LYIIHIKLPQGDESRNLLWS 68
           + VA++ S            K A +W ++ ++    +   + ++H+++   D      + 
Sbjct: 4   VMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVVDEDG-----FD 58

Query: 69  DTGSPLIPLEEFRDQEVMKQYEVDLDQDVLDMLDAASKQKHVSVVAKLYWGDARDKLCEA 128
           D  S     E+FRD   M+Q        +L+       +  V   A +  GD +D +C+ 
Sbjct: 59  DVDSIYASPEDFRD---MRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVICQE 115

Query: 129 VEAMKLDSLVMGSRGLGTIQRVLLGSVSNHVLANASCPVTIVKDPS 174
           V+ ++ D LV+GSRGLG  Q+V +G+VS   + +A CPV  +K  +
Sbjct: 116 VKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIKRNA 161
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 160 Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 147 Back     information, alignment and structure
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Length = 135 Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Length = 140 Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Length = 138 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query179
d1mjha_160 "Hypothetical" protein MJ0577 {Archaeon Methanococ 99.98
d1tq8a_147 Hypothetical protein Rv1636 {Mycobacterium tubercu 99.95
d2z3va1135 Hypothetical protein TTHA0895 {Thermus thermophilu 99.95
d2gm3a1171 Putative ethylene-responsive protein AT3g01520/F4P 99.94
d1jmva_140 Universal stress protein A, UspA {Haemophilus infl 99.91
d1q77a_138 Hypothetical protein Aq_178 {Aquifex aeolicus [Tax 99.88
d1wy5a1216 TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId 97.53
d1ni5a1227 tRNA-Ile-lysidine synthetase, TilS, N-terminal dom 96.55
d3clsc1 262 Small, beta subunit of electron transfer flavoprot 96.39
d1efpb_246 Small, beta subunit of electron transfer flavoprot 96.08
d1np7a2204 Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 94.93
d1xmpa_155 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 94.64
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 94.51
d1qcza_163 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 94.46
d1o4va_169 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 94.23
d1efvb_252 Small, beta subunit of electron transfer flavoprot 94.06
d3clsd1192 Large, alpha subunit of electron transfer flavopro 92.24
d1owla2202 DNA photolyase {Synechococcus elongatus [TaxId: 32 92.08
d1vbka1132 Hypothetical protein PH1313, C-terminal domain {Ar 90.03
d2j07a2170 DNA photolyase {Thermus thermophilus [TaxId: 274]} 89.76
d1ls1a2207 GTPase domain of the signal sequence recognition p 89.06
d2qy9a2211 GTPase domain of the signal recognition particle r 88.45
d1s8na_190 Probable two-component system transcriptional regu 87.72
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 86.57
d1p3y1_183 MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} 86.01
d1ycga1149 Nitric oxide reductase C-terminal domain {Moorella 81.84
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 81.8
d1qzua_181 4'-phosphopantothenoylcysteine decarboxylase (PPC 81.03
d1vmaa2213 GTPase domain of the signal recognition particle r 80.73
d2c5sa1218 Thiamine biosynthesis protein ThiI, C-terminal dom 80.66
d1okkd2207 GTPase domain of the signal recognition particle r 80.16
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: "Hypothetical" protein MJ0577
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=99.98  E-value=2.6e-31  Score=182.53  Aligned_cols=157  Identities=19%  Similarity=0.264  Sum_probs=121.7

Q ss_pred             CCeEEEeecCCccHHHHHHHHHHHhcCCCCEEEEEEEeCCCCCcccccccCCCCCCCCCchhhhhHHHHHHhhhhhhHHH
Q 041485           18 NRSIGVALDFSKGSKLALKWAIDNLLEKGDTLYIIHIKLPQGDESRNLLWSDTGSPLIPLEEFRDQEVMKQYEVDLDQDV   97 (179)
Q Consensus        18 ~~~ILv~vd~s~~s~~al~~a~~la~~~~~~l~ll~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   97 (179)
                      ||+||||+|+|+.+..++++|..+|+..+++|+++|+.++.............+................+...+..++.
T Consensus         3 ~~~ILvavD~s~~s~~al~~a~~la~~~~a~l~llhV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (160)
T d1mjha_           3 YKKILYPTDFSETAEIALKHVKAFKTLKAEEVILLHVIDEREIKKRDIFSLLLGVAGLNKSVEEFENELKNKLTEEAKNK   82 (160)
T ss_dssp             CCEEEEECCSCHHHHHHHHHHHHTCCSSCCEEEEEEEEEGGGTC-----------------CHHHHHHHHHHHHHHHHHH
T ss_pred             cCeEEEEECCCHHHHHHHHHHHHHHHhcCCEEEEEEecccccccccccccccccccccchhHHHHHHHHHHHHHHHHHHH
Confidence            79999999999999999999999999999999999998765433211111111111111111111223334445556677


Q ss_pred             HHHHHHHhhcCCceEEEEEeccChhHHHHHHHHhCCCCEEEEecCCCcccccccccchhHHHhhcCCCCEEEEcCCC
Q 041485           98 LDMLDAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLDSLVMGSRGLGTIQRVLLGSVSNHVLANASCPVTIVKDPS  174 (179)
Q Consensus        98 ~~~~~~~~~~~~~~~~~~~~~g~~~~~i~~~a~~~~~dlvVlg~~~~~~~~~~~~gs~~~~il~~~~~pVlvv~~~~  174 (179)
                      ++.+.+.+...|+++++.+..|++.+.|++++++.++||||||+++++.+.++|+||++++|+++++|||++||++.
T Consensus        83 l~~~~~~~~~~gv~~~~~~~~G~~~~~I~~~a~~~~~dliV~G~~~~~~~~~~~~GS~a~~vl~~s~~pVlvV~~~~  159 (160)
T d1mjha_          83 MENIKKELEDVGFKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLGSVTENVIKKSNKPVLVVKRKN  159 (160)
T ss_dssp             HHHHHHHHHHTTCEEEEEEEEECHHHHHHHHHHHTTCSEEEEESCCSSCCTTCSSCHHHHHHHHHCCSCEEEECCCC
T ss_pred             HHHHHHHHHhcCCeEEEEEEeccHHHHHhhhhhccccceEEeccCCCCcccccccCcHHHHHHhcCCCCEEEEcCCC
Confidence            77888888889999999999999999999999999999999999999999999999999999999999999999865
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3clsc1 c.26.2.3 (C:1-262) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1efpb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1np7a2 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1efvb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3clsd1 c.26.2.3 (D:1-192) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1owla2 c.28.1.1 (A:3-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1vbka1 c.26.2.6 (A:176-307) Hypothetical protein PH1313, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2j07a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1p3y1_ c.34.1.1 (1:) MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1qzua_ c.34.1.1 (A:) 4'-phosphopantothenoylcysteine decarboxylase (PPC decarboxylase, halotolerance protein Hal3a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure