Citrus Sinensis ID: 041513
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 294 | ||||||
| 297745189 | 658 | unnamed protein product [Vitis vinifera] | 0.969 | 0.433 | 0.750 | 1e-132 | |
| 255579400 | 603 | S-adenosylmethionine-dependent methyltra | 0.959 | 0.467 | 0.687 | 1e-120 | |
| 147789281 | 735 | hypothetical protein VITISV_003284 [Viti | 0.931 | 0.372 | 0.702 | 1e-117 | |
| 148906873 | 635 | unknown [Picea sitchensis] | 0.962 | 0.445 | 0.658 | 1e-115 | |
| 224095734 | 537 | predicted protein [Populus trichocarpa] | 0.931 | 0.510 | 0.693 | 1e-115 | |
| 148907610 | 626 | unknown [Picea sitchensis] | 0.931 | 0.437 | 0.638 | 1e-110 | |
| 357501453 | 591 | hypothetical protein MTR_7g006060 [Medic | 0.969 | 0.482 | 0.615 | 1e-108 | |
| 356524579 | 572 | PREDICTED: probable methyltransferase PM | 0.969 | 0.498 | 0.621 | 1e-108 | |
| 356567298 | 575 | PREDICTED: probable methyltransferase PM | 0.969 | 0.495 | 0.615 | 1e-108 | |
| 225426475 | 632 | PREDICTED: probable methyltransferase PM | 0.931 | 0.433 | 0.609 | 1e-106 |
| >gi|297745189|emb|CBI39181.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 478 bits (1229), Expect = e-132, Method: Compositional matrix adjust.
Identities = 217/289 (75%), Positives = 259/289 (89%), Gaps = 4/289 (1%)
Query: 1 MDYNILTMSFAPLDVHEAQVQFALERGLPAMVGLLSTYQLPYPSRSFDVAHCSRCLVPWT 60
MDYNILTMS AP+D+HEAQVQFALERGLPAM+G+LSTY+LPYPSRSFD+AHCSRCLVPWT
Sbjct: 275 MDYNILTMSIAPMDIHEAQVQFALERGLPAMLGILSTYRLPYPSRSFDMAHCSRCLVPWT 334
Query: 61 SYDGLYLMEIDRVLRPGGYWVVSGPPISWKTSYRGWERDAKDLQKEQISLENLATRLCWK 120
+YDG+YLMEIDRVLRPGGYWVVSGPPISWK+SY+GWER A+DL+KEQISLE+LA RLCWK
Sbjct: 335 AYDGVYLMEIDRVLRPGGYWVVSGPPISWKSSYKGWERKAQDLEKEQISLEDLARRLCWK 394
Query: 121 KIAERGPIAVWRKPTNHLHCIQKLKALKSPTFCVKSDPDAVWYTKMEPCVTPLPMVNEIK 180
KIAERGPIAVWRKPTNH+HCIQKLKA KSP FC ++DPDA WY +M+PC+TPLP V +I+
Sbjct: 395 KIAERGPIAVWRKPTNHIHCIQKLKAWKSPHFCAETDPDAGWYKEMDPCITPLPKVTDIR 454
Query: 181 DVAGGALEKWPKRLNTAPPRIRSGFIEGITVKSFNEDNQLWKKRVSHYRIILESLFSGKF 240
++GGALE+WPK LNTAPPRIR+G G TV +FN+DNQ+W KRVS+Y +L+SL +GK+
Sbjct: 455 SISGGALERWPKMLNTAPPRIRNGVTRGATVNTFNKDNQIWIKRVSYYGSVLKSLGAGKY 514
Query: 241 RNIMDMNAGLGGFAAALAKYPVWVMNAVPFDAKHNTL----QTGILSSF 285
RNIMDMNAGLGGFAAA++K VWVMN VPFDA++NTL + G++ ++
Sbjct: 515 RNIMDMNAGLGGFAAAISKQQVWVMNVVPFDAQNNTLGIVYERGLIGTY 563
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255579400|ref|XP_002530544.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus communis] gi|223529906|gb|EEF31835.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|147789281|emb|CAN62352.1| hypothetical protein VITISV_003284 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|148906873|gb|ABR16582.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|224095734|ref|XP_002310457.1| predicted protein [Populus trichocarpa] gi|222853360|gb|EEE90907.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|148907610|gb|ABR16934.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|357501453|ref|XP_003621015.1| hypothetical protein MTR_7g006060 [Medicago truncatula] gi|355496030|gb|AES77233.1| hypothetical protein MTR_7g006060 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356524579|ref|XP_003530906.1| PREDICTED: probable methyltransferase PMT19-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356567298|ref|XP_003551858.1| PREDICTED: probable methyltransferase PMT19-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225426475|ref|XP_002270920.1| PREDICTED: probable methyltransferase PMT18 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 294 | ||||||
| TAIR|locus:2041031 | 611 | AT2G43200 [Arabidopsis thalian | 0.928 | 0.446 | 0.577 | 7.3e-91 | |
| TAIR|locus:2196651 | 639 | AT1G33170 [Arabidopsis thalian | 0.928 | 0.427 | 0.561 | 4.6e-89 | |
| TAIR|locus:2127711 | 633 | AT4G10440 [Arabidopsis thalian | 0.928 | 0.431 | 0.556 | 5.9e-89 | |
| TAIR|locus:2050679 | 631 | AT2G45750 [Arabidopsis thalian | 0.931 | 0.434 | 0.555 | 2.5e-88 | |
| TAIR|locus:2117728 | 633 | AT4G00750 [Arabidopsis thalian | 0.942 | 0.437 | 0.542 | 2.3e-87 | |
| TAIR|locus:2202805 | 616 | AT1G26850 [Arabidopsis thalian | 0.928 | 0.443 | 0.525 | 2.2e-80 | |
| TAIR|locus:2141035 | 621 | AT4G18030 [Arabidopsis thalian | 0.914 | 0.433 | 0.503 | 5.9e-73 | |
| TAIR|locus:2034522 | 603 | AT1G31850 [Arabidopsis thalian | 0.891 | 0.434 | 0.455 | 2.2e-66 | |
| TAIR|locus:2134756 | 600 | ERD3 "early-responsive to dehy | 0.918 | 0.45 | 0.441 | 4.2e-63 | |
| TAIR|locus:2129660 | 608 | AT4G14360 [Arabidopsis thalian | 0.880 | 0.425 | 0.415 | 9.2e-52 |
| TAIR|locus:2041031 AT2G43200 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 906 (324.0 bits), Expect = 7.3e-91, P = 7.3e-91
Identities = 160/277 (57%), Positives = 205/277 (74%)
Query: 1 MDYNILTMSFAPLDVHEAQVQFALERGLPAMVGLLSTYQLPYPSRSFDVAHCSRCLVPWT 60
++Y ILTMS AP D+HEAQVQFALERGLPAM+G+LSTY+LPYPSRSFD+ HCSRCLV WT
Sbjct: 232 LNYKILTMSIAPRDIHEAQVQFALERGLPAMLGVLSTYKLPYPSRSFDMVHCSRCLVNWT 291
Query: 61 SYDGLYLMEIDRVLRPGGYWVVSGPPISWKTSYRGWERDAKDLQKEQISLENLATRLCWK 120
SYDGLYLME+DRVLRP GYWV+SGPP++ + ++ +RD+K+LQ + L ++ RLCW+
Sbjct: 292 SYDGLYLMEVDRVLRPEGYWVLSGPPVASRVKFKNQKRDSKELQNQMEKLNDVFRRLCWE 351
Query: 121 KIAERGPIAVWRKPTNHLHCIQKLKALKSPTFCVKSDPDAVWYTKMEPCVTPLPMVNEIK 180
KIAE P+ +WRKP+NHL C ++LKALK P C SDPDA WY +MEPC+TPLP VN+
Sbjct: 352 KIAESYPVVIWRKPSNHLQCRKRLKALKFPGLCSSSDPDAAWYKEMEPCITPLPDVNDTN 411
Query: 181 DVAGGALEKWPKRLNTAPPRIRSGFIEGITVKSFNEDNQLWKKRVSHYRIILESLFSGKF 240
L+ WP+RLN P R+++G I+G T+ F D LW++RV +Y + L +GK+
Sbjct: 412 KTV---LKNWPERLNHVP-RMKTGSIQGTTIAGFKADTNLWQRRVLYYDTKFKFLSNGKY 467
Query: 241 RNIMDMNXXXXXXXXXXXKYPVWVMNAVPFDAKHNTL 277
RN++DMN KYP+WVMN VPFD K NTL
Sbjct: 468 RNVIDMNAGLGGFAAALIKYPMWVMNVVPFDLKPNTL 504
|
|
| TAIR|locus:2196651 AT1G33170 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2127711 AT4G10440 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2050679 AT2G45750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2117728 AT4G00750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2202805 AT1G26850 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2141035 AT4G18030 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034522 AT1G31850 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2134756 ERD3 "early-responsive to dehydration 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2129660 AT4G14360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 294 | |||
| pfam03141 | 506 | pfam03141, Methyltransf_29, Putative S-adenosyl-L- | 1e-143 | |
| pfam08241 | 92 | pfam08241, Methyltransf_11, Methyltransferase doma | 1e-06 | |
| COG2226 | 238 | COG2226, UbiE, Methylase involved in ubiquinone/me | 0.003 |
| >gnl|CDD|217386 pfam03141, Methyltransf_29, Putative S-adenosyl-L-methionine-dependent methyltransferase | Back alignment and domain information |
|---|
Score = 413 bits (1063), Expect = e-143
Identities = 158/279 (56%), Positives = 204/279 (73%), Gaps = 14/279 (5%)
Query: 1 MDYNILTMSFAPLDVHEAQVQFALERGLPAMVGLLSTYQLPYPSRSFDVAHCSRCLVPWT 60
+ ++LTMSFAP DVHEAQVQFALERG+PAM+G+L T +LPYPSRSFD+AHCSRCL+PW
Sbjct: 136 LSRDVLTMSFAPKDVHEAQVQFALERGVPAMLGVLGTRRLPYPSRSFDMAHCSRCLIPWH 195
Query: 61 SYDGLYLMEIDRVLRPGGYWVVSGPPISWKTSYRGWERDAKDLQKEQISLENLATRLCWK 120
+ DG+ L+E+DRVLRPGGY+V+SGPP+ + RD +DLQ+E ++E LA LCWK
Sbjct: 196 ANDGILLLEVDRVLRPGGYFVLSGPPV--------YARDEEDLQEEWKAMEALAKSLCWK 247
Query: 121 KIAERGPIAVWRKPTNHLHCIQKLKALKSPTFC-VKSDPDAVWYTKMEPCVTPLPMVNEI 179
