Citrus Sinensis ID: 041509


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-
MACWSAENATKAYLKTLKMGQKAKEPNEAEFISALAAGNNAQLMVVACANVANATTLALAAAAHQTGGRVVCILRRVEEYKLSKKILGLDASHVEFVIGDAQSLLLSHFREADFVLIDCNLENHEGVLRAVQAGNKPNGAVVVGYNAFRKGSWRSSGSKSQLLPIGEGLLVTRIAAASANKKSHWIVKVDKCTGEEHVFRVRFPQGKQIQA
cccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHccccccEEEEEccHHHHHHHccccccEEEEEccccccHHHHHHHHcccccccEEEEEEccccccccccccccEEEEEccccEEEEEEEEcccccccccEEEcccccccEEEEEEEccccccccc
cccccHHHHHHHHHHHHHHcHccccccHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHccccccEEEEcccHHHHHHHHccccEEEEEccHHHHHHHHHHHHcccccccEEEEEEcccEcccccccEEEEEEEEccccEEEEEEEccccccccEEEEEEEcccccEEEEEEEcccccEEEc
macwsaenATKAYLKTLKMgqkakepnEAEFISALAAGNNAQLMVVACANVANATTLALAAAAHQTGGRVVCILRRVEEYKLSKKilgldashVEFVIGDAQSLLLSHFREADFVLIDCNLENHEGVLRAVqagnkpngavVVGYNafrkgswrssgsksqllpigegLLVTRIAAASANKKSHWIVKvdkctgeehvfrvrfpqgkqiqa
macwsaenaTKAYLKTLKMGQKAKEPNEAEFISALAAGNNAQLMVVACANVANATTLALAAAAHQTGGRVVCILRRVEEYKLSKKILGLDASHVEFVIGDAQSLLLSHFREADFVLIDCNLENHEGVLRAvqagnkpngAVVVGYNAfrkgswrssgsksqllpIGEGLLVTRIAAAsankkshwivkVDKCTGEEHVfrvrfpqgkqiqa
MACWSAENATKAYLKTLKMGQKAKEPNEAEFISALAAGNNAQLMVvacanvanattlalaaaaHQTGGRVVCILRRVEEYKLSKKILGLDASHVEFVIGDAQSLLLSHFREADFVLIDCNLENHEGVLRAVQAGNKPNGAVVVGYNAFrkgswrssgsksQLLPIGEGLLVTRIAAASANKKSHWIVKVDKCTGEEHVFRVRFPQGKQIQA
*****************************EFISALAAGNNAQLMVVACANVANATTLALAAAAHQTGGRVVCILRRVEEYKLSKKILGLDASHVEFVIGDAQSLLLSHFREADFVLIDCNLENHEGVLRAVQAGNKPNGAVVVGYNAFRKGSWRS****SQLLPIGEGLLVTRIAAASANKKSHWIVKVDKCTGEEHVFRVRF********
**CWSAENATKAYLKTLKMGQKAKEPNEAEFISALAAGNNAQLMVVACANVANATTLALAAAAHQTGGRVVCILRRVEEYKLSKKILGLDASHVEFVIGDAQSLLLSHFREADFVLIDCNLENHEGVLRAVQAGNKPNGAVVVGYNAFRKGSWRSSGSKSQLLPIGEGLL*****************KVDKCTGEEHVFRVRFPQ******
********ATKAYLKTLKMGQKAKEPNEAEFISALAAGNNAQLMVVACANVANATTLALAAAAHQTGGRVVCILRRVEEYKLSKKILGLDASHVEFVIGDAQSLLLSHFREADFVLIDCNLENHEGVLRAVQAGNKPNGAVVVGYNAFRKG*********QLLPIGEGLLVTRIAAASANKKSHWIVKVDKCTGEEHVFRVRFPQGKQIQA
*ACWSAENATKAYLKTLKMGQKAKEPNEAEFISALAAGNNAQLMVVACANVANATTLALAAAAHQTGGRVVCILRRVEEYKLSKKILGLDASHVEFVIGDAQSLLLSHFREADFVLIDCNLENHEGVLRAVQAGNKPNGAVVVGYNAFRKGSWRSSGSKSQLLPIGEGLLVTRIAAASANKKSHWIVKVDKCTGEEHVFRVRFPQGKQIQ*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MACWSAENATKAYLKTLKMGQKAKEPNEAEFISALAAGNNAQLMVVACANVANATTLALAAAAHQTGGRVVCILRRVEEYKLSKKILGLDASHVEFVIGDAQSLLLSHFREADFVLIDCNLENHEGVLRAVQAGNKPNGAVVVGYNAFRKGSWRSSGSKSQLLPIGEGLLVTRIAAASANKKSHWIVKVDKCTGEEHVFRVRFPQGKQIQA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query211
224120226218 predicted protein [Populus trichocarpa] 1.0 0.967 0.756 8e-90
225455533219 PREDICTED: uncharacterized protein LOC10 1.0 0.963 0.767 3e-89
224136790218 predicted protein [Populus trichocarpa] 1.0 0.967 0.775 4e-83
388522455226 unknown [Lotus japonicus] 1.0 0.933 0.672 3e-76
255539703206 conserved hypothetical protein [Ricinus 0.914 0.936 0.708 1e-75
356576563223 PREDICTED: uncharacterized protein LOC10 1.0 0.946 0.668 3e-75
356530959222 PREDICTED: uncharacterized protein LOC10 0.995 0.945 0.663 5e-75
356535312224 PREDICTED: uncharacterized protein LOC10 1.0 0.941 0.660 8e-75
255648119224 unknown [Glycine max] 1.0 0.941 0.660 2e-74
357504103222 hypothetical protein MTR_7g034710 [Medic 0.985 0.936 0.635 7e-74
>gi|224120226|ref|XP_002318277.1| predicted protein [Populus trichocarpa] gi|222858950|gb|EEE96497.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  335 bits (859), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 165/218 (75%), Positives = 184/218 (84%), Gaps = 7/218 (3%)

Query: 1   MACWSAENATKAYLKTLKMGQKAKEPNEAEFISALAAGNNAQLMVVACANVANATTLALA 60
           M  WSAENAT AYLKTL+MGQ+A EP+ AEFISALAAGNNAQLMVVACAN A  T+L L 
Sbjct: 1   MGYWSAENATNAYLKTLRMGQRANEPDVAEFISALAAGNNAQLMVVACANAAATTSLTLV 60

Query: 61  AAAHQTGGRVVCILRRVEEYKLSKKILGLDASHVEFVIGDAQSLLLSHFREADFVLIDCN 120
           AAAHQTGGRVVCIL   +E +LSKKILG DA HVEFVIG+AQSLLL+H+ EADFVLIDCN
Sbjct: 61  AAAHQTGGRVVCILPGHQELQLSKKILGYDACHVEFVIGEAQSLLLTHYSEADFVLIDCN 120

Query: 121 LENHEGVLRAVQAGNKPNGAVVVGYNAFRKGSWRSSGSKSQLLPIGEGLLVTRIAAASA- 179
           LENHE +L +VQA  K NGAVVVGYNAF KGSWRS GSK+QLLPIG GLLVTRI+A++  
Sbjct: 121 LENHEAILGSVQARKKRNGAVVVGYNAFSKGSWRSGGSKTQLLPIGGGLLVTRISASAKI 180

Query: 180 ------NKKSHWIVKVDKCTGEEHVFRVRFPQGKQIQA 211
                  K+SHW+VKVD+CTGEEHVFRVRFPQGKQI+A
Sbjct: 181 ADGCGHGKRSHWVVKVDECTGEEHVFRVRFPQGKQIEA 218




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225455533|ref|XP_002266318.1| PREDICTED: uncharacterized protein LOC100265251 [Vitis vinifera] gi|296084137|emb|CBI24525.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224136790|ref|XP_002322416.1| predicted protein [Populus trichocarpa] gi|222869412|gb|EEF06543.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388522455|gb|AFK49289.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255539703|ref|XP_002510916.1| conserved hypothetical protein [Ricinus communis] gi|223550031|gb|EEF51518.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356576563|ref|XP_003556400.1| PREDICTED: uncharacterized protein LOC100816283 [Glycine max] Back     alignment and taxonomy information
>gi|356530959|ref|XP_003534046.1| PREDICTED: uncharacterized protein LOC100805528 [Glycine max] Back     alignment and taxonomy information
>gi|356535312|ref|XP_003536191.1| PREDICTED: uncharacterized protein LOC100775961 [Glycine max] Back     alignment and taxonomy information
>gi|255648119|gb|ACU24514.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357504103|ref|XP_003622340.1| hypothetical protein MTR_7g034710 [Medicago truncatula] gi|217071496|gb|ACJ84108.1| unknown [Medicago truncatula] gi|355497355|gb|AES78558.1| hypothetical protein MTR_7g034710 [Medicago truncatula] gi|388491994|gb|AFK34063.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query211
TAIR|locus:2167913236 AT5G62280 "AT5G62280" [Arabido 0.824 0.737 0.475 3.5e-36
TAIR|locus:2050842215 AT2G45360 "AT2G45360" [Arabido 0.909 0.893 0.320 9.5e-18
TAIR|locus:2034645212 AT1G12320 "AT1G12320" [Arabido 0.928 0.924 0.271 2.9e-16
TAIR|locus:2101911218 AT3G60780 "AT3G60780" [Arabido 0.924 0.894 0.260 5e-12
TAIR|locus:2026202224 AT1G62840 "AT1G62840" [Arabido 0.843 0.794 0.269 5.2e-10
TAIR|locus:2167913 AT5G62280 "AT5G62280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 390 (142.3 bits), Expect = 3.5e-36, P = 3.5e-36
 Identities = 89/187 (47%), Positives = 116/187 (62%)

Query:     1 MACWSAENATKAYLKTLKMGQKAKEPNEAEFISALAAGNNAQ-LMVXXXXXXXXXXXXXX 59
             MA WSAENATKAYL TLK  Q+ KEPN AEFISALAAGN+A+ + V              
Sbjct:     1 MAFWSAENATKAYLSTLKTDQRTKEPNVAEFISALAAGNSARKIAVACAGAANADILVAL 60

Query:    60 XXXXHQTGGRVVCILRRVEEYKLSKKILGLDASH-VEFVIGDAQ--SLLLSHFREADFVL 116
                 +QT G+VVC+LR +EE  +S+K+L     H ++FV+G++   +L+ +HF EADFVL
Sbjct:    61 IAAANQTRGQVVCVLRGIEELIISQKMLEPSEIHQIQFVVGESNDDTLINNHFGEADFVL 120

Query:   117 IDCNLENHEGVLRAVQAGNKPNG--------AVVVGYNAFXXXX-XXXXXXXXQLLPIGE 167
             +DCNLENH+ ++  +   ++ N         AVVVGYNAF             Q LPIGE
Sbjct:   121 VDCNLENHQEIVGKILNHHEENARTGGGSGVAVVVGYNAFSRGSWRFSDGRKTQFLPIGE 180

Query:   168 GLLVTRI 174
             GLLVTR+
Sbjct:   181 GLLVTRV 187


GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2050842 AT2G45360 "AT2G45360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034645 AT1G12320 "AT1G12320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101911 AT3G60780 "AT3G60780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026202 AT1G62840 "AT1G62840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
pfam07279218 pfam07279, DUF1442, Protein of unknown function (D 2e-27
COG4122219 COG4122, COG4122, Predicted O-methyltransferase [G 6e-07
>gnl|CDD|115904 pfam07279, DUF1442, Protein of unknown function (DUF1442) Back     alignment and domain information
 Score =  103 bits (257), Expect = 2e-27
 Identities = 73/219 (33%), Positives = 112/219 (51%), Gaps = 28/219 (12%)

Query: 4   WSAENATKAYLKTLKMGQKAKEPNEAEFISALAAGNNAQLMVVACAN-VANATTLALAAA 62
           WS E A+KAY+ T+K  +    P  AE ++A+AAG NA+L+V   +     AT++ L  A
Sbjct: 5   WSPETASKAYIDTVKSCENLGTPGAAELLAAMAAGWNARLIVETWSEGDPIATSVGLNVA 64

Query: 63  AHQTGGRVVCIL---RRVEEYKLSKKILGLDASHV-EFVIGDAQSLLLSHFREADFVLID 118
           +  T GR +CI+   R    Y  +  +     S++ E ++G+     +   +  DF+++D
Sbjct: 65  SRHTNGRHICIVPNERSQSAYLQA--MREQSTSNLPETIVGEELEHTMETLQGVDFLVVD 122

Query: 119 CNLENHE---GVLRAVQAGNKPNGAVVVGYNAFRKG----SWRS--SGSK---SQLLPIG 166
              +  E     LR  + GN+  GAVVV  N +R+     SW       +   +  LP+G
Sbjct: 123 W--KRKEFAANALRNAKFGNR--GAVVVCRNGYRRSISGFSWTKVLRDRRVVRTVTLPVG 178

Query: 167 EGLLVTRIAAA-----SANKKSHWIVKVDKCTGEEHVFR 200
            GL +  +AAA     S N K  WI  VD+ +GEEHVFR
Sbjct: 179 GGLEIAHVAAAGSGGSSNNNKRRWIKHVDQRSGEEHVFR 217


This family consists of several hypothetical Arabidopsis thaliana proteins of around 225 residues in length. The function of this family is unknown. Length = 218

>gnl|CDD|226607 COG4122, COG4122, Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 211
PF07279218 DUF1442: Protein of unknown function (DUF1442); In 100.0
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 100.0
COG4122219 Predicted O-methyltransferase [General function pr 100.0
PLN02589247 caffeoyl-CoA O-methyltransferase 100.0
PLN02476278 O-methyltransferase 100.0
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 99.98
KOG1663237 consensus O-methyltransferase [Secondary metabolit 99.97
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 99.72
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.71
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 99.71
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.7
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.7
PLN03075296 nicotianamine synthase; Provisional 99.69
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 99.66
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.66
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.65
PRK04457262 spermidine synthase; Provisional 99.65
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.65
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.65
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 99.65
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.64
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 99.64
PRK07402196 precorrin-6B methylase; Provisional 99.62
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.62
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.62
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.6
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 99.57
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 99.57
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.55
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.53
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.53
PLN02233261 ubiquinone biosynthesis methyltransferase 99.53
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.53
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 99.52
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 99.52
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.51
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 99.5
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 99.49
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 99.48
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.48
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.48
PRK14902444 16S rRNA methyltransferase B; Provisional 99.48
PLN02244340 tocopherol O-methyltransferase 99.48
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.47
PRK14901434 16S rRNA methyltransferase B; Provisional 99.47
COG4123248 Predicted O-methyltransferase [General function pr 99.47
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.47
PRK00811283 spermidine synthase; Provisional 99.46
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.45
PRK01581374 speE spermidine synthase; Validated 99.45
PRK04266226 fibrillarin; Provisional 99.44
PRK14903431 16S rRNA methyltransferase B; Provisional 99.44
COG1092393 Predicted SAM-dependent methyltransferases [Genera 99.44
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 99.44
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.43
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.43
PRK14904445 16S rRNA methyltransferase B; Provisional 99.43
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.42
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.42
PLN02366308 spermidine synthase 99.41
PRK10901427 16S rRNA methyltransferase B; Provisional 99.41
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.4
PRK11207197 tellurite resistance protein TehB; Provisional 99.39
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.39
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 99.38
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 99.38
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.37
COG2521287 Predicted archaeal methyltransferase [General func 99.37
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.36
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.36
COG4106257 Tam Trans-aconitate methyltransferase [General fun 99.35
TIGR00536284 hemK_fam HemK family putative methylases. The gene 99.35
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.35
PLN02823336 spermine synthase 99.34
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 99.34
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 99.34
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 99.34
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 99.34
PRK14967223 putative methyltransferase; Provisional 99.34
PRK14968188 putative methyltransferase; Provisional 99.34
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.34
PRK08317241 hypothetical protein; Provisional 99.33
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 99.33
PLN02336475 phosphoethanolamine N-methyltransferase 99.32
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 99.32
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.31
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.31
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.31
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 99.31
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 99.3
PRK06922677 hypothetical protein; Provisional 99.3
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.3
PRK03612521 spermidine synthase; Provisional 99.29
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 99.29
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 99.28
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 99.28
PRK12335287 tellurite resistance protein TehB; Provisional 99.28
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 99.28
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 99.28
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 99.27
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.27
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.27
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 99.26
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 99.26
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 99.25
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 99.25
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 99.25
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.23
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 99.22
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 99.22
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 99.21
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 99.21
PLN02490340 MPBQ/MSBQ methyltransferase 99.19
PTZ00146293 fibrillarin; Provisional 99.19
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 99.18
smart00650169 rADc Ribosomal RNA adenine dimethylases. 99.18
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 99.18
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.18
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 99.17
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 99.17
TIGR00452314 methyltransferase, putative. Known examples to dat 99.17
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 99.17
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.16
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 99.16
TIGR03438301 probable methyltransferase. This model represents 99.15
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.14
COG0421282 SpeE Spermidine synthase [Amino acid transport and 99.14
COG2890280 HemK Methylase of polypeptide chain release factor 99.13
PLN02336 475 phosphoethanolamine N-methyltransferase 99.13
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 99.11
PRK13255218 thiopurine S-methyltransferase; Reviewed 99.11
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 99.1
COG0742187 N6-adenine-specific methylase [DNA replication, re 99.1
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 99.09
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 99.08
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 99.08
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 99.07
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 99.07
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.06
KOG1270282 consensus Methyltransferases [Coenzyme transport a 99.06
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 99.06
COG2265432 TrmA SAM-dependent methyltransferases related to t 99.06
COG2263198 Predicted RNA methylase [Translation, ribosomal st 99.05
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 99.05
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 99.04
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 99.04
TIGR00438188 rrmJ cell division protein FtsJ. 99.03
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 99.01
PRK06202232 hypothetical protein; Provisional 99.01
PRK05785226 hypothetical protein; Provisional 99.01
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 99.0
KOG4300252 consensus Predicted methyltransferase [General fun 98.99
PLN02672 1082 methionine S-methyltransferase 98.98
KOG2904328 consensus Predicted methyltransferase [General fun 98.96
PTZ00338294 dimethyladenosine transferase-like protein; Provis 98.96
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.94
PHA03412241 putative methyltransferase; Provisional 98.93
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.92
PHA03411279 putative methyltransferase; Provisional 98.91
COG2520341 Predicted methyltransferase [General function pred 98.89
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 98.88
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.85
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.83
PF04989206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 98.83
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.81
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 98.81
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.81
PLN02585315 magnesium protoporphyrin IX methyltransferase 98.79
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 98.79
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.79
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 98.76
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 98.75
PRK00050 296 16S rRNA m(4)C1402 methyltranserfase; Provisional 98.75
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 98.73
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 98.72
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 98.69
PRK13256226 thiopurine S-methyltransferase; Reviewed 98.67
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 98.67
PRK00536262 speE spermidine synthase; Provisional 98.67
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 98.65
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 98.61
KOG1271227 consensus Methyltransferases [General function pre 98.61
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 98.59
KOG1499 346 consensus Protein arginine N-methyltransferase PRM 98.59
KOG2899288 consensus Predicted methyltransferase [General fun 98.58
KOG3010261 consensus Methyltransferase [General function pred 98.58
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 98.56
PLN02232160 ubiquinone biosynthesis methyltransferase 98.55
COG4976287 Predicted methyltransferase (contains TPR repeat) 98.52
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 98.52
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 98.51
COG1041347 Predicted DNA modification methylase [DNA replicat 98.51
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 98.51
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 98.45
PRK10742250 putative methyltransferase; Provisional 98.43
COG4262508 Predicted spermidine synthase with an N-terminal m 98.43
KOG2361264 consensus Predicted methyltransferase [General fun 98.42
PRK04148134 hypothetical protein; Provisional 98.41
KOG0820315 consensus Ribosomal RNA adenine dimethylase [RNA p 98.38
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.38
KOG3420185 consensus Predicted RNA methylase [Translation, ri 98.35
KOG2730263 consensus Methylase [General function prediction o 98.33
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 98.33
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 98.3
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 98.3
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 98.28
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 98.27
KOG1709271 consensus Guanidinoacetate methyltransferase and r 98.24
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 98.23
COG4076252 Predicted RNA methylase [General function predicti 98.21
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 98.12
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.11
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 98.08
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 98.02
PF13679141 Methyltransf_32: Methyltransferase domain 98.01
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 98.0
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 97.99
TIGR00006 305 S-adenosyl-methyltransferase MraW. Genetics paper 97.95
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 97.91
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 97.82
PHA01634156 hypothetical protein 97.8
PF05711248 TylF: Macrocin-O-methyltransferase (TylF); InterPr 97.79
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 97.78
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 97.75
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 97.74
COG2384226 Predicted SAM-dependent methyltransferase [General 97.74
PRK10611287 chemotaxis methyltransferase CheR; Provisional 97.73
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 97.68
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 97.66
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 97.62
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 97.6
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 97.6
COG3897218 Predicted methyltransferase [General function pred 97.57
KOG1562337 consensus Spermidine synthase [Amino acid transpor 97.55
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 97.54
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 97.54
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 97.53
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 97.51
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 97.49
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 97.47
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 97.45
PF02005 377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 97.42
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 97.39
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 97.38
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferas 97.35
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 97.35
PF01795 310 Methyltransf_5: MraW methylase family; InterPro: I 97.28
COG3510237 CmcI Cephalosporin hydroxylase [Defense mechanisms 97.26
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 97.18
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 97.16
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 97.12
COG0286489 HsdM Type I restriction-modification system methyl 97.1
COG0275 314 Predicted S-adenosylmethionine-dependent methyltra 97.07
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 97.04
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 96.91
KOG2198375 consensus tRNA cytosine-5-methylases and related e 96.9
KOG2352482 consensus Predicted spermine/spermidine synthase [ 96.89
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 96.84
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 96.74
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 96.7
KOG1501 636 consensus Arginine N-methyltransferase [General fu 96.69
cd00315275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 96.69
KOG2940325 consensus Predicted methyltransferase [General fun 96.68
KOG1227351 consensus Putative methyltransferase [General func 96.63
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 96.61
KOG3115249 consensus Methyltransferase-like protein [General 96.57
COG5459 484 Predicted rRNA methylase [Translation, ribosomal s 96.53
KOG1253 525 consensus tRNA methyltransferase [Translation, rib 96.51
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 96.45
KOG1269364 consensus SAM-dependent methyltransferases [Lipid 96.4
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 96.28
PRK11524 284 putative methyltransferase; Provisional 96.23
KOG1596317 consensus Fibrillarin and related nucleolar RNA-bi 96.15
PF05430124 Methyltransf_30: S-adenosyl-L-methionine-dependent 96.14
PRK13699227 putative methylase; Provisional 96.13
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 96.12
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 96.09
KOG3201201 consensus Uncharacterized conserved protein [Funct 95.99
PRK09880343 L-idonate 5-dehydrogenase; Provisional 95.88
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 95.87
COG4798238 Predicted methyltransferase [General function pred 95.81
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 95.75
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 95.68
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 95.59
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 95.59
KOG2793248 consensus Putative N2,N2-dimethylguanosine tRNA me 95.53
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 95.52
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 95.5
KOG3045325 consensus Predicted RNA methylase involved in rRNA 95.44
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 95.4
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 95.4
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 95.33
KOG2360413 consensus Proliferation-associated nucleolar prote 95.26
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 95.14
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 95.11
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 95.1
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 95.06
PF00145 335 DNA_methylase: C-5 cytosine-specific DNA methylase 94.97
PF04378245 RsmJ: Ribosomal RNA small subunit methyltransferas 94.94
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 94.93
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 94.91
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 94.84
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 94.8
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 94.64
KOG4589232 consensus Cell division protein FtsJ [Cell cycle c 94.57
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 94.51
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 94.38
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 94.26
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 94.21
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 94.18
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 94.01
PRK09496453 trkA potassium transporter peripheral membrane com 93.99
PF05050167 Methyltransf_21: Methyltransferase FkbM domain; In 93.9
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 93.87
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 93.77
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 93.75
TIGR00675 315 dcm DNA-methyltransferase (dcm). All proteins in t 93.74
PRK11524284 putative methyltransferase; Provisional 93.66
PRK10867 433 signal recognition particle protein; Provisional 93.52
PLN02827378 Alcohol dehydrogenase-like 93.42
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 93.4
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 93.31
KOG1099294 consensus SAM-dependent methyltransferase/cell div 93.3
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 93.27
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 93.22
PLN02740381 Alcohol dehydrogenase-like 93.12
PF02636252 Methyltransf_28: Putative S-adenosyl-L-methionine- 93.1
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 93.07
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 92.94
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 92.91
cd08261337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 92.79
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 92.74
TIGR00064272 ftsY signal recognition particle-docking protein F 92.74
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 92.71
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 92.7
KOG2651 476 consensus rRNA adenine N-6-methyltransferase [RNA 92.61
PF07015231 VirC1: VirC1 protein; InterPro: IPR009744 This fam 92.58
PRK09422338 ethanol-active dehydrogenase/acetaldehyde-active r 92.49
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 92.34
PF11599246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 92.19
TIGR00959 428 ffh signal recognition particle protein. This mode 92.18
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 92.13
PRK13699227 putative methylase; Provisional 92.08
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 91.96
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 91.94
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 91.83
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 91.82
PF02153 258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 91.81
PRK07417 279 arogenate dehydrogenase; Reviewed 91.71
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 91.63
PRK09496 453 trkA potassium transporter peripheral membrane com 91.49
COG4301321 Uncharacterized conserved protein [Function unknow 91.48
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 91.36
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 91.26
KOG0822 649 consensus Protein kinase inhibitor [Cell cycle con 91.05
TIGR00692340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 91.04
cd08263367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 91.04
COG4017254 Uncharacterized protein conserved in archaea [Func 91.02
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.96
PLN02514357 cinnamyl-alcohol dehydrogenase 90.8
PRK10416318 signal recognition particle-docking protein FtsY; 90.79
PRK14974336 cell division protein FtsY; Provisional 90.66
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 90.59
PRK05708 305 2-dehydropantoate 2-reductase; Provisional 90.49
COG0673 342 MviM Predicted dehydrogenases and related proteins 90.46
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 90.39
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 90.39
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 90.38
COG2961279 ComJ Protein involved in catabolism of external DN 90.26
PRK10669558 putative cation:proton antiport protein; Provision 90.24
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 90.19
PTZ00354334 alcohol dehydrogenase; Provisional 90.18
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.14
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 90.1
cd08276336 MDR7 Medium chain dehydrogenases/reductase (MDR)/z 90.1
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 90.1
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 90.09
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 90.03
PRK03659601 glutathione-regulated potassium-efflux system prot 90.03
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 89.88
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 89.86
COG0569225 TrkA K+ transport systems, NAD-binding component [ 89.85
PLN02586360 probable cinnamyl alcohol dehydrogenase 89.85
KOG2078495 consensus tRNA modification enzyme [RNA processing 89.84
TIGR01007204 eps_fam capsular exopolysaccharide family. This mo 89.81
PRK13771334 putative alcohol dehydrogenase; Provisional 89.6
cd08286345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 89.53
KOG1331293 consensus Predicted methyltransferase [General fun 89.49
PRK08655 437 prephenate dehydrogenase; Provisional 89.4
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 89.39
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 89.35
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 89.29
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 89.24
cd08236343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 89.2
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 89.18
PLN02353 473 probable UDP-glucose 6-dehydrogenase 89.18
COG0270 328 Dcm Site-specific DNA methylase [DNA replication, 89.17
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 89.15
PRK07102243 short chain dehydrogenase; Provisional 89.07
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 88.94
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 88.86
PRK06949258 short chain dehydrogenase; Provisional 88.86
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 88.83
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 88.81
TIGR02012321 tigrfam_recA protein RecA. This model describes or 88.78
PLN02545 295 3-hydroxybutyryl-CoA dehydrogenase 88.65
COG1565 370 Uncharacterized conserved protein [Function unknow 88.61
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 88.6
PF00072112 Response_reg: Response regulator receiver domain; 88.55
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 88.48
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 88.29
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 88.25
PRK03562621 glutathione-regulated potassium-efflux system prot 88.19
PRK08324681 short chain dehydrogenase; Validated 88.12
cd03115173 SRP The signal recognition particle (SRP) mediates 88.06
PRK00771 437 signal recognition particle protein Srp54; Provisi 88.0
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 87.96
PF10237162 N6-adenineMlase: Probable N6-adenine methyltransfe 87.91
PF11899380 DUF3419: Protein of unknown function (DUF3419); In 87.9
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 87.84
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 87.82
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 87.8
PF10354166 DUF2431: Domain of unknown function (DUF2431); Int 87.68
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 87.66
TIGR03029274 EpsG chain length determinant protein tyrosine kin 87.62
cd05281341 TDH Threonine dehydrogenase. L-threonine dehydroge 87.61
PRK07454241 short chain dehydrogenase; Provisional 87.56
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 87.5
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 87.47
COG0287 279 TyrA Prephenate dehydrogenase [Amino acid transpor 87.36
TIGR00745 293 apbA_panE 2-dehydropantoate 2-reductase. This mode 87.31
PRK08213259 gluconate 5-dehydrogenase; Provisional 87.29
PRK10083339 putative oxidoreductase; Provisional 87.23
PRK09354349 recA recombinase A; Provisional 87.18
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 87.09
PRK07671 377 cystathionine beta-lyase; Provisional 87.06
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 87.03
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 86.98
cd08265384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 86.89
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 86.82
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 86.78
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 86.76
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provision 86.7
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 86.64
KOG4058199 consensus Uncharacterized conserved protein [Funct 86.61
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 86.6
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 86.55
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 86.52
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 86.46
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 86.41
PLN02427 386 UDP-apiose/xylose synthase 86.37
PRK07680 273 late competence protein ComER; Validated 86.31
PLN02178375 cinnamyl-alcohol dehydrogenase 86.29
KOG2671421 consensus Putative RNA methylase [Replication, rec 86.2
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 86.17
PRK07109 334 short chain dehydrogenase; Provisional 86.16
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 86.08
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 86.03
PRK12829264 short chain dehydrogenase; Provisional 86.02
PRK15001 378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 85.99
PRK07810 403 O-succinylhomoserine sulfhydrylase; Provisional 85.82
PF01053 386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 85.75
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 85.66
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 85.6
PRK06223 307 malate dehydrogenase; Reviewed 85.58
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 85.55
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 85.49
PLN02702364 L-idonate 5-dehydrogenase 85.31
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 85.17
PRK08306296 dipicolinate synthase subunit A; Reviewed 85.12
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 85.08
PLN02256 304 arogenate dehydrogenase 84.96
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 84.91
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 84.86
PHA02518211 ParA-like protein; Provisional 84.84
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 84.83
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 84.77
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 84.77
PRK12439 341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 84.75
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketid 84.74
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 84.72
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 84.68
PTZ00357 1072 methyltransferase; Provisional 84.66
cd08279363 Zn_ADH_class_III Class III alcohol dehydrogenase. 84.59
TIGR01324 377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 84.5
PRK07326237 short chain dehydrogenase; Provisional 84.49
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 84.49
KOG2352 482 consensus Predicted spermine/spermidine synthase [ 84.48
PRK05225 487 ketol-acid reductoisomerase; Validated 84.34
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 84.31
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 84.25
PLN02650 351 dihydroflavonol-4-reductase 84.22
PRK07819 286 3-hydroxybutyryl-CoA dehydrogenase; Validated 84.19
PRK07806248 short chain dehydrogenase; Provisional 84.14
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 83.98
PRK08064 390 cystathionine beta-lyase; Provisional 83.96
COG2130340 Putative NADP-dependent oxidoreductases [General f 83.94
PRK07774250 short chain dehydrogenase; Provisional 83.91
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 83.87
PRK08507 275 prephenate dehydrogenase; Validated 83.85
>PF07279 DUF1442: Protein of unknown function (DUF1442); InterPro: IPR009902 This family consists of several hypothetical Arabidopsis thaliana proteins of around 225 residues in length Back     alignment and domain information
Probab=100.00  E-value=3.2e-40  Score=270.84  Aligned_cols=196  Identities=56%  Similarity=0.820  Sum_probs=172.4

Q ss_pred             CcCChhHHHHHHHHHhhcCCcCCChhHHHHHHHHHhhCCCCeEEEEcccc--HHHHHHHHHHHccCCCcEEEEEeCChhH
Q 041509            2 ACWSAENATKAYLKTLKMGQKAKEPNEAEFISALAAGNNAQLMVVACANV--ANATTLALAAAAHQTGGRVVCILRRVEE   79 (211)
Q Consensus         2 ~~~~~~~~~~ay~~~~~~~~~~~~~~~~~lL~~l~~~~~~~~VLEi~Gtg--~G~stl~la~a~~~~~g~v~tiE~~~~~   79 (211)
                      .+||||++++|||+++++++...+|..+|||++|+++++++.|+|+ .+.  ...+|+.||.|+++++|+++||..+++.
T Consensus         3 l~WSpe~AtkAYl~Tvk~c~~~~ep~~aEfISAlAAG~nAkliVe~-~s~g~~~~ttiaLaaAAr~TgGR~vCIvp~~~~   81 (218)
T PF07279_consen    3 LVWSPENATKAYLDTVKMCKKFKEPGVAEFISALAAGWNAKLIVEA-WSSGGAISTTIALAAAARQTGGRHVCIVPDEQS   81 (218)
T ss_pred             ceeChhHHHHHHHHHHHHhhhcCCCCHHHHHHHHhccccceEEEEE-ecCCCchHhHHHHHHHHHhcCCeEEEEcCChhh
Confidence            4799999999999999999999999999999999999999999999 343  3357999999999999999999999999


Q ss_pred             HHHHHHHhc--CCCCcEEEEEcch-HHHhhhccCCccEEEEcCCcCcHH-HHHHHHHhcCCCCcEEEEEecCCCCC----
Q 041509           80 YKLSKKILG--LDASHVEFVIGDA-QSLLLSHFREADFVLIDCNLENHE-GVLRAVQAGNKPNGAVVVGYNAFRKG----  151 (211)
Q Consensus        80 ~~~Ar~~~~--~~~~~V~~~~gda-~e~l~~l~~~fD~VfiD~~~~~y~-~~l~~~~~~L~pgG~viv~dn~~~~~----  151 (211)
                      ....++.+.  +..+.++|+.|++ .++++. ...+||+++|+..++|. ++|+.+.  +.|.|.|+|++|++.++    
T Consensus        82 ~~~~~~~l~~~~~~~~vEfvvg~~~e~~~~~-~~~iDF~vVDc~~~d~~~~vl~~~~--~~~~GaVVV~~Na~~r~~~~~  158 (218)
T PF07279_consen   82 LSEYKKALGEAGLSDVVEFVVGEAPEEVMPG-LKGIDFVVVDCKREDFAARVLRAAK--LSPRGAVVVCYNAFSRSTNGF  158 (218)
T ss_pred             HHHHHHHHhhccccccceEEecCCHHHHHhh-ccCCCEEEEeCCchhHHHHHHHHhc--cCCCceEEEEeccccCCcCCc
Confidence            888888887  6677899999995 557765 57899999999999998 8888765  56789999999999854    


Q ss_pred             cee-----cCCCcEEEeecCCcEEEEEEeccC-----CCCccceEEeccccCCceeeEEe
Q 041509          152 SWR-----SSGSKSQLLPIGEGLLVTRIAAAS-----ANKKSHWIVKVDKCTGEEHVFRV  201 (211)
Q Consensus       152 ~~~-----~~~~~~v~lpig~Gl~v~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~  201 (211)
                      .|.     .+.+++++||||.||+|++....+     ++.++|||+|+|++||||||||.
T Consensus       159 ~w~~~~~~~r~Vrsv~LPIG~GleVt~ig~~~~~~~~~~~~srWi~~vD~~sGEeHv~R~  218 (218)
T PF07279_consen  159 SWRSVLRGRRVVRSVFLPIGKGLEVTRIGASGGSNSSRRKKSRWIKHVDQCSGEEHVFRR  218 (218)
T ss_pred             cHHHhcCCCCceeEEEeccCCCeEEEEEeecCCCCCCCCCCccceEeeccCCCceeeecC
Confidence            454     366899999999999999999864     44789999999999999999994



The function of this family is unknown.

>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>PF05711 TylF: Macrocin-O-methyltransferase (TylF); InterPro: IPR008884 This family consists of bacterial macrocin O-methyltransferase (TylF) proteins Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1562 consensus Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>COG3510 CmcI Cephalosporin hydroxylase [Defense mechanisms] Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>KOG2198 consensus tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>KOG1501 consensus Arginine N-methyltransferase [General function prediction only] Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1227 consensus Putative methyltransferase [General function prediction only] Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1253 consensus tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>KOG1596 consensus Fibrillarin and related nucleolar RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>PF05430 Methyltransf_30: S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR008471 This entry contains several uncharacterised bacterial proteins with no known function Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>KOG3201 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>KOG2793 consensus Putative N2,N2-dimethylguanosine tRNA methyltransferase [RNA processing and modification] Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>KOG2360 consensus Proliferation-associated nucleolar protein (NOL1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>PF04378 RsmJ: Ribosomal RNA small subunit methyltransferase D, RsmJ; InterPro: IPR007473 This is a bacterial protein of unknown function, possibly secreted Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PF05050 Methyltransf_21: Methyltransferase FkbM domain; InterPro: IPR007744 This entry contains proteins of unknown function Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00675 dcm DNA-methyltransferase (dcm) Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>KOG1099 consensus SAM-dependent methyltransferase/cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>KOG2651 consensus rRNA adenine N-6-methyltransferase [RNA processing and modification] Back     alignment and domain information
>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>COG4301 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>KOG0822 consensus Protein kinase inhibitor [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>COG4017 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>COG2961 ComJ Protein involved in catabolism of external DNA [General function prediction only] Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>KOG2078 consensus tRNA modification enzyme [RNA processing and modification] Back     alignment and domain information
>TIGR01007 eps_fam capsular exopolysaccharide family Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>COG1565 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PF10237 N6-adenineMlase: Probable N6-adenine methyltransferase; InterPro: IPR019369 This family of proteins, which are of approximately 200 residues in length, contain a highly conserved Glu-Phe-Trp (QFW) motif close to the N terminus and an Asp/Asn-Pro-Pro-Tyr/Phe motif in the centre Back     alignment and domain information
>PF11899 DUF3419: Protein of unknown function (DUF3419); InterPro: IPR021829 This family of proteins are functionally uncharacterised Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>KOG4058 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>KOG2671 consensus Putative RNA methylase [Replication, recombination and repair] Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00357 methyltransferase; Provisional Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 7e-05
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 3e-04
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 3e-04
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Length = 298 Back     alignment and structure
 Score = 41.7 bits (97), Expect = 7e-05
 Identities = 18/102 (17%), Positives = 35/102 (34%), Gaps = 8/102 (7%)

Query: 43  LMVVACANVANATTLALAAAAHQTGGRVVCILRRVEEYKLSKKIL-GLDASHVEFVIGDA 101
            + +          L     +H  G RV  +    +  +LS+K++ GL    V  + GD 
Sbjct: 126 AVFIGG----GPLPLTGILLSHVYGMRVNVVEIEPDIAELSRKVIEGLGVDGVNVITGDE 181

Query: 102 QSLLLSHFREADFVLIDCNLENHEGVLRAVQAGNKPNGAVVV 143
             +      E D +++    E    V R +         ++ 
Sbjct: 182 TVI---DGLEFDVLMVAALAEPKRRVFRNIHRYVDTETRIIY 220


>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} Length = 204 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Length = 178 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query211
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.97
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 99.95
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.95
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 99.95
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.94
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.94
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.93
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.93
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 99.93
2avd_A229 Catechol-O-methyltransferase; structural genomics, 99.93
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.93
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.92
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 99.91
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.89
3cvo_A202 Methyltransferase-like protein of unknown functio; 99.86
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 99.76
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 99.72
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.68
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.67
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.67
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.65
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.64
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.64
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.63
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.62
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.62
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.61
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.61
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 99.6
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.6
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.6
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.59
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.59
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.59
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.58
3f4k_A257 Putative methyltransferase; structural genomics, P 99.57
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.57
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.56
3lpm_A259 Putative methyltransferase; structural genomics, p 99.56
2b25_A336 Hypothetical protein; structural genomics, methyl 99.56
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.56
3gjy_A317 Spermidine synthase; APC62791, structural genomics 99.56
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.55
2o07_A304 Spermidine synthase; structural genomics, structur 99.54
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.54
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.54
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.54
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.54
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.54
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.53
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.53
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.53
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.53
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 99.53
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.53
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.53
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.52
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 99.52
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.52
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.52
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 99.52
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 99.52
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.51
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.51
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.51
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.51
2b78_A385 Hypothetical protein SMU.776; structure genomics, 99.51
1xj5_A334 Spermidine synthase 1; structural genomics, protei 99.51
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.51
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.51
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.51
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.51
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 99.5
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.5
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.5
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 99.49
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 99.49
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.49
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 99.49
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.49
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 99.49
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.49
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.49
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.48
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.48
2pt6_A321 Spermidine synthase; transferase, structural genom 99.48
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.48
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 99.48
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.48
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.48
3gu3_A284 Methyltransferase; alpha-beta protein, structural 99.47
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 99.47
2i7c_A283 Spermidine synthase; transferase, structural genom 99.47
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.47
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.47
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.47
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.47
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 99.47
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.47
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.46
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.46
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.46
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.46
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.46
3ocj_A305 Putative exported protein; structural genomics, PS 99.46
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.46
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.46
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.45
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.45
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.45
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.45
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.45
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.45
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.45
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 99.45
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.45
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.45
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.44
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.44
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.44
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 99.44
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.44
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.44
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.43
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 99.43
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.42
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.42
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.42
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.42
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.41
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.41
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 99.41
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 99.41
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.4
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.4
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 99.39
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.39
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 99.39
2h00_A254 Methyltransferase 10 domain containing protein; st 99.39
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.39
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.39
2cmg_A262 Spermidine synthase; transferase, putrescine amino 99.39
3lcc_A235 Putative methyl chloride transferase; halide methy 99.39
3k6r_A278 Putative transferase PH0793; structural genomics, 99.39
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 99.39
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 99.39
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.39
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.39
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 99.38
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.38
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 99.38
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.38
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.38
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.37
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.37
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 99.37
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.36
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.36
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 99.36
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.36
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 99.35
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 99.35
1wzn_A252 SAM-dependent methyltransferase; structural genomi 99.35
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.35
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 99.35
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.35
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.34
3dp7_A363 SAM-dependent methyltransferase; structural genomi 99.34
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.34
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.34
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.34
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 99.34
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.34
2qm3_A373 Predicted methyltransferase; putative methyltransf 99.33
3ege_A261 Putative methyltransferase from antibiotic biosyn 99.33
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.33
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.33
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 99.32
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.32
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 99.32
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 99.32
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 99.32
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.32
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 99.32
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 99.31
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 99.31
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.31
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.31
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.31
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 99.3
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 99.3
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.3
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 99.3
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 99.29
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 99.29
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.29
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.29
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 99.28
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 99.28
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 99.28
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 99.27
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.27
1ne2_A200 Hypothetical protein TA1320; structural genomics, 99.27
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.27
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.27
3sso_A419 Methyltransferase; macrolide, natural product, ros 99.26
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.26
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.25
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.24
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.24
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 99.24
2i62_A265 Nicotinamide N-methyltransferase; structural genom 99.24
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 99.23
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.23
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 99.23
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.23
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.23
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 99.2
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 99.2
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 99.19
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.18
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 99.18
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 99.18
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 99.18
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 99.16
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 99.15
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 99.15
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 99.15
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 99.15
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 99.13
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 99.13
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 99.11
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 99.1
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 99.1
3cc8_A230 Putative methyltransferase; structural genomics, j 99.1
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 99.1
1vlm_A219 SAM-dependent methyltransferase; possible histamin 99.08
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 99.08
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 99.07
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 99.06
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 99.05
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 99.05
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 99.05
3ll7_A 410 Putative methyltransferase; methytransferase, stru 99.04
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 99.03
3giw_A277 Protein of unknown function DUF574; rossmann-fold 99.03
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 99.03
3fut_A271 Dimethyladenosine transferase; methyltransferase, 99.03
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 99.02
3tos_A257 CALS11; methyltransferase, calicheamicin, structur 99.01
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 99.0
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 99.0
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.98
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 98.98
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 98.98
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 98.93
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 98.92
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 98.92
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.92
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 98.9
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 98.87
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 98.84
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 98.83
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 98.82
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 98.82
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.82
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 98.81
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 98.81
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 98.79
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 98.76
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 98.76
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.74
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 98.73
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.71
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.69
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.68
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 98.66
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 98.64
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 98.62
3lkd_A 542 Type I restriction-modification system methyltrans 98.52
2oo3_A283 Protein involved in catabolism of external DNA; st 98.51
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 98.5
3khk_A544 Type I restriction-modification system methylation 98.48
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 98.39
1wg8_A285 Predicted S-adenosylmethionine-dependent methyltra 98.36
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 98.3
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.24
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 97.9
3vyw_A308 MNMC2; tRNA wobble uridine, modification enzyme, g 97.88
3tka_A 347 Ribosomal RNA small subunit methyltransferase H; H 97.88
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 97.79
3ufb_A530 Type I restriction-modification system methyltran 97.77
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 97.45
2zig_A297 TTHA0409, putative modification methylase; methylt 97.45
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.42
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 97.18
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 97.14
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 97.1
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, 97.09
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 97.08
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 97.0
3r24_A344 NSP16, 2'-O-methyl transferase; methyltransferase, 96.98
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 96.94
1g55_A 343 DNA cytosine methyltransferase DNMT2; human DNA me 96.81
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 96.75
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 96.72
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 96.71
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 96.7
2py6_A409 Methyltransferase FKBM; YP_546752.1, structural ge 96.64
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 96.63
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 96.6
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 96.6
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 96.6
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 96.59
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 96.56
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 96.53
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 96.52
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 96.5
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 96.49
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 96.48
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 96.48
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 96.47
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 96.46
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 96.45
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 96.43
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 96.41
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 96.38
2px2_A269 Genome polyprotein [contains: capsid protein C (co 96.36
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 96.34
3gms_A340 Putative NADPH:quinone reductase; structural genom 96.33
2c7p_A 327 Modification methylase HHAI; DNA methyltransferase 96.31
4eye_A342 Probable oxidoreductase; structural genomics, niai 96.28
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 96.26
1boo_A 323 Protein (N-4 cytosine-specific methyltransferase P 96.26
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 96.23
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 96.2
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 96.16
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 96.15
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 96.13
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 96.11
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.1
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.07
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 96.05
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 96.04
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 96.03
1g60_A 260 Adenine-specific methyltransferase MBOIIA; structu 95.97
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 95.94
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 95.91
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 95.8
1eg2_A 319 Modification methylase RSRI; rossmann fold, exocyc 95.79
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 95.79
2zig_A 297 TTHA0409, putative modification methylase; methylt 95.77
3fbg_A346 Putative arginate lyase; structural genomics, unkn 95.76
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 95.7
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 95.62
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 95.6
3ubt_Y 331 Modification methylase HAEIII; protein-DNA complex 95.57
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 95.55
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 95.49
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.49
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 95.45
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 95.44
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 95.41
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 95.33
1id1_A153 Putative potassium channel protein; RCK domain, E. 95.31
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 95.28
3lkz_A321 Non-structural protein 5; flavivirus, methyltransf 95.24
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 95.22
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 95.21
3c85_A183 Putative glutathione-regulated potassium-efflux S 95.2
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 95.12
3p8z_A267 Mtase, non-structural protein 5; methyltransferase 95.12
4h0n_A 333 DNMT2; SAH binding, transferase; HET: SAH; 2.71A { 95.05
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 95.0
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 94.95
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 94.82
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 94.73
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 94.69
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 94.56
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 94.5
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 94.4
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 94.33
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 94.32
1m6e_X 359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 94.3
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 94.27
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 94.22
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 94.18
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 94.13
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 94.11
3krt_A456 Crotonyl COA reductase; structural genomics, prote 93.93
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 93.92
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 93.83
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 93.68
2qrv_A 295 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 93.62
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 93.28
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 93.24
3qv2_A 327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 93.16
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 93.06
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 92.92
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 92.81
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 92.74
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 92.64
3me5_A 482 Cytosine-specific methyltransferase; structural ge 92.5
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 92.43
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 92.43
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 92.26
1rjd_A334 PPM1P, carboxy methyl transferase for protein phos 92.14
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 92.02
4dcm_A 375 Ribosomal RNA large subunit methyltransferase G; 2 91.99
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyc 91.92
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 91.69
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 91.65
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 91.61
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 91.5
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 91.48
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 91.48
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 91.37
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 91.31
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 91.27
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 91.25
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 91.17
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 90.94
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 90.87
1lnq_A336 MTHK channels, potassium channel related protein; 90.81
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 90.74
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 90.7
3hwr_A 318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 90.61
3imf_A257 Short chain dehydrogenase; structural genomics, in 90.31
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 90.22
4ezb_A 317 Uncharacterized conserved protein; structural geno 90.21
4f3n_A 432 Uncharacterized ACR, COG1565 superfamily; structur 90.14
4eso_A255 Putative oxidoreductase; NADP, structural genomics 90.12
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 90.08
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 90.07
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 89.92
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 89.82
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 89.66
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 89.65
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 89.64
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 89.6
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 89.56
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 89.54
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 89.41
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 89.39
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 89.39
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 89.31
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 89.22
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 89.21
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 89.09
1zkd_A 387 DUF185; NESG, RPR58, structural genomics, PSI, pro 89.03
4g65_A 461 TRK system potassium uptake protein TRKA; structur 89.0
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 88.91
3iht_A174 S-adenosyl-L-methionine methyl transferase; YP_165 88.88
3b1f_A 290 Putative prephenate dehydrogenase; enzyme, 4-hydro 88.82
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 88.7
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 88.67
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 88.64
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 88.54
2i6t_A 303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 88.47
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 88.37
1y6j_A 318 L-lactate dehydrogenase; southeast collaboratory f 88.35
2qr3_A140 Two-component system response regulator; structura 88.3
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 88.23
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 88.22
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 88.21
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 88.2
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 88.19
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 88.16
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 88.15
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 88.1
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 88.09
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 88.06
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 88.04
3tjr_A301 Short chain dehydrogenase; structural genomics, se 88.02
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 87.98
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 87.95
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 87.8
4ft4_B 784 DNA (cytosine-5)-methyltransferase 1; chromodomain 87.8
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 87.73
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 87.7
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 87.66
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 87.59
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 87.53
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 87.45
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 87.45
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 87.39
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 87.37
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 87.22
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 87.21
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 87.18
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 87.18
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 87.13
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 87.11
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 87.09
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 87.02
3t8y_A164 CHEB, chemotaxis response regulator protein-glutam 87.02
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 86.97
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 86.96
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 86.92
2rjn_A154 Response regulator receiver:metal-dependent phosph 86.89
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
Probab=99.97  E-value=3.8e-29  Score=207.32  Aligned_cols=153  Identities=18%  Similarity=0.228  Sum_probs=136.6