+A++G IA+W+KP N+ C K + K P C DPDA WY ME C+TPLP V+
Sbjct: 248 LVAKKGDIAIWQKPVNN-SCYNKREPGKKPPLCKDSDDPDAAWYVPMEACITPLPEVSH- 305
Query: 180 KDVAGGALEKWPKRLNTAPPRIRSGFIEGITVKSFNEDNQLWKKRVSHYRIILESLF-SG 238
+V GG LEKWP+RL PPR+ SG I G++ ++F D +LWK+RVS Y+ +L+ L G
Sbjct: 306 -EVGGGWLEKWPERLTAVPPRLASGQIGGVSAEAFKADTELWKRRVSKYKRLLKLLIDKG 364
Query: 239 KFRNIMDMNAGLGGFAAALAKYPVWVMNAVPFDAKHNTL 277
+ RN+MDMNAG GGFAAAL PVWVMN VP D+ +TL
Sbjct: 365 RVRNVMDMNAGFGGFAAALIDDPVWVMNVVPVDSP-DTL 402
|
This family is a putative S-adenosyl-L-methionine (SAM)-dependent methyltransferase. Length = 506 |
| >gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|225136 COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 294 | |||
| PF03141 | 506 | Methyltransf_29: Putative S-adenosyl-L-methionine- | 100.0 | |
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 99.49 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 99.39 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 99.33 | |
| PLN02232 | 160 | ubiquinone biosynthesis methyltransferase | 99.32 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 99.21 | |
| KOG4300 | 252 | consensus Predicted methyltransferase [General fun | 99.19 | |
| KOG1540 | 296 | consensus Ubiquinone biosynthesis methyltransferas | 99.06 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 99.0 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 98.87 | |
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 98.86 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 98.86 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 98.8 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 98.78 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 98.74 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 98.73 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 98.73 | |
| PLN02490 | 340 | MPBQ/MSBQ methyltransferase | 98.71 | |
| smart00138 | 264 | MeTrc Methyltransferase, chemotaxis proteins. Meth | 98.68 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 98.66 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 98.66 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 98.64 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 98.64 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 98.63 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 98.61 | |
| PF13489 | 161 | Methyltransf_23: Methyltransferase domain; PDB: 3J | 98.54 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 98.53 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 98.51 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 98.45 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 98.44 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 98.44 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 98.42 | |
| PRK06922 | 677 | hypothetical protein; Provisional | 98.42 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 98.41 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 98.4 | |
| PF08242 | 99 | Methyltransf_12: Methyltransferase domain; InterPr | 98.39 | |
| KOG3010 | 261 | consensus Methyltransferase [General function pred | 98.39 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 98.37 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 98.35 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 98.35 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 98.26 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 98.26 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 98.22 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 98.21 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 98.21 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 98.18 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 98.17 | |
| COG4106 | 257 | Tam Trans-aconitate methyltransferase [General fun | 98.11 | |
| KOG2940 | 325 | consensus Predicted methyltransferase [General fun | 98.08 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 98.08 | |
| PLN03075 | 296 | nicotianamine synthase; Provisional | 98.03 | |
| PF03141 | 506 | Methyltransf_29: Putative S-adenosyl-L-methionine- | 98.01 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 97.94 | |
| KOG1270 | 282 | consensus Methyltransferases [Coenzyme transport a | 97.93 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 97.92 | |
| PF05401 | 201 | NodS: Nodulation protein S (NodS); InterPro: IPR00 | 97.91 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 97.87 | |
| KOG1541 | 270 | consensus Predicted protein carboxyl methylase [Ge | 97.79 | |
| PF07021 | 193 | MetW: Methionine biosynthesis protein MetW; InterP | 97.79 | |
| PF05148 | 219 | Methyltransf_8: Hypothetical methyltransferase; In | 97.79 | |
| KOG1975 | 389 | consensus mRNA cap methyltransferase [RNA processi | 97.78 | |
| TIGR02081 | 194 | metW methionine biosynthesis protein MetW. This pr | 97.78 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 97.77 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 97.75 | |
| KOG3045 | 325 | consensus Predicted RNA methylase involved in rRNA | 97.71 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 97.71 | |
| TIGR03840 | 213 | TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d | 97.7 | |
| COG4627 | 185 | Uncharacterized protein conserved in bacteria [Fun | 97.7 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 97.65 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 97.64 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 97.62 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 97.6 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 97.6 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 97.58 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 97.58 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 97.57 | |
| PRK10611 | 287 | chemotaxis methyltransferase CheR; Provisional | 97.56 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 97.52 | |
| TIGR03438 | 301 | probable methyltransferase. This model represents | 97.51 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 97.51 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 97.49 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 97.44 | |
| PRK04266 | 226 | fibrillarin; Provisional | 97.42 | |
| PRK13255 | 218 | thiopurine S-methyltransferase; Reviewed | 97.42 | |
| PF03291 | 331 | Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 | 97.4 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 97.39 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 97.39 | |
| PF05219 | 265 | DREV: DREV methyltransferase; InterPro: IPR007884 | 97.32 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 97.29 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 97.29 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 97.27 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 97.23 | |
| KOG1331 | 293 | consensus Predicted methyltransferase [General fun | 97.22 | |
| PF08003 | 315 | Methyltransf_9: Protein of unknown function (DUF16 | 97.22 | |
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 97.21 | |
| PF01739 | 196 | CheR: CheR methyltransferase, SAM binding domain; | 97.19 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 97.19 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 97.18 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 97.15 | |
| PF03848 | 192 | TehB: Tellurite resistance protein TehB; InterPro: | 97.14 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 97.12 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 97.12 | |