Q ss_pred             cCCChhHHHHHHHHHhhCCCC---eEEEEccccHHHHHHHHHHHccCCCcEEEEEeCChhHHHHHHHHhc--CCC-CcEE
Q 041509           22 KAKEPNEAEFISALAAGNNAQ---LMVVACANVANATTLALAAAAHQTGGRVVCILRRVEEYKLSKKILG--LDA-SHVE   95 (211)
Q Consensus        22 ~~~~~~~~~lL~~l~~~~~~~---~VLEi~Gtg~G~stl~la~a~~~~~g~v~tiE~~~~~~~~Ar~~~~--~~~-~~V~   95 (211)
                      ..++|.++++|..++...+++   +|||+ |||+|++|++||+++++ +++|++||+++++++.|+++++  ++. ++|+
T Consensus        35 p~i~~~~~~~l~~l~~~~~~~~~~~vLdi-G~G~G~~~~~la~~~~~-~~~v~~vD~~~~~~~~a~~~~~~~g~~~~~i~  112 (221)
T 3dr5_A           35 PAPDEMTGQLLTTLAATTNGNGSTGAIAI-TPAAGLVGLYILNGLAD-NTTLTCIDPESEHQRQAKALFREAGYSPSRVR  112 (221)
T ss_dssp             CCCCHHHHHHHHHHHHHSCCTTCCEEEEE-STTHHHHHHHHHHHSCT-TSEEEEECSCHHHHHHHHHHHHHTTCCGGGEE
T ss_pred             CCCCHHHHHHHHHHHHhhCCCCCCCEEEE-cCCchHHHHHHHHhCCC-CCEEEEEECCHHHHHHHHHHHHHcCCCcCcEE
Confidence            468999999999999998888   99999 99999999999999864 7999999999999999999998  666 7999


Q ss_pred             EEEcchHHHhhhc-cCCccEEEEcCCcCcHHHHHHHHHhcCCCCcEEEEEecCCCCCc----------------e-----
Q 041509           96 FVIGDAQSLLLSH-FREADFVLIDCNLENHEGVLRAVQAGNKPNGAVVVGYNAFRKGS----------------W-----  153 (211)
Q Consensus        96 ~~~gda~e~l~~l-~~~fD~VfiD~~~~~y~~~l~~~~~~L~pgG~viv~dn~~~~~~----------------~-----  153 (211)
                      +++||+.+.++.+ .++||+||+|+.+.+|.++++.+.++|+||| ++++||++++|.                |     
T Consensus       113 ~~~gda~~~l~~~~~~~fD~V~~d~~~~~~~~~l~~~~~~LkpGG-~lv~dn~~~~g~v~~~~~~~~~~~~~~~~~~~l~  191 (221)
T 3dr5_A          113 FLLSRPLDVMSRLANDSYQLVFGQVSPMDLKALVDAAWPLLRRGG-ALVLADALLDGTIADQTRKDRDTQAARDADEYIR  191 (221)
T ss_dssp             EECSCHHHHGGGSCTTCEEEEEECCCTTTHHHHHHHHHHHEEEEE-EEEETTTTGGGTCSCSSCCCHHHHHHHHHHHHHT
T ss_pred             EEEcCHHHHHHHhcCCCcCeEEEcCcHHHHHHHHHHHHHHcCCCc-EEEEeCCCCCCcCCCCCCCChHHHHHHHHHHHHh
Confidence            9999999998876 6899999999999999999999999999966 556699998652                1     


Q ss_pred             ecCCCcEEEeecCCcEEEEEEecc
Q 041509          154 RSSGSKSQLLPIGEGLLVTRIAAA  177 (211)
Q Consensus       154 ~~~~~~~v~lpig~Gl~v~~~~~~  177 (211)
                      .+++++++++|+|||++++++.-.
T Consensus       192 ~~~~~~~~~lp~gdGl~~~~~~~~  215 (221)
T 3dr5_A          192 SIEGAHVARLPLGAGLTVVTKALE  215 (221)
T ss_dssp             TCTTEEEEEESSTTCEEEEEECCC
T ss_pred             hCCCeeEEEeeccchHHHHHHHHH
Confidence            168999999999999999998653