| PRK13256 | 226 | thiopurine S-methyltransferase; Reviewed | 97.1 | |
| PTZ00146 | 293 | fibrillarin; Provisional | 97.08 | |
| COG0500 | 257 | SmtA SAM-dependent methyltransferases [Secondary m | 97.07 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 97.01 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 97.0 | |
| KOG1269 | 364 | consensus SAM-dependent methyltransferases [Lipid | 96.96 | |
| PF06080 | 204 | DUF938: Protein of unknown function (DUF938); Inte | 96.94 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 96.9 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 96.9 | |
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 96.86 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 96.82 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 96.8 | |
| KOG2361 | 264 | consensus Predicted methyltransferase [General fun | 96.78 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 96.7 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 96.54 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 96.54 | |
| COG1041 | 347 | Predicted DNA modification methylase [DNA replicat | 96.53 | |
| PF11968 | 219 | DUF3321: Putative methyltransferase (DUF3321); Int | 96.46 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 96.44 | |
| TIGR00438 | 188 | rrmJ cell division protein FtsJ. | 96.44 | |
| PF07942 | 270 | N2227: N2227-like protein; InterPro: IPR012901 Thi | 96.39 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 96.38 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 96.38 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 96.37 | |
| PRK14966 | 423 | unknown domain/N5-glutamine S-adenosyl-L-methionin | 96.32 | |
| KOG2352 | 482 | consensus Predicted spermine/spermidine synthase [ | 96.07 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 95.95 | |
| PRK13943 | 322 | protein-L-isoaspartate O-methyltransferase; Provis | 95.94 | |
| PF00891 | 241 | Methyltransf_2: O-methyltransferase; InterPro: IPR | 95.89 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 95.88 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 95.86 | |
| PRK03612 | 521 | spermidine synthase; Provisional | 95.67 | |
| PRK01581 | 374 | speE spermidine synthase; Validated | 95.61 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 95.6 | |
| COG2521 | 287 | Predicted archaeal methyltransferase [General func | 95.57 | |
| PF05891 | 218 | Methyltransf_PK: AdoMet dependent proline di-methy | 95.53 | |
| TIGR00417 | 270 | speE spermidine synthase. the SpeE subunit of sper | 95.43 | |
| KOG1271 | 227 | consensus Methyltransferases [General function pre | 95.36 | |
| PF01234 | 256 | NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I | 95.35 | |
| PRK13699 | 227 | putative methylase; Provisional | 95.28 | |
| COG2519 | 256 | GCD14 tRNA(1-methyladenosine) methyltransferase an | 94.93 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 94.83 | |
| KOG3201 | 201 | consensus Uncharacterized conserved protein [Funct | 94.79 | |
| PF03269 | 177 | DUF268: Caenorhabditis protein of unknown function | 94.76 | |
| PF01170 | 179 | UPF0020: Putative RNA methylase family UPF0020; In | 94.75 | |
| PF05724 | 218 | TPMT: Thiopurine S-methyltransferase (TPMT); Inter | 94.71 | |
| COG1352 | 268 | CheR Methylase of chemotaxis methyl-accepting prot | 94.63 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 94.47 | |
| COG2813 | 300 | RsmC 16S RNA G1207 methylase RsmC [Translation, ri | 94.11 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 94.05 | |
| PHA03412 | 241 | putative methyltransferase; Provisional | 93.9 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 93.88 | |
| PRK11933 | 470 | yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; | 93.47 | |
| PLN02366 | 308 | spermidine synthase | 93.14 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 92.84 | |
| COG4122 | 219 | Predicted O-methyltransferase [General function pr | 92.78 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 92.76 | |
| COG0220 | 227 | Predicted S-adenosylmethionine-dependent methyltra | 92.68 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 92.4 | |
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 91.93 | |
| smart00650 | 169 | rADc Ribosomal RNA adenine dimethylases. | 91.76 | |
| PF02390 | 195 | Methyltransf_4: Putative methyltransferase ; Inter | 91.48 | |
| PRK11524 | 284 | putative methyltransferase; Provisional | 91.46 | |
| PF08704 | 247 | GCD14: tRNA methyltransferase complex GCD14 subuni | 90.42 | |
| PRK00536 | 262 | speE spermidine synthase; Provisional | 90.22 | |
| PF06859 | 110 | Bin3: Bicoid-interacting protein 3 (Bin3); InterPr | 90.11 | |
| KOG2798 | 369 | consensus Putative trehalase [Carbohydrate transpo | 89.81 | |
| COG2242 | 187 | CobL Precorrin-6B methylase 2 [Coenzyme metabolism | 89.77 | |
| PF12147 | 311 | Methyltransf_20: Putative methyltransferase; Inter | 89.6 | |
| KOG2899 | 288 | consensus Predicted methyltransferase [General fun | 89.59 | |
| PLN02823 | 336 | spermine synthase | 89.06 | |
| TIGR00478 | 228 | tly hemolysin TlyA family protein. Hemolysins are | 88.7 | |
| KOG3178 | 342 | consensus Hydroxyindole-O-methyltransferase and re | 88.56 | |
| PF03059 | 276 | NAS: Nicotianamine synthase protein; InterPro: IPR | 88.41 | |
| PRK15128 | 396 | 23S rRNA m(5)C1962 methyltransferase; Provisional | 88.08 | |
| PLN02476 | 278 | O-methyltransferase | 87.2 | |
| COG4798 | 238 | Predicted methyltransferase [General function pred | 86.2 | |
| COG2518 | 209 | Pcm Protein-L-isoaspartate carboxylmethyltransfera | 85.83 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 85.3 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 85.17 | |
| TIGR03439 | 319 | methyl_EasF probable methyltransferase domain, Eas | 84.55 | |
| PF01555 | 231 | N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th | 84.17 | |
| KOG1661 | 237 | consensus Protein-L-isoaspartate(D-aspartate) O-me | 83.33 | |
| PF06962 | 140 | rRNA_methylase: Putative rRNA methylase; InterPro: | 82.21 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 82.16 | |
| COG1092 | 393 | Predicted SAM-dependent methyltransferases [Genera | 81.88 | |
| PLN02589 | 247 | caffeoyl-CoA O-methyltransferase | 81.78 | |
| KOG3987 | 288 | consensus Uncharacterized conserved protein DREV/C | 81.52 | |
| PF10294 | 173 | Methyltransf_16: Putative methyltransferase; Inter | 81.37 |
| >PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.5e-91 Score=680.11 Aligned_cols=271 Identities=58% Similarity=1.077 Sum_probs=259.5
Q ss_pred CCCCceeeeeccCCCcHHHHHHHHHcCCCcEEEEccCCCCCCCCCcccEEEecCcCcccccChHHHHHHHHhccCCCcEE
Q 041513 1 MDYNILTMSFAPLDVHEAQVQFALERGLPAMVGLLSTYQLPYPSRSFDVAHCSRCLVPWTSYDGLYLMEIDRVLRPGGYW 80 (294)
Q Consensus 1 ~~~~v~t~s~ap~D~S~~mlq~A~ergv~~~~~v~d~~~LPfpd~sFD~V~~s~~l~h~~~d~~~~L~Ei~RVLKPGG~~ 80 (294)
++|||+|||+||.|.++.++|+|.|||+++.+.+.++++||||+++||+|||++|+++|+.+.+.+|.|++|||||||||
T Consensus 136 ~~r~V~t~s~a~~d~~~~qvqfaleRGvpa~~~~~~s~rLPfp~~~fDmvHcsrc~i~W~~~~g~~l~evdRvLRpGGyf 215 (506)
T PF03141_consen 136 LERNVTTMSFAPNDEHEAQVQFALERGVPAMIGVLGSQRLPFPSNAFDMVHCSRCLIPWHPNDGFLLFEVDRVLRPGGYF 215 (506)
T ss_pred hhCCceEEEcccccCCchhhhhhhhcCcchhhhhhccccccCCccchhhhhcccccccchhcccceeehhhhhhccCceE
Confidence 57999999999999999999999999999999888999999999999999999999999999889999999999999999
Q ss_pred EEEcCCCCccccCCCcccChHHHHHHHHHHHHHHHhhceEeeecccceeEeeCCCCCchhhhhhhcCCCCCCCC-CCCCC
Q 041513 81 VVSGPPISWKTSYRGWERDAKDLQKEQISLENLATRLCWKKIAERGPIAVWRKPTNHLHCIQKLKALKSPTFCV-KSDPD 159 (294)
Q Consensus 81 vis~pp~~~~~~~~~w~~~~e~l~~~~~~le~l~~~lcW~~v~~~~~~~iw~Kp~~~~~C~~~r~~~~~~~~C~-~~~~d 159 (294)
++|+||++ ++++++++++|++|++++++|||++++++++++|||||.+| +||.+|+..+.|++|+ ++|||
T Consensus 216 v~S~ppv~--------~r~~~~~~~~~~~~~~l~~~lCW~~va~~~~~aIwqKp~~~-~Cy~~r~~~~~pplC~~~~dpd 286 (506)
T PF03141_consen 216 VLSGPPVY--------QRTDEDLEEEWNAMEDLAKSLCWKKVAEKGDTAIWQKPTNN-SCYQKRKPGKSPPLCDSSDDPD 286 (506)
T ss_pred EecCCccc--------ccchHHHHHHHHHHHHHHHHHHHHHheeeCCEEEEeccCCc-hhhhhccCCCCCCCCCCCCCCc
Confidence 99999997 35677889999999999999999999999999999999997 9999999889999999 88999
Q ss_pred ccccccCccccccCCCCcccccccCCCCcCCcccccCCCCcccccccccccchhhhhhHHHHHHHHHHHHHhhh-cCCCC
Q 041513 160 AVWYTKMEPCVTPLPMVNEIKDVAGGALEKWPKRLNTAPPRIRSGFIEGITVKSFNEDNQLWKKRVSHYRIILE-SLFSG 238 (294)
Q Consensus 160 ~~wy~~~~~ci~~~~~~~~~~~~~~~~~~~wp~Rl~~~p~r~~~~~~~g~~~~~f~~D~~~W~~~v~~Y~~~~~-~~~~~ 238 (294)
++||++|++||||+|++++ +.+++++++||+||+++|+||++|++.|+++|+|++||++||++|++||+++. .|+++
T Consensus 287 ~aWY~~l~~Cit~~p~~~~--~~~~~~~~~WP~RL~~~P~rl~~~~~~g~~~e~F~~Dt~~Wk~~V~~Y~~l~~~~i~~~ 364 (506)
T PF03141_consen 287 AAWYVPLEACITPLPEVSS--EIAGGWLPKWPERLNAVPPRLSSGSIPGISPEEFKEDTKHWKKRVSHYKKLLGLAIKWG 364 (506)
T ss_pred chhhcchhhhcCcCCcccc--cccccCCCCChhhhccCchhhhcCCcCCCCHHHHHHHHHHHHHHHHHHHHhhccccccc
Confidence 9999999999999998754 78899999999999999999999999999999999999999999999999887 79999
Q ss_pred CcceeeccccCcchhHhhhcCCCceEEEecCCCCCCCCccceEec
Q 041513 239 KFRNIMDMNAGLGGFAAALAKYPVWVMNAVPFDAKHNTLQTGILS 283 (294)
Q Consensus 239 ~~RNvmDMnA~~GGFAAAl~~~~vWVMNVvP~~~~~~tL~v~~~~ 283 (294)
+||||||||||||||||||+++|||||||||+.++ |||||||--
T Consensus 365 ~iRNVMDMnAg~GGFAAAL~~~~VWVMNVVP~~~~-ntL~vIydR 408 (506)
T PF03141_consen 365 RIRNVMDMNAGYGGFAAALIDDPVWVMNVVPVSGP-NTLPVIYDR 408 (506)
T ss_pred ceeeeeeecccccHHHHHhccCCceEEEecccCCC-Ccchhhhhc
Confidence 99999999999999999999999999999999887 999999853
|
; GO: 0008168 methyltransferase activity |
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >PLN02232 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >KOG4300 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >PLN02490 MPBQ/MSBQ methyltransferase | Back alignment and domain information |
|---|
| >smart00138 MeTrc Methyltransferase, chemotaxis proteins | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06922 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >KOG3010 consensus Methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2940 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >PLN03075 nicotianamine synthase; Provisional | Back alignment and domain information |
|---|
| >PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] | Back alignment and domain information |
|---|
| >PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins | Back alignment and domain information |
|---|
| >PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases | Back alignment and domain information |
|---|
| >KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02081 metW methionine biosynthesis protein MetW | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family | Back alignment and domain information |
|---|
| >COG4627 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >PRK10611 chemotaxis methyltransferase CheR; Provisional | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >TIGR03438 probable methyltransferase | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PRK13255 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >KOG1331 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >PRK13256 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00146 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2361 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >TIGR00438 rrmJ cell division protein FtsJ | Back alignment and domain information |
|---|
| >PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK03612 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK01581 speE spermidine synthase; Validated | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2521 Predicted archaeal methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like | Back alignment and domain information |
|---|
| >TIGR00417 speE spermidine synthase | Back alignment and domain information |
|---|
| >KOG1271 consensus Methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK13699 putative methylase; Provisional | Back alignment and domain information |
|---|
| >COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >KOG3201 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF03269 DUF268: Caenorhabditis protein of unknown function, DUF268; InterPro: IPR004951 This family consists of proteins of unknown function found in Caenorhabditis species | Back alignment and domain information |
|---|
| >PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase | Back alignment and domain information |
|---|
| >PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >COG4122 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >smart00650 rADc Ribosomal RNA adenine dimethylases | Back alignment and domain information |
|---|
| >PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 | Back alignment and domain information |
|---|
| >PRK11524 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] | Back alignment and domain information |
|---|
| >PRK00536 speE spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) | Back alignment and domain information |
|---|
| >KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length | Back alignment and domain information |
|---|
| >KOG2899 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02823 spermine synthase | Back alignment and domain information |
|---|
| >TIGR00478 tly hemolysin TlyA family protein | Back alignment and domain information |
|---|
| >KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 | Back alignment and domain information |
|---|
| >PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02476 O-methyltransferase | Back alignment and domain information |
|---|
| >COG4798 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03439 methyl_EasF probable methyltransferase domain, EasF family | Back alignment and domain information |
|---|
| >PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases | Back alignment and domain information |
|---|
| >KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02589 caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] | Back alignment and domain information |
|---|
| >PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 294 | |||
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 2e-07 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 2e-07 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 2e-07 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 2e-07 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 2e-07 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 6e-07 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 7e-07 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 2e-06 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 4e-06 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 7e-06 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 2e-05 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 3e-05 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 3e-05 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 4e-05 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 4e-05 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 5e-05 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 7e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 1e-04 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 1e-04 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 2e-04 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 2e-04 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 2e-04 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 3e-04 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 3e-04 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 4e-04 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 4e-04 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 6e-04 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 7e-04 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 7e-04 |
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 | Back alignment and structure |
|---|
Score = 50.7 bits (121), Expect = 2e-07
Identities = 22/94 (23%), Positives = 32/94 (34%), Gaps = 10/94 (10%)
Query: 13 LDVHEAQVQFALER----GLPAMVGLL--STYQLPYPSRSFDVAHCSRCLVPWTSYDGLY 66
LD + GL V + S LP+ + D+ + +
Sbjct: 75 LDFLSGFIDIFNRNARQSGLQNRVTGIVGSMDDLPFRNEELDLIWSEGAI--YNIGFERG 132
Query: 67 LMEIDRVLRPGGYWVVSGPPISWKTSYRGWERDA 100
L E + L+ GGY VS SW T R E +
Sbjct: 133 LNEWRKYLKKGGYLAVS--ECSWFTDERPAEIND 164
|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Length = 243 | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Length = 273 | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Length = 261 | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Length = 202 | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Length = 219 | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 203 | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 195 | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Length = 260 | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Length = 240 | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Length = 230 | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Length = 211 | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Length = 263 | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Length = 227 | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Length = 297 | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Length = 269 | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Length = 235 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 294 | |||
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 99.15 | |
| 2ld4_A | 176 | Anamorsin; methyltransferase-like fold, alpha/beta | 99.12 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 99.02 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 99.0 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 98.98 | |
| 2aot_A | 292 | HMT, histamine N-methyltransferase; classic methyl | 98.95 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 98.94 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 98.93 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 98.93 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 98.92 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 98.92 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 98.92 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 98.91 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 98.9 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 98.9 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 98.89 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 98.88 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 98.88 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 98.88 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 98.88 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 98.86 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 98.86 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 98.85 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 98.85 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 98.84 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 98.84 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 98.84 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 98.83 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 98.81 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 98.81 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 98.8 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 98.8 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 98.78 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 98.78 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 98.77 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 98.77 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 98.77 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 98.75 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 98.75 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 98.73 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 98.73 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 98.73 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 98.73 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 98.72 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 98.72 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 98.72 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 98.71 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 98.71 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 98.71 | |
| 2g72_A | 289 | Phenylethanolamine N-methyltransferase; HET: SAM F | 98.7 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 98.69 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 98.66 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 98.66 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 98.66 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 98.65 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 98.64 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 98.62 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 98.62 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 98.62 | |
| 2a14_A | 263 | Indolethylamine N-methyltransferase; SGC,INMT, str | 98.61 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 98.61 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 98.61 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 98.6 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 98.6 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 98.59 | |
| 4e2x_A | 416 | TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s | 98.56 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 98.54 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 98.54 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 98.52 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 98.5 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 98.48 | |
| 1af7_A | 274 | Chemotaxis receptor methyltransferase CHER; chemot | 98.47 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 98.47 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 98.47 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 98.47 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 98.46 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 98.46 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 98.46 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 98.46 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 98.45 | |
| 2qe6_A | 274 | Uncharacterized protein TFU_2867; putative methylt | 98.43 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 98.4 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 98.38 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 98.37 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 98.34 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 98.34 | |
| 3hp7_A | 291 | Hemolysin, putative; structural genomics, APC64019 | 98.34 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 98.34 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 98.32 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 98.29 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 98.28 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 98.25 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 98.24 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 98.22 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 98.22 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 98.2 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 98.2 | |
| 3sso_A | 419 | Methyltransferase; macrolide, natural product, ros | 98.19 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 98.19 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 98.19 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 98.18 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 98.18 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 98.17 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 98.15 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 98.14 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 98.13 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 98.12 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 98.11 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 98.1 | |
| 3giw_A | 277 | Protein of unknown function DUF574; rossmann-fold | 98.06 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 98.04 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 98.04 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 98.04 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 98.03 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 98.0 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 98.0 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 97.99 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 97.99 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 97.98 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 97.98 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 97.98 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 97.97 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 97.95 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 97.95 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 97.92 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 97.92 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 97.91 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 97.9 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 97.89 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 97.87 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 97.86 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 97.85 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 97.85 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 97.84 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 97.84 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 97.84 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 97.84 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 97.83 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 97.82 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 97.82 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 97.81 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 97.81 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 97.81 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 97.8 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 97.8 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 97.8 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 97.79 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 97.78 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 97.78 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 97.76 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 97.76 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 97.75 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 97.73 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 97.72 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 97.72 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 97.71 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 97.7 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 97.7 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 97.7 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 97.69 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 97.68 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 97.68 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 97.68 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 97.67 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 97.67 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 97.67 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 97.66 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 97.65 | |
| 2bm8_A | 236 | Cephalosporin hydroxylase CMCI; cephamycin biosynt | 97.65 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 97.65 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 97.62 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 97.59 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 97.59 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 97.59 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 97.55 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 97.53 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 97.51 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 97.49 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 97.49 | |
| 3opn_A | 232 | Putative hemolysin; structural genomics, PSI-2, pr | 97.49 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 97.49 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 97.47 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 97.42 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 97.4 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 97.4 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 97.4 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 97.38 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 97.35 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 97.34 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 97.34 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 97.31 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 97.28 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 97.27 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 97.26 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 97.26 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 97.25 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 97.24 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 97.23 | |
| 2wa2_A | 276 | Non-structural protein 5; transferase, S-adenosyl- | 97.22 | |
| 2oxt_A | 265 | Nucleoside-2'-O-methyltransferase; flavivirus, vir | 97.21 | |
| 2plw_A | 201 | Ribosomal RNA methyltransferase, putative; malaria | 97.2 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 97.2 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 97.18 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 97.17 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 97.17 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 97.15 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 97.13 | |
| 3b5i_A | 374 | S-adenosyl-L-methionine:salicylic acid carboxyl me | 97.12 | |
| 4a6d_A | 353 | Hydroxyindole O-methyltransferase; melatonin, circ | 97.11 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 97.11 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 97.1 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 97.09 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 97.07 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 97.03 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 97.01 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 97.0 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 96.96 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 96.89 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 96.82 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 96.79 | |
| 2p41_A | 305 | Type II methyltransferase; vizier, viral enzymes i | 96.78 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 96.77 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 96.72 | |
| 2efj_A | 384 | 3,7-dimethylxanthine methyltransferase; SAM-depend | 96.7 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 96.69 | |
| 2xyq_A | 290 | Putative 2'-O-methyl transferase; transferase-vira | 96.68 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 96.66 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 96.59 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 96.58 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 96.58 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 96.55 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 96.55 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 96.51 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 96.47 | |
| 1m6e_X | 359 | S-adenosyl-L-methionnine:salicylic acid carboxyl m | 96.45 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 96.32 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 96.31 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 96.16 | |
| 3lcv_B | 281 | Sisomicin-gentamicin resistance methylase SGM; ant | 95.9 | |
| 3frh_A | 253 | 16S rRNA methylase; methyltransferase domain, heli | 95.89 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 95.82 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 95.65 | |
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 95.6 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 95.57 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 95.37 | |
| 2okc_A | 445 | Type I restriction enzyme stysji M protein; NP_813 | 95.29 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 95.25 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 95.11 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 94.41 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 94.4 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 94.31 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 94.09 | |
| 3evf_A | 277 | RNA-directed RNA polymerase NS5; NS5 methyltransfe | 94.0 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 93.67 | |
| 1yub_A | 245 | Ermam, rRNA methyltransferase; MLS antibiotics; NM | 93.58 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 93.56 | |
| 1boo_A | 323 | Protein (N-4 cytosine-specific methyltransferase P | 93.21 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 92.99 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 92.97 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 92.93 | |
| 2b9e_A | 309 | NOL1/NOP2/SUN domain family, member 5 isoform 2; m | 92.5 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 92.39 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 91.74 | |
| 2ar0_A | 541 | M.ecoki, type I restriction enzyme ecoki M protein | 91.32 | |
| 1g60_A | 260 | Adenine-specific methyltransferase MBOIIA; structu | 90.83 | |
| 1qam_A | 244 | ERMC' methyltransferase; rRNA methyltransferase ER | 89.56 | |
| 3o4f_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 89.52 | |
| 2dul_A | 378 | N(2),N(2)-dimethylguanosine tRNA methyltransferas; | 88.77 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 88.61 | |
| 3khk_A | 544 | Type I restriction-modification system methylation | 88.48 | |
| 3cvo_A | 202 | Methyltransferase-like protein of unknown functio; | 87.89 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 87.21 | |
| 2qy6_A | 257 | UPF0209 protein YFCK; structural genomics, unknown | 87.13 | |
| 1eg2_A | 319 | Modification methylase RSRI; rossmann fold, exocyc | 86.71 | |
| 3lkd_A | 542 | Type I restriction-modification system methyltrans | 86.56 | |
| 3axs_A | 392 | Probable N(2),N(2)-dimethylguanosine tRNA methylt | 86.01 | |
| 4fzv_A | 359 | Putative methyltransferase NSUN4; mterf fold, meth | 82.62 | |
| 2km1_A | 136 | Protein DRE2; yeast, antiapoptotic, protein bindin | 80.08 |
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
Probab=99.15 E-value=1.3e-11 Score=112.27 Aligned_cols=74 Identities=24% Similarity=0.347 Sum_probs=64.2
Q ss_pred eeccCCCcHHHHHHHHHcCCCcEEEEccCCCCCCCCCcccEEEecCcCcccccChHHHHHHHHhccCCCcEEEEEcC
Q 041513 9 SFAPLDVHEAQVQFALERGLPAMVGLLSTYQLPYPSRSFDVAHCSRCLVPWTSYDGLYLMEIDRVLRPGGYWVVSGP 85 (294)
Q Consensus 9 s~ap~D~S~~mlq~A~ergv~~~~~v~d~~~LPfpd~sFD~V~~s~~l~h~~~d~~~~L~Ei~RVLKPGG~~vis~p 85 (294)
.+.+.|+|++|++.|+++ ..+.+.+++++.+||++++||+|+|+.++ ||.+ +..+++|+.|+|||||.|++...
T Consensus 63 ~v~gvD~s~~ml~~a~~~-~~v~~~~~~~e~~~~~~~sfD~v~~~~~~-h~~~-~~~~~~e~~rvLkpgG~l~~~~~ 136 (257)
T 4hg2_A 63 RVHAVDPGEAQIRQALRH-PRVTYAVAPAEDTGLPPASVDVAIAAQAM-HWFD-LDRFWAELRRVARPGAVFAAVTY 136 (257)
T ss_dssp EEEEEESCHHHHHTCCCC-TTEEEEECCTTCCCCCSSCEEEEEECSCC-TTCC-HHHHHHHHHHHEEEEEEEEEEEE
T ss_pred EEEEEeCcHHhhhhhhhc-CCceeehhhhhhhcccCCcccEEEEeeeh-hHhh-HHHHHHHHHHHcCCCCEEEEEEC
Confidence 456779999999998754 35778888999999999999999999999 7764 56899999999999999998763
|
| >2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* | Back alignment and structure |
|---|
| >2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} | Back alignment and structure |
|---|
| >2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* | Back alignment and structure |
|---|
| >3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* | Back alignment and structure |
|---|
| >1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A | Back alignment and structure |
|---|
| >3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A | Back alignment and structure |
|---|
| >3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* | Back alignment and structure |
|---|
| >4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* | Back alignment and structure |
|---|
| >2km1_A Protein DRE2; yeast, antiapoptotic, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 294 | ||||
| d2g72a1 | 263 | c.66.1.15 (A:18-280) Phenylethanolamine N-methyltr | 0.004 |
| >d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: Arylamine N-methyltransferase domain: Phenylethanolamine N-methyltransferase, PNMTase species: Human (Homo sapiens) [TaxId: 9606]
Score = 35.6 bits (81), Expect = 0.004
Identities = 13/75 (17%), Positives = 23/75 (30%), Gaps = 5/75 (6%)
Query: 38 YQLPYPSRSFDVAHCSRCL----VPWTSYDGLYLMEIDRVLRPGGYWVVSGPPISWKTSY 93
D + CL S+ L I +LRPGG+ ++ G
Sbjct: 149 GAGSPAPLPADALVSAFCLEAVSPDLASFQR-ALDHITTLLRPGGHLLLIGALEESWYLA 207
Query: 94 RGWERDAKDLQKEQI 108
+ +E++
Sbjct: 208 GEARLTVVPVSEEEV 222
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 294 | |||
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 99.3 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 99.27 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 99.24 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 99.19 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 99.15 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 99.08 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 99.05 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 98.98 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 98.91 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 98.9 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 98.87 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 98.83 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 98.82 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 98.81 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 98.77 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 98.64 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 98.62 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 98.61 | |
| d2a14a1 | 257 | Indolethylamine N-methyltransferase, INMT {Human ( | 98.41 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 98.38 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 98.36 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 98.25 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 98.24 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 98.23 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 98.2 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 98.17 | |
| d2g72a1 | 263 | Phenylethanolamine N-methyltransferase, PNMTase {H | 98.16 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 98.12 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 98.12 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 98.12 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 98.08 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 98.05 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 98.04 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 97.96 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 97.92 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 97.9 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 97.86 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 97.85 | |
| d1qzza2 | 256 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 97.78 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 97.74 | |
| d1af7a2 | 193 | Chemotaxis receptor methyltransferase CheR, C-term | 97.63 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 97.51 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 97.46 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 97.41 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 97.25 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 97.18 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 96.92 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 96.8 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 96.39 | |
| d1u2za_ | 406 | Catalytic, N-terminal domain of histone methyltran | 96.31 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 95.84 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 95.84 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 94.98 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 94.55 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 94.54 | |
| d1fp1d2 | 244 | Chalcone O-methyltransferase {Alfalfa (Medicago sa | 93.94 | |
| d2b78a2 | 317 | Hypothetical protein SMu776, middle and C-terminal | 93.78 | |
| d1g60a_ | 256 | Methyltransferase mboII {Moraxella bovis [TaxId: 4 | 93.13 | |
| d2cl5a1 | 214 | Catechol O-methyltransferase, COMT {Rat (Rattus no | 92.72 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 92.01 | |
| d1m6ya2 | 192 | TM0872, methyltransferase domain {Thermotoga marit | 90.74 | |
| d1mjfa_ | 276 | Putative spermidine synthetase PF0127 (SpeE) {Arch | 90.46 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 90.26 | |
| d1fp2a2 | 244 | Isoflavone O-methyltransferase {Alfalfa (Medicago | 90.07 | |
| d2avda1 | 219 | COMT domain-containing protein 1, COMTD1 {Human (H | 89.07 | |
| d1nv8a_ | 271 | N5-glutamine methyltransferase, HemK {Thermotoga m | 87.98 | |
| d1uira_ | 312 | Spermidine synthase {Thermus thermophilus [TaxId: | 87.7 | |
| d1kyza2 | 243 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 87.55 | |
| d1xj5a_ | 290 | Spermidine synthase {Thale cress (Arabidopsis thal | 87.28 | |
| d1eg2a_ | 279 | m.RsrI N6 adenosine-specific DNA methyltransferase | 87.24 | |
| d1inla_ | 295 | Spermidine synthase {Thermotoga maritima [TaxId: 2 | 87.12 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 86.56 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 85.68 | |
| d2o07a1 | 285 | Spermidine synthase {Human (Homo sapiens) [TaxId: | 84.76 | |
| d1iy9a_ | 274 | Spermidine synthase {Bacillus subtilis [TaxId: 142 | 83.08 | |
| d1ixka_ | 313 | Hypothetical methyltransferase PH1374 {Archaeon Py | 82.88 | |
| d2b2ca1 | 312 | Spermidine synthase {Caenorhabditis elegans [TaxId | 82.13 | |
| d1m6ex_ | 359 | Salicylic acid carboxyl methyltransferase (SAMT) { | 81.24 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 80.27 |
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: UbiE/COQ5-like domain: Hypothetical protein YcgJ species: Bacillus subtilis [TaxId: 1423]
Probab=99.30 E-value=2.1e-12 Score=112.09 Aligned_cols=76 Identities=22% Similarity=0.318 Sum_probs=66.4
Q ss_pred eeccCCCcHHHHHHHHHc----CC-CcEEEEccCCCCCCCCCcccEEEecCcCcccccChHHHHHHHHhccCCCcEEEEE
Q 041513 9 SFAPLDVHEAQVQFALER----GL-PAMVGLLSTYQLPYPSRSFDVAHCSRCLVPWTSYDGLYLMEIDRVLRPGGYWVVS 83 (294)
Q Consensus 9 s~ap~D~S~~mlq~A~er----gv-~~~~~v~d~~~LPfpd~sFD~V~~s~~l~h~~~d~~~~L~Ei~RVLKPGG~~vis 83 (294)
.+.+.|+|+.|++.|+++ ++ .+.+.+++++.+||++++||+|+|..++ ||..++..+|+|+.|+|||||+++++
T Consensus 40 ~v~gvD~S~~~l~~A~~~~~~~~~~~~~~~~~d~~~~~~~~~~fD~v~~~~~l-~~~~d~~~~l~~~~r~LkpgG~~~~~ 118 (234)
T d1xxla_ 40 ECIGVDATKEMVEVASSFAQEKGVENVRFQQGTAESLPFPDDSFDIITCRYAA-HHFSDVRKAVREVARVLKQDGRFLLV 118 (234)
T ss_dssp EEEEEESCHHHHHHHHHHHHHHTCCSEEEEECBTTBCCSCTTCEEEEEEESCG-GGCSCHHHHHHHHHHHEEEEEEEEEE
T ss_pred eEEEEeCChhhhhhhhhhhcccccccccccccccccccccccccceeeeecee-ecccCHHHHHHHHHHeeCCCcEEEEE
Confidence 467889999999999765 44 4677788999999999999999999999 55677889999999999999999997
Q ss_pred cC
Q 041513 84 GP 85 (294)
Q Consensus 84 ~p 85 (294)
.+
T Consensus 119 ~~ 120 (234)
T d1xxla_ 119 DH 120 (234)
T ss_dssp EE
T ss_pred Ec
Confidence 64
|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} | Back information, alignment and structure |
|---|
| >d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|