>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3tos_A CALS11; methyltransferase, calicheamicin, structural genomic protein structure initiative, PSI, natPro; HET: MSE SAH GLU; 1.55A {Micromonospora echinospora} PDB: 4gf5_A* Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>4f3n_A Uncharacterized ACR, COG1565 superfamily; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.75A {Burkholderia thailandensis} PDB: 4g67_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1zkd_A DUF185; NESG, RPR58, structural genomics, PSI, protein structure INI northeast structural genomics consortium, unknown function; 2.10A {Rhodopseudomonas palustris} SCOP: c.66.1.52 Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3iht_A S-adenosyl-L-methionine methyl transferase; YP_165822.1, STR genomics, joint center for structural genomics, JCSG; HET: MSE SAM; 1.80A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query211
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 100.0
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 100.0
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 99.96
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.78
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.76
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.74
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.74
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.72
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.7
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.7
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.68
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.67
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 99.66
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.65
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.63
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.59
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.59
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 99.59
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.57
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.56
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.55
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.55
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.54
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.54
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 99.54
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.52
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.51
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.49
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.49
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.48
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.47
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 99.47
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.46
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 99.45
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.45
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 99.45
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.44
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.44
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.44
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 99.44
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.42
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.41
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.4
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.4
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.4
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.39
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.39
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.38
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.38
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 99.37
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.36
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.33
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.32
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.3
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.3
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 99.3
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.27
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.25
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.24
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 99.24
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 99.23
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.22
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 99.21
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 99.2
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 99.19
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 99.18
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 99.18
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 99.17
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 99.17
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 99.15
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 99.15
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 99.14
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 99.13
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 99.09
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 99.07
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 99.06
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 98.89
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 98.86
d2h00a1250 Methyltransferase 10 domain containing protein MET 98.85
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 98.83
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 98.78
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.76
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 98.7
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.64
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 98.52
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 98.5
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.49
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 98.48
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 98.45
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 98.41
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 98.33
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 98.33
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 98.32
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 98.22
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 98.2
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 98.17
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 98.15
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 98.14
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.86
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 97.84
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 97.84
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.82
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.58
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 97.54
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 97.48
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 97.46
d1i4wa_ 322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 97.43
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 97.39
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.38
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 97.19
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 97.19
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 97.07
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 97.04
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 96.87
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.84
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.83
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.79
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 96.73
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 96.68
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 96.65
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 96.6
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 96.6
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 96.57
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 96.56
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.23
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.22
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 96.19
d1g60a_ 256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 95.96
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 95.94
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 95.93
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 95.88
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 95.77
d1eg2a_ 279 m.RsrI N6 adenosine-specific DNA methyltransferase 95.69
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 95.68
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 95.67
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.45
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 95.35
d1booa_ 320 m.PvuII N4 cytosine-specific DNA methyltransferase 95.32
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 95.25
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.04
d2oo3a1271 Uncharacterized protein LPG1296 {Legionella pneumo 94.64
d2c7pa1 327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 94.63
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 94.39
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 94.29
d1dcta_ 324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 94.26
d1id1a_153 Rck domain from putative potassium channel Kch {Es 94.07
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 93.9
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 93.78
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 93.74
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 93.52
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 93.3
d1g55a_ 343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 93.23
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 92.33
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 91.89
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 91.86
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 91.69
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 91.56
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 91.18
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 91.05
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 90.99
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 90.75
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 90.74
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 90.67
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 90.36
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 90.26
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 90.2
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 90.02
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 90.01
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 89.6
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 89.47
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 89.35
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 89.34
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 88.96
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 88.88
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 88.77
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 88.67
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 88.59
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 88.37
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 88.35
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 88.16
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 88.01
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 88.01
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 87.96
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 87.83
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 87.72
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 87.34
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 86.95
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 86.85
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 86.7
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 86.57
d1dz3a_123 Sporulation response regulator Spo0A {Bacillus ste 86.33
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 86.2
d1zkda1 365 Hypothetical protein RPA4359 {Rhodopseudomonas pal 86.13
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 86.09
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 85.97
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 85.76
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 85.67
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 85.23
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 85.08
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 85.06
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 85.01
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 84.95
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 84.61
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 84.52
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 83.96
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 83.84
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 83.26
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 82.76
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 82.7
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 82.65
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 82.3
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 82.18
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 81.95
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 81.94
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 81.9
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 81.54
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 81.38
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 81.24
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 80.81
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 80.81
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 80.73
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 80.45
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 80.37
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 80.33
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 80.23
d1mb3a_123 Cell division response regulator DivK {Caulobacter 80.15
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: COMT-like
domain: Caffeoyl-CoA O-methyltransferase
species: Alfalfa (Medicago sativa) [TaxId: 3879]
Probab=100.00  E-value=9e-36  Score=247.12  Aligned_cols=151  Identities=22%  Similarity=0.278  Sum_probs=138.2

Q ss_pred             cCCChhHHHHHHHHHhhCCCCeEEEEccccHHHHHHHHHHHccCCCcEEEEEeCChhHHHHHHHHhc--CCCCcEEEEEc
Q 041509           22 KAKEPNEAEFISALAAGNNAQLMVVACANVANATTLALAAAAHQTGGRVVCILRRVEEYKLSKKILG--LDASHVEFVIG   99 (211)
Q Consensus        22 ~~~~~~~~~lL~~l~~~~~~~~VLEi~Gtg~G~stl~la~a~~~~~g~v~tiE~~~~~~~~Ar~~~~--~~~~~V~~~~g   99 (211)
                      ..++|.+|+||..+++..+|++|||| ||++||||+|+|+++++ +|+|+|+|.+|+.++.|+++++  +..++|++++|
T Consensus        41 m~~~~~~g~~L~~L~~~~~~k~iLEi-GT~~GyStl~la~al~~-~g~v~tie~~~~~~~~A~~~~~~~g~~~~i~~~~g  118 (227)
T d1susa1          41 MTTSADEGQFLSMLLKLINAKNTMEI-GVYTGYSLLATALAIPE-DGKILAMDINKENYELGLPVIKKAGVDHKIDFREG  118 (227)
T ss_dssp             GSCCHHHHHHHHHHHHHHTCCEEEEE-CCGGGHHHHHHHHHSCT-TCEEEEEESCCHHHHHHHHHHHHTTCGGGEEEEES
T ss_pred             cccCHHHHHHHHHHHHhcCCCcEEEe-cchhhhhHHHHHhhCCC-CcEEEEEeccchhHHHHHHHHHHhccccceeeeeh
Confidence            35889999999999999999999999 99999999999999975 8999999999999999999998  77889999999


Q ss_pred             chHHHhhhc------cCCccEEEEcCCcCcHHHHHHHHHhcCCCCcEEEEEecCCCCCce--------------------
Q 041509          100 DAQSLLLSH------FREADFVLIDCNLENHEGVLRAVQAGNKPNGAVVVGYNAFRKGSW--------------------  153 (211)
Q Consensus       100 da~e~l~~l------~~~fD~VfiD~~~~~y~~~l~~~~~~L~pgG~viv~dn~~~~~~~--------------------  153 (211)
                      ++.+.++++      .++|||||+|+++++|.+|++.+.++|+||| ++++||++++|..                    
T Consensus       119 ~a~~~L~~l~~~~~~~~~fD~iFiDa~k~~y~~~~e~~~~ll~~gG-iii~DNvl~~G~v~~~~~~~~~~~~~~~~~~i~  197 (227)
T d1susa1         119 PALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGG-VIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVL  197 (227)
T ss_dssp             CHHHHHHHHHHCGGGTTCBSEEEECSCSTTHHHHHHHHHHHBCTTC-CEEEETTTGGGGGGCCTTCCCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhccccCCceeEEEeccchhhhHHHHHHHHhhcCCCc-EEEEccCCCCCcccCCcccchHHHHHHHHHHHH
Confidence            999999876      4589999999999999999999999999966 5667999987620                    


Q ss_pred             -------ecCCCcEEEeecCCcEEEEEEe
Q 041509          154 -------RSSGSKSQLLPIGEGLLVTRIA  175 (211)
Q Consensus       154 -------~~~~~~~v~lpig~Gl~v~~~~  175 (211)
                             .|++++++++|+|||+.|++|.
T Consensus       198 ~~n~~i~~d~r~~~~llPigDGl~i~~K~  226 (227)
T d1susa1         198 ELNKALAVDPRIEICMLPVGDGITICRRI  226 (227)
T ss_dssp             HHHHHHHHCTTBCCEEECSTTCEEEECBC
T ss_pred             HHHHHHhcCCCEEEEEeecCCeeEEEEEC
Confidence                   1699999999999999999875



>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oo3a1 c.66.1.59 (A:9-279) Uncharacterized protein LPG1296 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure