Citrus Sinensis ID: 041515


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760--
MISIPPSKRWRLTWFPLHDSRNKAKARRTRKQERRKTQSKMEESEVILLNSLKSGGVSIPADVSSIKDLTSETLVSICGQSLNLIFNTMTFGTSLPHSMAEKFKICTDISSAIKNLGYIGDISYYKFLYPSEEDLYKLIRFLVERLSELPKKVKVADGKGVDVRGNINKSTLEGNGETDLDHQKIRDQLEECRLENELPQSSNSEDVASDSVSSSRVQDYNKNDVTGVIRGKIKNHADNLQNRDESLMEAVTAKTSELCDPEEEYQLLKAAAEMAFDDSHPTEFYLEQLDEQVGAKKHNLVELELQWDALKESLEEKKRSLEESLYANELEAQAKLLKLREVELERQSVLSEIRKREDEYSKLSADLEKQPKVASRRSYIERIKEITKNSRKVDTDIERILKETRELQLESNSIQERLHRTYAVVDDMIFREAKKDQSFEQVSEKILATDRVRREIAEYEKKLAAVASRSLNVDKLQADVDVIMKENEFLEQQFHRDGRALEEIRGALYNEIRTSDGAKRQQQKICGPVVAMTFNFVVSVGIILTNKLVMGQVGFNFPIFLTVIHYAVAWILLAIFKAFSIIPVSPPAITTPFSSLFALGVVMSFATGLANTSLKHNSVGFYQMSKIAVTPTIVLAEFILFSKTISYKKVLALAIVSVGVAVATVTDLEFNIFGAIIAVAWIIPSAINKILWSNLQQQGNWTALALMWKTTPVTVFFLLALMPWLDPPGVLFYKWNLNNSSAIFISALLGFLLQWSGALALG
ccccccccccccEEcccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccHHHHHccccccccccHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccccHHHcHHccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcc
cccccccccEEEEEccccccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHccccccccEEEEccccHHHHHHHHHHHHHHccccccccEEccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEccHHHHHHHHHHHHHHHHcccccHHHcHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccccHcHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHccHccHHHHHHHHHHHHHHccccHccHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccHHEEEEEEEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHEEEcc
misippskrwrltwfplhdsrNKAKARRTRKQERRKTQSKMEESEVILLNSlksggvsipadvssikdltseTLVSICGQSLNLIFNtmtfgtslphsmaEKFKICTDISSAIKNlgyigdisyykflypseEDLYKLIRFLVERLSELpkkvkvadgkgvdvrgninkstlegngetdldHQKIRDQLEecrlenelpqssnsedvasdsvsssrvqdynkndvtGVIRGKIKNHADNLQNRDESLMEAVTAktselcdpeEEYQLLKAAAEmafddshpteFYLEQLDEQVGAKKHNLVELELQWDALKESLEEKKRSLEESLYANELEAQAKLLKLREVELERQSVLSEIRKREDEYSKLSADlekqpkvaSRRSYIERIKEITKNSRKVDTDIERILKETRELQLESNSIQERLHRTYAVVDDMIFREAKKDQSFEQVSEKILATDRVRREIAEYEKKLAAVASRSLNVDKLQADVDVIMKENEFLEQQFHRDGRALEEIRGALYNeirtsdgakrqqqkicgpvvAMTFNFVVSVGIILTnklvmgqvgfnfPIFLTVIHYAVAWILLAIFKAfsiipvsppaittpfsSLFALGVVMSFATGLANTSLKHNSVGFYQMSKIAVTPTIVLAEFILFSKTISYKKVLALAIVSVGVAVATVTDLEFNIFGAIIAVAWIIPSAINKILWSNLQQQGNWTALALMWKTTPVTVFFLLAlmpwldppgvlfykwnlnnsSAIFISALLGFLLQWSGALALG
misippskrwrltwfplhdsrnkakarrtrkqerrktqskmeesevillnslksggvsiPADVSSIKDLTSETLVSICGQSLNLIFNTMTFGTSLPHSMAEKFKICTDISSAIKNLGYIGDISYYKFLYPSEEDLYKLIRFLVERLselpkkvkvadgkgvdvrgninkstlegngetdldHQKIRDQLEECRLenelpqssnsedvasdsvsssrvqdynkndvtgvirgkiknhadnlqnrDESLMEAVTAKTSELCDPEEEYQLLKAAAEMAFDDSHPTEFYLEQLDEQVGAKKHNLVELELQWDALKESLEEKKRSLEESLYANELEAQAKLLKLREVELERQSVLseirkredeysklsadlekqpkvasrrsyierikeitknsrkvdtdiERILKEtrelqlesnsiqerlhrTYAVVDDMIFReakkdqsfeqvsekilatdrvRREIAEYEKKLaavasrslnvdKLQADVDVIMKENEFLEQQFHRDGRALEEIRGALYNEirtsdgakrqqQKICGPVVAMTFNFVVSVGIILTNKLVMGQVGFNFPIFLTVIHYAVAWILLAIFKAFSIIPVSPPAITTPFSSLFALGVVMSFATGLANTSLKHNSVGFYQMSKIAVTPTIVLAEFILFSKTISYKKVLALAIVSVGVAVATVTDLEFNIFGAIIAVAWIIPSAINKILWSNLQQQGNWTALALMWKTTPVTVFFLLALMPWLDPPGVLFYKWNLNNSSAIFISALLGFLLQWSGALALG
MISIPPSKRWRLTWFPLHDSRNkakarrtrkqerrktqskMEESEVILLNSLKSGGVSIPADVSSIKDLTSETLVSICGQSLNLIFNTMTFGTSLPHSMAEKFKICTDISSAIKNLGYIGDISYYKFLYPSEEDLYKLIRFLVERLSELPkkvkvadgkgvdvRGNINKSTLEGNGETDLDHQKIRDQLEECRLENELPQssnsedvasdsvsssrvqdYNKNDVTGVIRGKIKNHADNLQNRDESLMEAVTAKTSELCDPEEEYQLLKAAAEMAFDDSHPTEFYLEQLDEQVGAKKHNLVELELQWDAlkesleekkrsleeslYANELEAQAkllklrevelerQSVLSEIRKREDEYSKLSADLEKQPKVASRRSYIERIKEITKNSRKVDTDIERILKETRELQLESNSIQERLHRTYAVVDDMIFREAKKDQSFEQVSEKILATDRVRREIAEYEKKLAAVASRSLNVDKLQADVDVIMKENEFLEQQFHRDGRALEEIRGALYNEIRTSDGAKRQQQKICGPVVAMTFNFVVSVGIILTNKLVMGQVGFNFPIFLTVIHYAVAWILLAIFKAFSIIPVSPPAITTPFSSLFALGVVMSFATGLANTSLKHNSVGFYQMSKIAVTPTIVLAEFILFSKTISYKKVLALAIVSVGVAVATVTDLEFNIFGAIIAVAWIIPSAINKILWSNLQQQGNWTALALMWKTTPVTVFFLLALMPWLDPPGVLFYKWNLNNSSAIFISALLGFLLQWSGALALG
*********WRLTWFPL*****************************ILLNSLKSGGVSIPADVSSIKDLTSETLVSICGQSLNLIFNTMTFGTSLPHSMAEKFKICTDISSAIKNLGYIGDISYYKFLYPSEEDLYKLIRFLVERLSELPKKVKVADG************************************************************************************************************LLKAAA*MAF****PTEFYLEQLDEQVGAKKHNLVELELQWDAL********************************************************************************************************QERLHRTYAVVDDMIFREA**********EKILATDRVRREIAEYEKKLAAVASRSLNVDKLQADVDVIMKENEFLEQQFHRDGRALEEIRGALYNEIRTS*****QQQKICGPVVAMTFNFVVSVGIILTNKLVMGQVGFNFPIFLTVIHYAVAWILLAIFKAFSIIPVSPPAITTPFSSLFALGVVMSFATGLANTSLKHNSVGFYQMSKIAVTPTIVLAEFILFSKTISYKKVLALAIVSVGVAVATVTDLEFNIFGAIIAVAWIIPSAINKILWSNLQQQGNWTALALMWKTTPVTVFFLLALMPWLDPPGVLFYKWNLNNSSAIFISALLGFLLQWSGAL***
*******KRWRLTWFPL****************************VILLNSLKSGGVSIPADVSSIKDLTSETLVSICGQSLNLIFN************AEKFKICTDISSAIKNLGYIGDISYYKFLYPSEEDLYKLIRF********************************************************************************************************************************************************************QWDALKESLE********************************************************************KEITKNSRKVDTDIERILKETR**********ERLHRTYAVVDDMIFREAKKDQSFEQVSEKILATDRVRREIAEYEKK*******************************************************AKRQQQKICGPVVAMTFNFVVSVGIILTNKLVMGQVGFNFPIFLTVIHYAVAWILLAIFKAFSIIPVSPPAITTPFSSLFALGVVMSFATGLANTSLKHNSVGFYQMSKIAVTPTIVLAEFILFSKTISYKKVLALAIVSVGVAVATVTDLEFNIFGAIIAVAWIIPSAINKILWSNLQQQGNWTALALMWKTTPVTVFFLLALMPWLDPPGVLFYKWNLNNSSAIFISALLGFLLQWSGALALG
MISIPPSKRWRLTWFPLHDS**********************ESEVILLNSLKSGGVSIPADVSSIKDLTSETLVSICGQSLNLIFNTMTFGTSLPHSMAEKFKICTDISSAIKNLGYIGDISYYKFLYPSEEDLYKLIRFLVERLSELPKKVKVADGKGVDVRGNINKSTLEGNGETDLDHQKIRDQLEECRLE**********************QDYNKNDVTGVIRGKIKNHADNLQNRDESLMEAVTAKTSELCDPEEEYQLLKAAAEMAFDDSHPTEFYLEQLDEQVGAKKHNLVELELQWDALKESLEEKKRSLEESLYANELEAQAKLLKLREVELERQSVLSEIRKREDEYSKLSADLEKQPKVASRRSYIERIKEITKNSRKVDTDIERILKETRELQLESNSIQERLHRTYAVVDDMIFREAKKDQSFEQVSEKILATDRVRREIAEYEKKLAAVASRSLNVDKLQADVDVIMKENEFLEQQFHRDGRALEEIRGALYNEIRT*********KICGPVVAMTFNFVVSVGIILTNKLVMGQVGFNFPIFLTVIHYAVAWILLAIFKAFSIIPVSPPAITTPFSSLFALGVVMSFATGLANTSLKHNSVGFYQMSKIAVTPTIVLAEFILFSKTISYKKVLALAIVSVGVAVATVTDLEFNIFGAIIAVAWIIPSAINKILWSNLQQQGNWTALALMWKTTPVTVFFLLALMPWLDPPGVLFYKWNLNNSSAIFISALLGFLLQWSGALALG
*ISIPPSKRWRLTWFPLHDS***A********************E*IL*NSLKSGGVSIPADVSSIKDLTSETLVSICGQSLNLIFNTMTFGTSLPHSMAEKFKICTDISSAIKNLGYIGDISYYKFLYPSEEDLYKLIRFLVERLSELPKKVKVAD*KGVDVRGNIN*********TDLDHQKIRDQLEECR*****************************NDVTGVIRGKIKNHADNLQNRDESLMEAVTAKTSELCDPEEEYQLLKAAAEMAFDDSHPTEFYLEQLDEQVGAKKHNLVELELQWDALKESLEEKKRSLEESLYANELEAQAKLLKLREVELERQSVLSEIRKREDEYSKLSADLEKQPKVASRRSYIERIKEITKNSRKVDTDIERILKETRELQLESNSIQERLHRTYAVVDDMIFREAKKDQSFEQVSEKILATDRVRREIAEYEKKLAAVASRSLNVDKLQADVDVIMKENEFLEQQFHRDGRALEEIRGALYNEIRTSDGAKRQQQKICGPVVAMTFNFVVSVGIILTNKLVMGQVGFNFPIFLTVIHYAVAWILLAIFKAFSIIPVSPPAITTPFSSLFALGVVMSFATGLANTSLKHNSVGFYQMSKIAVTPTIVLAEFILFSKTISYKKVLALAIVSVGVAVATVTDLEFNIFGAIIAVAWIIPSAINKILWSNLQQQGNWTALALMWKTTPVTVFFLLALMPWLDPPGVLFYKWNLNNSSAIFISALLGFLLQWSGALALG
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHi
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHi
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISIPPSKRWRLTWFPLHDSRNKAKARRTRKQERRKTQSKMEESEVILLNSLKSGGVSIPADVSSIKDLTSETLVSICGQSLNLIFNTMTFGTSLPHSMAEKFKICTDISSAIKNLGYIGDISYYKFLYPSEEDLYKLIRFLVERLSELPKKVKVADGKGVDVRGNINKSTLEGNGETDLDHQKIRDQLEECRLENELPQSSNSEDVASDSVSSSRVQDYNKNDVTGVIRGKIKNHADNLQNRDESLMEAVTAKTSELCDPEEEYQLLKAAAEMAFDDSHPTEFYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPKVASRRSYIERIKEITKNSRKVDTDxxxxxxxxxxxxxxxxxxxxxLHRTYAVVDDMIFREAKKDQSFEQVSEKILAxxxxxxxxxxxxxxxxxxxxxSLNxxxxxxxxxxxxxxxxxxxxxFHRDGRALEEIRGALYNEIRTSDGAKRQQQKICGPVVAMTFNFVVSVGIILTNKLVMGQVGFNFPIFLTVIHYAVAWILLAIFKAFSIIPVSPPAITTPFSSLFALGVVMSFATGLANTSLKHNSVGFYQMSKIAVTPTIVLAEFILFSKTISYKKVLALAIVSVGVAVATVTDLEFNIFGAIIAVAWIIPSAINKILWSNLQQQGNWTALALMWKTTPVTVFFLLALMPWLDPPGVLFYKWNLNNSSAIFISALLGFLLQWSGALALG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query762 2.2.26 [Sep-21-2011]
Q8RXL8 357 Uncharacterized membrane no no 0.276 0.591 0.297 5e-20
P86182627 Coiled-coil domain-contai yes no 0.259 0.315 0.308 2e-18
Q9JIG7627 Coiled-coil domain-contai yes no 0.259 0.315 0.308 4e-18
O60826627 Coiled-coil domain-contai yes no 0.253 0.307 0.301 7e-18
A7RNG8644 Coiled-coil domain-contai N/A no 0.311 0.368 0.293 3e-16
Q1RMI8595 Coiled-coil domain-contai yes no 0.139 0.178 0.379 1e-15
Q28G12632 Coiled-coil domain-contai no no 0.139 0.167 0.388 2e-15
Q54MP2637 Coiled-coil domain-contai yes no 0.300 0.359 0.273 2e-15
B0WTU5571 Coiled-coil domain-contai N/A no 0.279 0.373 0.275 7e-15
Q4V909639 Coiled-coil domain-contai yes no 0.259 0.309 0.294 2e-14
>sp|Q8RXL8|Y1689_ARATH Uncharacterized membrane protein At1g06890 OS=Arabidopsis thaliana GN=At1g06890 PE=1 SV=1 Back     alignment and function desciption
 Score =  100 bits (249), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 67/225 (29%), Positives = 115/225 (51%), Gaps = 14/225 (6%)

Query: 545 TNKLVMGQVGFNFPIFLTVIHYAVAWILLAI---FKAFSIIPVSPPAITTPFSSLFALGV 601
            NK ++  +GF F   LT  H  V +  L +    K F   P  P A+          G+
Sbjct: 28  CNKALISTLGFTFATTLTSWHLLVTFCSLHVALWMKMFEHKPFDPRAV-------MGFGI 80

Query: 602 VMSFATGLANTSLKHNSVGFYQMSKIAVTPTIVLAEFILFSKTISYKKVLALAIVSVGVA 661
           +   + GL N SL  NSVGFYQM+K+A+ P  VL E + F K  S K   +L I+ +GV 
Sbjct: 81  LNGISIGLLNLSLGFNSVGFYQMTKLAIIPCTVLLETLFFRKKFSRKIQFSLTILLLGVG 140

Query: 662 VATVTDLEFNIFGAIIAVAWIIPSAINKILWSNLQQQGNWTALALMWKTTPVTVFFLLAL 721
           +ATVTDL+ N+ G+++++  ++ + + +I+ + +Q++   ++  L++++ P     L   
Sbjct: 141 IATVTDLQLNMLGSVLSLLAVVTTCVAQIMTNTIQKKFKVSSTQLLYQSCPYQAITLFVT 200

Query: 722 MPWLDP----PGVLFYKWNLNNSSAIFISALLGFLLQWSGALALG 762
            P+LD       V  +K+       I +S L+   + +S  L +G
Sbjct: 201 GPFLDGLLTNQNVFAFKYTSQVVFFIVLSCLISVSVNFSTFLVIG 245





Arabidopsis thaliana (taxid: 3702)
>sp|P86182|CCD22_RAT Coiled-coil domain-containing protein 22 OS=Rattus norvegicus GN=Ccdc22 PE=1 SV=2 Back     alignment and function description
>sp|Q9JIG7|CCD22_MOUSE Coiled-coil domain-containing protein 22 OS=Mus musculus GN=Ccdc22 PE=1 SV=1 Back     alignment and function description
>sp|O60826|CCD22_HUMAN Coiled-coil domain-containing protein 22 OS=Homo sapiens GN=CCDC22 PE=1 SV=1 Back     alignment and function description
>sp|A7RNG8|CCD22_NEMVE Coiled-coil domain-containing protein 22 homolog OS=Nematostella vectensis GN=v1g180167 PE=3 SV=1 Back     alignment and function description
>sp|Q1RMI8|CCD22_BOVIN Coiled-coil domain-containing protein 22 OS=Bos taurus GN=CCDC22 PE=2 SV=1 Back     alignment and function description
>sp|Q28G12|CCD22_XENTR Coiled-coil domain-containing protein 22 OS=Xenopus tropicalis GN=ccdc22 PE=2 SV=1 Back     alignment and function description
>sp|Q54MP2|CCD22_DICDI Coiled-coil domain-containing protein 22 homolog OS=Dictyostelium discoideum GN=DDB_G0285813 PE=3 SV=1 Back     alignment and function description
>sp|B0WTU5|CCD22_CULQU Coiled-coil domain-containing protein 22 homolog OS=Culex quinquefasciatus GN=CPIJ010681 PE=3 SV=1 Back     alignment and function description
>sp|Q4V909|CCD22_DANRE Coiled-coil domain-containing protein 22 OS=Danio rerio GN=ccdc22 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query762
255563588472 conserved hypothetical protein [Ricinus 0.580 0.936 0.575 1e-138
225461989545 PREDICTED: coiled-coil domain-containing 0.601 0.840 0.516 1e-134
449461055394 PREDICTED: uncharacterized membrane prot 0.353 0.682 0.821 1e-133
449461057385 PREDICTED: uncharacterized membrane prot 0.347 0.688 0.833 1e-132
15241097398 Nucleotide/sugar transporter family prot 0.347 0.665 0.830 1e-131
21593061397 unknown [Arabidopsis thaliana] 0.347 0.667 0.830 1e-131
116831615399 unknown [Arabidopsis thaliana] 0.347 0.664 0.830 1e-131
255563586389 organic anion transporter, putative [Ric 0.347 0.681 0.807 1e-130
297796471398 hypothetical protein ARALYDRAFT_495677 [ 0.347 0.665 0.822 1e-130
225461987383 PREDICTED: uncharacterized membrane prot 0.347 0.691 0.784 1e-124
>gi|255563588|ref|XP_002522796.1| conserved hypothetical protein [Ricinus communis] gi|223538034|gb|EEF39647.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  498 bits (1283), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 271/471 (57%), Positives = 351/471 (74%), Gaps = 29/471 (6%)

Query: 47  ILLNSLKSGGVSIPADVSSIKDLTSETLVSICGQSLNLIFNTMTFGTSLPHSMAEKFKIC 106
           ILL SL++ GVS+P +VSSI+D+  ETLVSI  Q LNL+  T TF +S P S+ +KFKIC
Sbjct: 5   ILLKSLQNAGVSVPGNVSSIRDMKPETLVSISAQCLNLLDQTTTFPSSFPDSLVDKFKIC 64

Query: 107 TDISSAIKNLGYIGDISYYKFLYPSEEDLYKLIRFLVERLSELPKKVKVADGKGVDV--- 163
           TDI+ A+K LGYIGD++YYKFLYPSEEDL+KL+RFLVERLSEL   VK+ D K ++    
Sbjct: 65  TDIALAVKRLGYIGDMTYYKFLYPSEEDLFKLVRFLVERLSELSNAVKIPDLKDMNAIRI 124

Query: 164 ---RGNIN--KSTLEGNGETDLDHQKIRDQLEECRLENELPQSSNSEDVASDSVSSSRVQ 218
               G+ +  K  +E   +  LD    ++ L++  L+N  P+ S+  +V + S + SR  
Sbjct: 125 IKKDGSTDNLKDYMEKANDKGLDCNHHQENLKDLGLQNVEPEFSDP-NVDNASFTGSRTL 183

Query: 219 DYNKNDVTGVIRGKIKNHADNLQNRDESLMEAVTAKTSELCDPEEEYQLLKAAAEMAFDD 278
            + K+ +TG     I + ++ LQN+ + L+E VTA+ SE+ + EEE+QLLKAA+EMAFDD
Sbjct: 184 SFGKDKLTG-----IADESEILQNQKKFLIEEVTARISEIQNLEEEFQLLKAASEMAFDD 238

Query: 279 SHPTEFYLEQLDEQVGAKKHNLVELELQWDALKESLEEKKRSLEESLYANELEAQAKLLK 338
            HP +FYLEQL++QV ++K N++EL+ QWDA ++ LEEKK SLEESLYAN  EA+ KL K
Sbjct: 239 QHPIDFYLEQLNDQVDSRKLNIMELDSQWDAFRKPLEEKKISLEESLYANIPEAREKLQK 298

Query: 339 LREVELERQSVLSEIRKREDEYSKLSADLEKQPKVASRRSYIERIKEITKNSRKVDTDIE 398
           LREVELER+S+LSEIR REDE+SKLS DL+KQ  + SR SYIERIKEITKNSRK D DIE
Sbjct: 299 LREVELERESILSEIR-REDEHSKLSVDLKKQSGLPSRTSYIERIKEITKNSRKQDADIE 357

Query: 399 RILKETRELQLESNSIQERLHRTYAVVDDMIFREAKKD--------------QSFEQVSE 444
           RILKETRELQLESNSIQ+RLHRTY V+D+++FREAKK+              + FEQ+SE
Sbjct: 358 RILKETRELQLESNSIQDRLHRTYTVLDELVFREAKKEPVGRQAYRLLTSIHECFEQISE 417

Query: 445 KILATDRVRREIAEYEKKLAAVASRSLNVDKLQADVDVIMKENEFLEQQFH 495
           KIL TDR++RE+ E+EKKL A+A+RSLN+DKLQAD+D I KENE L+QQ  
Sbjct: 418 KILLTDRIQREMVEHEKKLTAMATRSLNIDKLQADLDAIRKENENLQQQLQ 468




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225461989|ref|XP_002267477.1| PREDICTED: coiled-coil domain-containing protein 22 [Vitis vinifera] gi|296089961|emb|CBI39780.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449461055|ref|XP_004148259.1| PREDICTED: uncharacterized membrane protein At1g06890-like isoform 1 [Cucumis sativus] gi|449515193|ref|XP_004164634.1| PREDICTED: uncharacterized membrane protein At1g06890-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449461057|ref|XP_004148260.1| PREDICTED: uncharacterized membrane protein At1g06890-like isoform 2 [Cucumis sativus] gi|449515195|ref|XP_004164635.1| PREDICTED: uncharacterized membrane protein At1g06890-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|15241097|ref|NP_200406.1| Nucleotide/sugar transporter family protein [Arabidopsis thaliana] gi|9758215|dbj|BAB08660.1| unnamed protein product [Arabidopsis thaliana] gi|91807050|gb|ABE66252.1| transporter-like [Arabidopsis thaliana] gi|110740390|dbj|BAF02090.1| hypothetical protein [Arabidopsis thaliana] gi|332009319|gb|AED96702.1| Nucleotide/sugar transporter family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21593061|gb|AAM65010.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|116831615|gb|ABK28760.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255563586|ref|XP_002522795.1| organic anion transporter, putative [Ricinus communis] gi|223538033|gb|EEF39646.1| organic anion transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297796471|ref|XP_002866120.1| hypothetical protein ARALYDRAFT_495677 [Arabidopsis lyrata subsp. lyrata] gi|297311955|gb|EFH42379.1| hypothetical protein ARALYDRAFT_495677 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225461987|ref|XP_002267430.1| PREDICTED: uncharacterized membrane protein At1g06890 [Vitis vinifera] gi|296089960|emb|CBI39779.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query762
TAIR|locus:2178373 398 AT5G55950 [Arabidopsis thalian 0.347 0.665 0.830 4.7e-119
TAIR|locus:2175569390 AT5G57100 "AT5G57100" [Arabido 0.372 0.728 0.6 2.7e-93
UNIPROTKB|O60826627 CCDC22 "Coiled-coil domain-con 0.343 0.417 0.267 5.8e-32
MGI|MGI:1859608627 Ccdc22 "coiled-coil domain con 0.313 0.381 0.280 7e-32
UNIPROTKB|A7RNG8644 v1g180167 "Coiled-coil domain- 0.334 0.395 0.266 4.3e-31
UNIPROTKB|Q28G12632 ccdc22 "Coiled-coil domain-con 0.313 0.378 0.248 3.7e-30
UNIPROTKB|Q6PA15632 ccdc22 "Coiled-coil domain-con 0.265 0.319 0.261 3.3e-28
ZFIN|ZDB-GENE-050913-93639 ccdc22 "coiled-coil domain con 0.316 0.377 0.267 5.5e-27
UNIPROTKB|B0WTU5571 CPIJ010681 "Coiled-coil domain 0.312 0.416 0.269 5.9e-27
TAIR|locus:2033097 357 AT1G06890 [Arabidopsis thalian 0.311 0.663 0.301 1.3e-25
TAIR|locus:2178373 AT5G55950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1172 (417.6 bits), Expect = 4.7e-119, P = 4.7e-119
 Identities = 220/265 (83%), Positives = 249/265 (93%)

Query:   498 GRALEEIRGALYNEIRTSDGAKRQQQKICGPVVAMTFNFVVSVGIILTNKLVMGQVGFNF 557
             GRALEE+R +LYNE++TS+GAKRQQQ+ CGPVVAM+FNFVV+VGIIL NKLVMG+VGFNF
Sbjct:    27 GRALEELRSSLYNELKTSEGAKRQQQRFCGPVVAMSFNFVVAVGIILANKLVMGRVGFNF 86

Query:   558 PIFLTVIHYAVAWILLAIFKAFSIIPVSPPAITTPFSSLFALGVVMSFATGLANTSLKHN 617
             PIFLT+IHY VAWILLA FK+ S++P+SPP+ TTPFSSLF+LG VM+FA+GLANTSLKHN
Sbjct:    87 PIFLTLIHYTVAWILLAFFKSLSLLPMSPPSKTTPFSSLFSLGAVMAFASGLANTSLKHN 146

Query:   618 SVGFYQMSKIAVTPTIVLAEFILFSKTISYKKVLALAIVSVGVAVATVTDLEFNIFGAII 677
             SVGFYQM+KIAVTPTIVLAEF+LF KTIS  KV+ALA+VS+GVA+ATVTDLEFN+FGA++
Sbjct:   147 SVGFYQMAKIAVTPTIVLAEFVLFKKTISSTKVMALAVVSLGVAIATVTDLEFNLFGALV 206

Query:   678 AVAWIIPSAINKILWSNLQQQGNWTALALMWKTTPVTVFFLLALMPWLDPPGVLFYKWNL 737
             AVAWIIPSAINKILWSNLQQQ NWTALALMWKTTP TVFFLLALMPWLDPPGVL +KW+L
Sbjct:   207 AVAWIIPSAINKILWSNLQQQANWTALALMWKTTPFTVFFLLALMPWLDPPGVLLFKWDL 266

Query:   738 NNSSAIFISALLGFLLQWSGALALG 762
              NSSAI ISALLGFLLQWSGALALG
Sbjct:   267 TNSSAILISALLGFLLQWSGALALG 291




GO:0055085 "transmembrane transport" evidence=IEA
GO:0016020 "membrane" evidence=ISS
TAIR|locus:2175569 AT5G57100 "AT5G57100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O60826 CCDC22 "Coiled-coil domain-containing protein 22" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1859608 Ccdc22 "coiled-coil domain containing 22" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|A7RNG8 v1g180167 "Coiled-coil domain-containing protein 22 homolog" [Nematostella vectensis (taxid:45351)] Back     alignment and assigned GO terms
UNIPROTKB|Q28G12 ccdc22 "Coiled-coil domain-containing protein 22" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q6PA15 ccdc22 "Coiled-coil domain-containing protein 22" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050913-93 ccdc22 "coiled-coil domain containing 22" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|B0WTU5 CPIJ010681 "Coiled-coil domain-containing protein 22 homolog" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms
TAIR|locus:2033097 AT1G06890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query762
pfam05667536 pfam05667, DUF812, Protein of unknown function (DU 3e-35
pfam05667536 pfam05667, DUF812, Protein of unknown function (DU 5e-24
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 3e-09
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-08
TIGR00817302 TIGR00817, tpt, Tpt phosphate/phosphoenolpyruvate 2e-07
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-06
TIGR00618 1042 TIGR00618, sbcc, exonuclease SbcC 1e-06
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-06
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-06
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-05
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 8e-05
COG4372499 COG4372, COG4372, Uncharacterized protein conserve 1e-04
COG0697292 COG0697, RhaT, Permeases of the drug/metabolite tr 1e-04
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-04
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 2e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 4e-04
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 5e-04
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 5e-04
pfam05622713 pfam05622, HOOK, HOOK protein 5e-04
cd06550261 cd06550, TM_ABC_iron-siderophores_like, Transmembr 5e-04
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 7e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.001
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 0.001
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
pfam121281198 pfam12128, DUF3584, Protein of unknown function (D 0.002
COG4942420 COG4942, COG4942, Membrane-bound metallopeptidase 0.002
pfam08449303 pfam08449, UAA, UAA transporter family 0.003
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 0.003
PRK05771 646 PRK05771, PRK05771, V-type ATP synthase subunit I; 0.003
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 0.004
>gnl|CDD|218681 pfam05667, DUF812, Protein of unknown function (DUF812) Back     alignment and domain information
 Score =  140 bits (355), Expect = 3e-35
 Identities = 79/249 (31%), Positives = 133/249 (53%), Gaps = 22/249 (8%)

Query: 229 IRGKIKNHADNLQNRDESLMEAVTAKTSELCDPEEEYQLLKAAAEMAFDDSHPTEFYLEQ 288
           +  +IK  A  ++  +E L   V  +  EL   EEEY++ K   E+  D  +     + +
Sbjct: 289 VLSEIKALASKIKQVNEEL-TTVRQENEEL---EEEYKIKKRTVELLPDAENN----VAK 340

Query: 289 LDEQVGAKKHNLVELELQWDALKESLEEKKRSLEESLYANELEAQAKLLKLREVELERQS 348
           L   V A    L+EL  QW+A +  L ++ RSL+E     E E Q +L +++++  + + 
Sbjct: 341 LQALVVASSERLLELAQQWEAHRTPLIDEYRSLKEKNRNKEDETQRQLDEIKKLRNKIEE 400

Query: 349 VLSEIRKREDEYSKLSADLEKQPKVASRRSYIERIKEITKNSRKVDTDIERILKETRELQ 408
           + SE++ +E  Y +L  + E  PK  SR +Y  RI EI KN +K   DI++IL +TR LQ
Sbjct: 401 LESELQTKEQLYKQLLDEYENAPKSVSRSAYTRRILEIIKNIKKQKEDIDKILSDTRSLQ 460

Query: 409 LESNSIQERLHRTYAVVDDMIFREAKKDQS--------------FEQVSEKILATDRVRR 454
            E N+I  +L RT+ V D+++FR+AKKD+                 ++ E +  T  ++R
Sbjct: 461 KEINNITGKLDRTFTVTDELLFRDAKKDEHAKKAYKLLAALHENCSELIETVEETGNIKR 520

Query: 455 EIAEYEKKL 463
           EI + E+++
Sbjct: 521 EIRDLEEQI 529


This family consists of several eukaryotic proteins of unknown function. Length = 536

>gnl|CDD|218681 pfam05667, DUF812, Protein of unknown function (DUF812) Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|129898 TIGR00817, tpt, Tpt phosphate/phosphoenolpyruvate translocator Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>gnl|CDD|223769 COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|218661 pfam05622, HOOK, HOOK protein Back     alignment and domain information
>gnl|CDD|119348 cd06550, TM_ABC_iron-siderophores_like, Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+ Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) Back     alignment and domain information
>gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|219846 pfam08449, UAA, UAA transporter family Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|235600 PRK05771, PRK05771, V-type ATP synthase subunit I; Validated Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 762
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 100.0
KOG1937521 consensus Uncharacterized conserved protein [Funct 100.0
KOG1441316 consensus Glucose-6-phosphate/phosphate and phosph 100.0
KOG1444314 consensus Nucleotide-sugar transporter VRG4/SQV-7 99.96
KOG1443349 consensus Predicted integral membrane protein [Fun 99.96
PTZ00343350 triose or hexose phosphate/phosphate translocator; 99.95
TIGR00817302 tpt Tpt phosphate/phosphoenolpyruvate translocator 99.93
KOG1442347 consensus GDP-fucose transporter [Carbohydrate tra 99.89
COG5070309 VRG4 Nucleotide-sugar transporter [Carbohydrate tr 99.87
PF08449303 UAA: UAA transporter family; InterPro: IPR013657 T 99.83
KOG1582367 consensus UDP-galactose transporter related protei 99.56
KOG1581327 consensus UDP-galactose transporter related protei 99.55
PF06027334 DUF914: Eukaryotic protein of unknown function (DU 99.54
KOG1580337 consensus UDP-galactose transporter related protei 99.48
TIGR00950260 2A78 Carboxylate/Amino Acid/Amine Transporter. 99.44
PLN00411358 nodulin MtN21 family protein; Provisional 99.41
PRK11453299 O-acetylserine/cysteine export protein; Provisiona 99.35
PF04142244 Nuc_sug_transp: Nucleotide-sugar transporter; Inte 99.34
PRK11272292 putative DMT superfamily transporter inner membran 99.3
PRK11689295 aromatic amino acid exporter; Provisional 99.26
PRK15430296 putative chloramphenical resistance permease RarD; 99.17
TIGR00688256 rarD rarD protein. This uncharacterized protein is 99.14
KOG2234345 consensus Predicted UDP-galactose transporter [Car 99.14
PRK10532293 threonine and homoserine efflux system; Provisiona 99.13
COG0697292 RhaT Permeases of the drug/metabolite transporter 99.04
KOG3912 372 consensus Predicted integral membrane protein [Gen 98.97
KOG1583330 consensus UDP-N-acetylglucosamine transporter [Car 98.92
KOG2765416 consensus Predicted membrane protein [Function unk 98.84
TIGR03340281 phn_DUF6 phosphonate utilization associated putati 98.84
PF03151153 TPT: Triose-phosphate Transporter family; InterPro 98.81
TIGR00776290 RhaT RhaT L-rhamnose-proton symporter family prote 98.59
PF00892126 EamA: EamA-like transporter family; InterPro: IPR0 98.53
KOG4510346 consensus Permease of the drug/metabolite transpor 98.34
COG5006292 rhtA Threonine/homoserine efflux transporter [Amin 98.22
KOG2766336 consensus Predicted membrane protein [Function unk 98.15
COG2962293 RarD Predicted permeases [General function predict 98.14
PF13536113 EmrE: Multidrug resistance efflux transporter 98.11
KOG4314290 consensus Predicted carbohydrate/phosphate translo 98.09
COG2510140 Predicted membrane protein [Function unknown] 97.83
TIGR00950260 2A78 Carboxylate/Amino Acid/Amine Transporter. 97.76
PLN00411358 nodulin MtN21 family protein; Provisional 97.65
PF03151153 TPT: Triose-phosphate Transporter family; InterPro 97.6
TIGR00803222 nst UDP-galactose transporter. NSTs generally appe 97.58
PRK15051111 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl 97.54
PRK11272292 putative DMT superfamily transporter inner membran 97.53
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 97.05
PRK10532293 threonine and homoserine efflux system; Provisiona 97.03
PHA02562562 46 endonuclease subunit; Provisional 96.97
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 96.96
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 96.95
PRK11689295 aromatic amino acid exporter; Provisional 96.91
PRK10452120 multidrug efflux system protein MdtJ; Provisional 96.9
PRK11453299 O-acetylserine/cysteine export protein; Provisiona 96.84
COG11961163 Smc Chromosome segregation ATPases [Cell division 96.83
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 96.82
PRK02224 880 chromosome segregation protein; Provisional 96.81
TIGR00817302 tpt Tpt phosphate/phosphoenolpyruvate translocator 96.78
PF06800269 Sugar_transport: Sugar transport protein; InterPro 96.77
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 96.75
PRK03918 880 chromosome segregation protein; Provisional 96.74
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 96.68
KOG09331174 consensus Structural maintenance of chromosome pro 96.67
PHA02562562 46 endonuclease subunit; Provisional 96.66
PRK02224880 chromosome segregation protein; Provisional 96.63
PRK10650109 multidrug efflux system protein MdtI; Provisional 96.61
COG2076106 EmrE Membrane transporters of cations and cationic 96.6
PRK02971129 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl 96.6
PRK11431105 multidrug efflux system protein; Provisional 96.53
TIGR006061311 rad50 rad50. This family is based on the phylogeno 96.51
PRK01156895 chromosome segregation protein; Provisional 96.49
PRK11637428 AmiB activator; Provisional 96.47
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 96.47
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 96.45
PRK15430296 putative chloramphenical resistance permease RarD; 96.45
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 96.44
PTZ00343350 triose or hexose phosphate/phosphate translocator; 96.42
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 96.39
TIGR03340281 phn_DUF6 phosphonate utilization associated putati 96.39
PF14662193 CCDC155: Coiled-coil region of CCDC155 96.36
KOG4673961 consensus Transcription factor TMF, TATA element m 96.31
PRK09541110 emrE multidrug efflux protein; Reviewed 96.31
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 96.25
PRK03918 880 chromosome segregation protein; Provisional 96.18
COG0697292 RhaT Permeases of the drug/metabolite transporter 96.14
PF06027334 DUF914: Eukaryotic protein of unknown function (DU 96.11
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 96.07
PRK01156895 chromosome segregation protein; Provisional 96.01
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 95.93
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 95.93
KOG09331174 consensus Structural maintenance of chromosome pro 95.86
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 95.85
PF135141111 AAA_27: AAA domain 95.75
PRK11637428 AmiB activator; Provisional 95.72
PF08449303 UAA: UAA transporter family; InterPro: IPR013657 T 95.65
TIGR00776290 RhaT RhaT L-rhamnose-proton symporter family prote 95.56
PRK04778569 septation ring formation regulator EzrA; Provision 95.55
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 95.46
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 95.45
KOG09961293 consensus Structural maintenance of chromosome pro 95.37
PF10174775 Cast: RIM-binding protein of the cytomatrix active 95.13
PF05653300 Mg_trans_NIPA: Magnesium transporter NIPA; InterPr 95.01
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 94.84
KOG0996 1293 consensus Structural maintenance of chromosome pro 94.79
KOG0977546 consensus Nuclear envelope protein lamin, intermed 94.72
PF10174775 Cast: RIM-binding protein of the cytomatrix active 94.61
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 94.6
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 94.51
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 94.41
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 94.38
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 94.35
PF00038312 Filament: Intermediate filament protein; InterPro: 94.32
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 94.21
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 94.1
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 94.0
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 93.92
PF0089393 Multi_Drug_Res: Small Multidrug Resistance protein 93.89
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 93.8
PRK13499345 rhamnose-proton symporter; Provisional 93.78
PF04657138 DUF606: Protein of unknown function, DUF606; Inter 93.61
KOG2765416 consensus Predicted membrane protein [Function unk 93.58
PRK04778569 septation ring formation regulator EzrA; Provision 93.53
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 93.51
PF121281201 DUF3584: Protein of unknown function (DUF3584); In 93.48
PF00038312 Filament: Intermediate filament protein; InterPro: 93.41
KOG0971 1243 consensus Microtubule-associated protein dynactin 93.36
COG5185622 HEC1 Protein involved in chromosome segregation, i 93.26
COG4942420 Membrane-bound metallopeptidase [Cell division and 93.24
KOG0977546 consensus Nuclear envelope protein lamin, intermed 93.23
COG2962293 RarD Predicted permeases [General function predict 92.84
PF05701522 WEMBL: Weak chloroplast movement under blue light; 92.7
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 92.63
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 92.63
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 92.58
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 92.55
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 92.54
PF05010207 TACC: Transforming acidic coiled-coil-containing p 92.46
COG4942420 Membrane-bound metallopeptidase [Cell division and 92.46
PF15397258 DUF4618: Domain of unknown function (DUF4618) 92.44
PF10639113 UPF0546: Uncharacterised protein family UPF0546; I 92.42
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 92.42
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 92.36
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 92.35
KOG0964 1200 consensus Structural maintenance of chromosome pro 92.3
PRK04863 1486 mukB cell division protein MukB; Provisional 92.27
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 92.07
KOG0963629 consensus Transcription factor/CCAAT displacement 92.06
PRK09039343 hypothetical protein; Validated 91.91
PRK04863 1486 mukB cell division protein MukB; Provisional 91.89
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 91.89
PRK10884206 SH3 domain-containing protein; Provisional 91.63
TIGR00803222 nst UDP-galactose transporter. NSTs generally appe 91.41
KOG0964 1200 consensus Structural maintenance of chromosome pro 91.31
KOG2922 335 consensus Uncharacterized conserved protein [Funct 91.28
KOG0979 1072 consensus Structural maintenance of chromosome pro 91.19
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 90.89
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 90.71
TIGR01005754 eps_transp_fam exopolysaccharide transport protein 90.54
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 90.52
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 90.46
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 90.36
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 89.95
KOG4673961 consensus Transcription factor TMF, TATA element m 89.92
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 89.83
KOG4438446 consensus Centromere-associated protein NUF2 [Cell 89.54
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 89.42
TIGR03319514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 89.4
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 89.32
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 89.3
PF13514 1111 AAA_27: AAA domain 89.13
PRK10929 1109 putative mechanosensitive channel protein; Provisi 89.11
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 89.0
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 88.95
KOG45721424 consensus Predicted DNA-binding transcription fact 88.87
PF15397258 DUF4618: Domain of unknown function (DUF4618) 88.85
COG5006292 rhtA Threonine/homoserine efflux transporter [Amin 88.21
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 88.02
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 87.88
KOG1666220 consensus V-SNARE [Intracellular trafficking, secr 87.85
PF10186302 Atg14: UV radiation resistance protein and autopha 87.78
PF06800269 Sugar_transport: Sugar transport protein; InterPro 87.74
COG49131104 Uncharacterized protein conserved in bacteria [Fun 87.53
PF15556252 Zwint: ZW10 interactor 87.37
TIGR026801353 conserved hypothetical protein TIGR02680. Members 87.37
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 87.19
COG2510140 Predicted membrane protein [Function unknown] 87.06
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 86.63
PRK12704520 phosphodiesterase; Provisional 86.47
TIGR00634563 recN DNA repair protein RecN. All proteins in this 86.32
PF06730219 FAM92: FAM92 protein; InterPro: IPR009602 This fam 86.15
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 86.06
KOG3091508 consensus Nuclear pore complex, p54 component (sc 85.92
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 85.84
PF09744158 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte 85.58
PF05911769 DUF869: Plant protein of unknown function (DUF869) 85.47
PF03904230 DUF334: Domain of unknown function (DUF334); Inter 85.35
PF05884299 ZYG-11_interact: Interactor of ZYG-11; InterPro: I 85.31
TIGR01005754 eps_transp_fam exopolysaccharide transport protein 85.3
COG3238150 Uncharacterized protein conserved in bacteria [Fun 85.27
PRK00106535 hypothetical protein; Provisional 85.27
KOG1937521 consensus Uncharacterized conserved protein [Funct 84.96
PF06120301 Phage_HK97_TLTM: Tail length tape measure protein; 84.92
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 84.71
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 84.37
COG5185622 HEC1 Protein involved in chromosome segregation, i 84.11
PRK12705508 hypothetical protein; Provisional 83.9
KOG4421 637 consensus Uncharacterized conserved protein [Funct 83.68
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 83.56
PF13094160 CENP-Q: CENP-Q, a CENPA-CAD centromere complex sub 83.56
PRK00409782 recombination and DNA strand exchange inhibitor pr 83.5
PRK09343121 prefoldin subunit beta; Provisional 83.44
PF00892126 EamA: EamA-like transporter family; InterPro: IPR0 83.35
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 82.64
cd09238339 V_Alix_like_1 Protein-interacting V-domain of an u 82.42
COG0497557 RecN ATPase involved in DNA repair [DNA replicatio 82.37
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 82.33
PF10234267 Cluap1: Clusterin-associated protein-1; InterPro: 82.31
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 81.83
KOG1962216 consensus B-cell receptor-associated protein and r 81.73
PRK09841726 cryptic autophosphorylating protein tyrosine kinas 81.29
TIGR00844 810 c_cpa1 na(+)/h(+) antiporter. This model is specif 81.16
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 81.06
PRK09039343 hypothetical protein; Validated 81.02
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 80.84
PF0500879 V-SNARE: Vesicle transport v-SNARE protein N-termi 80.83
KOG0018 1141 consensus Structural maintenance of chromosome pro 80.68
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 80.54
KOG4593716 consensus Mitotic checkpoint protein MAD1 [Cell cy 80.39
KOG0018 1141 consensus Structural maintenance of chromosome pro 80.33
PF09762182 KOG2701: Coiled-coil domain-containing protein (DU 80.18
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 80.16
PF10186302 Atg14: UV radiation resistance protein and autopha 80.14
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
Probab=100.00  E-value=3.9e-102  Score=889.82  Aligned_cols=412  Identities=37%  Similarity=0.544  Sum_probs=354.6

Q ss_pred             hhhhhHHHHHhhhhcCCcccccccccccCChhHHHHHHhhhhhhhcCCC--CCCCCCChhHHHHHHhhHHHHHHHHhcCC
Q 041515           41 MEESEVILLNSLKSGGVSIPADVSSIKDLTSETLVSICGQSLNLIFNTM--TFGTSLPHSMAEKFKICTDISSAIKNLGY  118 (762)
Q Consensus        41 MeE~D~ii~~sl~~~g~~~~~~~~sl~~ftte~~v~~~~~cl~~I~p~~--~l~~~lP~~msaRfr~~~~lA~a~k~~Gy  118 (762)
                      |||||+||||+|+|+||+||+||+||++||||++|++||+|||+|||+.  ++|++||++||||||+||+||+|||++||
T Consensus         1 Mee~d~ii~~~L~~~g~~~~~~~~sl~~ft~e~~v~~~~~cL~~I~p~~~~~l~~~lP~~msaRfr~~~~lA~~~k~lGy   80 (594)
T PF05667_consen    1 MEEADEIIIHSLRQIGCDIPEDVQSLKQFTTELLVEAVVRCLRVIDPSLGSSLPRSLPPGMSARFRVGTSLAQACKELGY   80 (594)
T ss_pred             CcHHHHHHHHHHHHcCCcccCCcccHhhCCHHHHHHHHHHHHHHhCccccCCCcccCChHHHHHHHHHHHHHHHHHHcCC
Confidence            9999999999999999999999999999999999999999999999999  69999999999999999999999999999


Q ss_pred             CCCCcccccccCChHHHHHHHHHHHHHhcCCCccccccC------CCccccccccccccccCCCCccchhhHHHHHHh--
Q 041515          119 IGDISYYKFLYPSEEDLYKLIRFLVERLSELPKKVKVAD------GKGVDVRGNINKSTLEGNGETDLDHQKIRDQLE--  190 (762)
Q Consensus       119 ~~digy~tfLY~~~~dlr~l~~fLiekLp~~p~~~~~~~------~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~l~--  190 (762)
                      |||||||||||||++|+|++|||||||||++..+....+      |.+..+.++|              ++.++++|+  
T Consensus        81 ~~digyq~fLYp~e~~~R~ll~fLiekLP~~~~~~~~~~~~~~~~~~~~~l~~~i--------------~~~i~~~l~~p  146 (594)
T PF05667_consen   81 RGDIGYQTFLYPNEKDLRRLLMFLIEKLPRENTSSADSDASKQPVGKSALLQRSI--------------AQAIREQLKAP  146 (594)
T ss_pred             CCCCcchhhccCChHHHHHHHHHHHHHCCccccccccchhhhhhHHHHHHHHHHH--------------HHHHHhhccCC
Confidence            999999999999999999999999999966632222221      5566677777              688999987  


Q ss_pred             ----hhhhcc--------CCCCCC---CCccccccc--CCchhhhcccC---CCcc-------ccccchhhhchhhh---
Q 041515          191 ----ECRLEN--------ELPQSS---NSEDVASDS--VSSSRVQDYNK---NDVT-------GVIRGKIKNHADNL---  240 (762)
Q Consensus       191 ----~c~~~~--------~~~~~~---~~~~~~~~~--~~~~~~~~~~~---~~~~-------~~~~~~~~~~~~~l---  240 (762)
                          +||...        .++|+.   +.|...+..  ..+.++++|+.   ||||       +++||.+++|+..+   
T Consensus       147 wvP~~cr~~~~~~~~~~~~~~f~~~~~~~p~~~~~~~~~~~~~~~~~~~~~l~~v~~Q~~~~~~~~~SlLe~naa~l~~~  226 (594)
T PF05667_consen  147 WVPPFCRPTMRRKQGSSSLKRFHSQPLSIPFSTSGREKPSPKELQEYYSRYLPPVTAQPPQAASRAPSLLECNAAELSAA  226 (594)
T ss_pred             CCChhhcccccccCCCcccccccCCCceeecccCCCcCCCChhHHHHHHhhCCCccccccccchhhhhHHhhcHHHHhhc
Confidence                799332        234543   233222211  12345555544   4443       23344443333221   


Q ss_pred             --------------------------------------------------------------------------------
Q 041515          241 --------------------------------------------------------------------------------  240 (762)
Q Consensus       241 --------------------------------------------------------------------------------  240 (762)
                                                                                                      
T Consensus       227 ~~~~~e~~~~g~~e~~~~K~~~l~~~l~e~lr~~~~~~~~~~~~~~s~~dl~~~l~~~~~~~~~k~s~f~~~ek~~~~~~  306 (594)
T PF05667_consen  227 QEWENEWNSQGLEEYRKRKQQRLQKRLAEQLRQAASASSDNHFRASSSDDLADVLHKFSGEAWDKGSRFTHSEKPQEAAP  306 (594)
T ss_pred             cchhhccccccchhhhHHHHHHHHHHHHHHHHHhhcccccccccccchhHHHHHHHhccccccccccccccccchhhhhh
Confidence                                                                                            


Q ss_pred             ---------------------------hhHHHHH---------------------HHHHhhhhhcccCcHHHHHHHHHHH
Q 041515          241 ---------------------------QNRDESL---------------------MEAVTAKTSELCDPEEEYQLLKAAA  272 (762)
Q Consensus       241 ---------------------------~~~~~~l---------------------~~~~~~~~~~~~e~e~~~~~~~~~~  272 (762)
                                                 +.+++.+                     .+++++.+.+++++|+++.++++++
T Consensus       307 ~~~~~~~~~~~~~~~~~~~~~~el~~l~~~l~~l~~~i~~~~~~~~~l~~~~~q~~~e~~~~~~~~~~le~~~~l~~k~~  386 (594)
T PF05667_consen  307 AAAVVPPKEKETEEDEQEEQEQELEELQEQLDELESQIEELEAEIKMLKSSLKQLEEELEEKEAENEELEEELKLKKKTV  386 (594)
T ss_pred             ccccCCcccccchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence                                       0001111                     0222245567889999999999999


Q ss_pred             HHhcCCCCChhHHHHHHHHHHHHHhhHHHHHHHHHHHhhHHHHHHHHHHHHHHhhchHHHHHHHHHHHHHHHHHHHHHHH
Q 041515          273 EMAFDDSHPTEFYLEQLDEQVGAKKHNLVELELQWDALKESLEEKKRSLEESLYANELEAQAKLLKLREVELERQSVLSE  352 (762)
Q Consensus       273 e~l~d~~~~~~~n~~kL~~~~~~~~~~l~~L~~qWe~~r~pl~~~~~~l~~~~~~~~~e~~~k~~~ik~~~~~~~~~~~e  352 (762)
                      ++|+|    +++||+||+++|+++++||.+|++|||+||.||++|||+|+++.+++..|+++++++||++|++++++.+|
T Consensus       387 ~lL~d----~e~ni~kL~~~v~~s~~rl~~L~~qWe~~R~pL~~e~r~lk~~~~~~~~e~~~~~~~ik~~r~~~k~~~~e  462 (594)
T PF05667_consen  387 ELLPD----AEENIAKLQALVEASEQRLVELAQQWEKHRAPLIEEYRRLKEKASNRESESKQKLQEIKELREEIKEIEEE  462 (594)
T ss_pred             HHhcC----cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHhhcchHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999    99999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhHHHHHHHHHHHhcCCCccChHHHHHHHHHHHhhhhhhHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q 041515          353 IRKREDEYSKLSADLEKQPKVASRRSYIERIKEITKNSRKVDTDIERILKETRELQLESNSIQERLHRTYAVVDDMIFRE  432 (762)
Q Consensus       353 ~~~k~e~~~~L~~~~~~~~k~~~R~~Yt~RI~Eiv~nirKQ~~eI~Kil~dtr~lqkein~~~~~l~Rtf~v~delif~~  432 (762)
                      ++.|+++|+||+++|+++||++||++||+||+|||||||||++||+||+.|||+||||||+++|+|+|||+|+||+||+|
T Consensus       463 ~~~Kee~~~qL~~e~e~~~k~~~Rs~Yt~RIlEIv~NI~KQk~eI~KIl~DTr~lQkeiN~l~gkL~RtF~v~dElifrd  542 (594)
T PF05667_consen  463 IRQKEELYKQLVKELEKLPKDVNRSAYTRRILEIVKNIRKQKEEIEKILSDTRELQKEINSLTGKLDRTFTVTDELIFRD  542 (594)
T ss_pred             HHHHHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCccch--------------HHHHHHHHHHhhHHHHHHHHHHHHHHHHhccc
Q 041515          433 AKKDQS--------------FEQVSEKILATDRVRREIAEYEKKLAAVASRS  470 (762)
Q Consensus       433 akkd~~--------------~~~l~~~i~~tg~~~rei~~le~qi~~~~~k~  470 (762)
                      ||||++              |++||++|++||+++|||||||+||+++++||
T Consensus       543 AKkDe~~rkaYK~La~lh~~c~~Li~~v~~tG~~~rEirdLe~qI~~e~~kn  594 (594)
T PF05667_consen  543 AKKDEAARKAYKLLASLHENCSQLIETVEETGTISREIRDLEEQIDTESQKN  594 (594)
T ss_pred             hhcCHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHhcCC
Confidence            999994              99999999999999999999999999999986



>KOG1937 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1441 consensus Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter [Carbohydrate transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>KOG1444 consensus Nucleotide-sugar transporter VRG4/SQV-7 [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1443 consensus Predicted integral membrane protein [Function unknown] Back     alignment and domain information
>PTZ00343 triose or hexose phosphate/phosphate translocator; Provisional Back     alignment and domain information
>TIGR00817 tpt Tpt phosphate/phosphoenolpyruvate translocator Back     alignment and domain information
>KOG1442 consensus GDP-fucose transporter [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5070 VRG4 Nucleotide-sugar transporter [Carbohydrate transport and metabolism / Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>PF08449 UAA: UAA transporter family; InterPro: IPR013657 This family includes transporters with a specificity for UDP-N-acetylglucosamine [] Back     alignment and domain information
>KOG1582 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1581 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06027 DUF914: Eukaryotic protein of unknown function (DUF914); InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function Back     alignment and domain information
>KOG1580 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter Back     alignment and domain information
>PLN00411 nodulin MtN21 family protein; Provisional Back     alignment and domain information
>PRK11453 O-acetylserine/cysteine export protein; Provisional Back     alignment and domain information
>PF04142 Nuc_sug_transp: Nucleotide-sugar transporter; InterPro: IPR007271 This family of membrane proteins transport nucleotide sugars from the cytoplasm into golgi vesicles Back     alignment and domain information
>PRK11272 putative DMT superfamily transporter inner membrane protein; Provisional Back     alignment and domain information
>PRK11689 aromatic amino acid exporter; Provisional Back     alignment and domain information
>PRK15430 putative chloramphenical resistance permease RarD; Provisional Back     alignment and domain information
>TIGR00688 rarD rarD protein Back     alignment and domain information
>KOG2234 consensus Predicted UDP-galactose transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10532 threonine and homoserine efflux system; Provisional Back     alignment and domain information
>COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG3912 consensus Predicted integral membrane protein [General function prediction only] Back     alignment and domain information
>KOG1583 consensus UDP-N-acetylglucosamine transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2765 consensus Predicted membrane protein [Function unknown] Back     alignment and domain information
>TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein Back     alignment and domain information
>PF03151 TPT: Triose-phosphate Transporter family; InterPro: IPR004853 This family consists entirely of aligned regions from Drosophila melanogaster proteins Back     alignment and domain information
>TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein Back     alignment and domain information
>PF00892 EamA: EamA-like transporter family; InterPro: IPR000620 This domain is found in proteins including the Erwinia chrysanthemi PecM protein, which is involved in pectinase, cellulase and blue pigment regulation; and the Salmonella typhimurium PagO protein, the function of which is unknown Back     alignment and domain information
>KOG4510 consensus Permease of the drug/metabolite transporter (DMT) superfamily [General function prediction only] Back     alignment and domain information
>COG5006 rhtA Threonine/homoserine efflux transporter [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2766 consensus Predicted membrane protein [Function unknown] Back     alignment and domain information
>COG2962 RarD Predicted permeases [General function prediction only] Back     alignment and domain information
>PF13536 EmrE: Multidrug resistance efflux transporter Back     alignment and domain information
>KOG4314 consensus Predicted carbohydrate/phosphate translocator [General function prediction only] Back     alignment and domain information
>COG2510 Predicted membrane protein [Function unknown] Back     alignment and domain information
>TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter Back     alignment and domain information
>PLN00411 nodulin MtN21 family protein; Provisional Back     alignment and domain information
>PF03151 TPT: Triose-phosphate Transporter family; InterPro: IPR004853 This family consists entirely of aligned regions from Drosophila melanogaster proteins Back     alignment and domain information
>TIGR00803 nst UDP-galactose transporter Back     alignment and domain information
>PRK15051 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; Provisional Back     alignment and domain information
>PRK11272 putative DMT superfamily transporter inner membrane protein; Provisional Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PRK10532 threonine and homoserine efflux system; Provisional Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PRK11689 aromatic amino acid exporter; Provisional Back     alignment and domain information
>PRK10452 multidrug efflux system protein MdtJ; Provisional Back     alignment and domain information
>PRK11453 O-acetylserine/cysteine export protein; Provisional Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR00817 tpt Tpt phosphate/phosphoenolpyruvate translocator Back     alignment and domain information
>PF06800 Sugar_transport: Sugar transport protein; InterPro: IPR010651 This is a family of bacterial sugar transporters approximately 300 residues long Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK10650 multidrug efflux system protein MdtI; Provisional Back     alignment and domain information
>COG2076 EmrE Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK02971 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; Provisional Back     alignment and domain information
>PRK11431 multidrug efflux system protein; Provisional Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PRK15430 putative chloramphenical resistance permease RarD; Provisional Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PTZ00343 triose or hexose phosphate/phosphate translocator; Provisional Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>PRK09541 emrE multidrug efflux protein; Reviewed Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PF06027 DUF914: Eukaryotic protein of unknown function (DUF914); InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF08449 UAA: UAA transporter family; InterPro: IPR013657 This family includes transporters with a specificity for UDP-N-acetylglucosamine [] Back     alignment and domain information
>TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF05653 Mg_trans_NIPA: Magnesium transporter NIPA; InterPro: IPR008521 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00893 Multi_Drug_Res: Small Multidrug Resistance protein; InterPro: IPR000390 Members of this family which have been characterised, belong to the small multidrug resistance (Smr) protein family and are integral membrane proteins Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PRK13499 rhamnose-proton symporter; Provisional Back     alignment and domain information
>PF04657 DUF606: Protein of unknown function, DUF606; InterPro: IPR006750 This family contains uncharacterised bacterial proteins Back     alignment and domain information
>KOG2765 consensus Predicted membrane protein [Function unknown] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>COG2962 RarD Predicted permeases [General function prediction only] Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF15397 DUF4618: Domain of unknown function (DUF4618) Back     alignment and domain information
>PF10639 UPF0546: Uncharacterised protein family UPF0546; InterPro: IPR018908 This family of proteins has no known function Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>TIGR00803 nst UDP-galactose transporter Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2922 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4572 consensus Predicted DNA-binding transcription factor, interacts with stathmin [Transcription; General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>PF15397 DUF4618: Domain of unknown function (DUF4618) Back     alignment and domain information
>COG5006 rhtA Threonine/homoserine efflux transporter [Amino acid transport and metabolism] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1666 consensus V-SNARE [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF06800 Sugar_transport: Sugar transport protein; InterPro: IPR010651 This is a family of bacterial sugar transporters approximately 300 residues long Back     alignment and domain information
>COG4913 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF15556 Zwint: ZW10 interactor Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>COG2510 Predicted membrane protein [Function unknown] Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PF06730 FAM92: FAM92 protein; InterPro: IPR009602 This family consists of several eukaryotic sequences of around 270 residues in length Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>KOG3091 consensus Nuclear pore complex, p54 component (sc Nup57) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF03904 DUF334: Domain of unknown function (DUF334); InterPro: IPR005602 This is a family of proteins found in Staphylococcus aureus plasmid with no characterised function Back     alignment and domain information
>PF05884 ZYG-11_interact: Interactor of ZYG-11; InterPro: IPR008574 This family consists of proteins of unknown function found in Caenorhabditis species Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>COG3238 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>KOG1937 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>KOG4421 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>PF13094 CENP-Q: CENP-Q, a CENPA-CAD centromere complex subunit Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>PRK09343 prefoldin subunit beta; Provisional Back     alignment and domain information
>PF00892 EamA: EamA-like transporter family; InterPro: IPR000620 This domain is found in proteins including the Erwinia chrysanthemi PecM protein, which is involved in pectinase, cellulase and blue pigment regulation; and the Salmonella typhimurium PagO protein, the function of which is unknown Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>cd09238 V_Alix_like_1 Protein-interacting V-domain of an uncharacterized family of the V_Alix_like superfamily Back     alignment and domain information
>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>TIGR00844 c_cpa1 na(+)/h(+) antiporter Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF05008 V-SNARE: Vesicle transport v-SNARE protein N-terminus; InterPro: IPR007705 V-SNARE proteins are required for protein traffic between eukaryotic organelles Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09762 KOG2701: Coiled-coil domain-containing protein (DUF2037); InterPro: IPR019159 This entry represents a family of coiled-coil-containing proteins conserved from plants to vertebrates Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query762
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-08
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-07
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 9e-07
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 1e-05
1cii_A602 Colicin IA; bacteriocin, ION channel formation, tr 9e-06
2zuo_A861 MVP, major vault protein; repeat domains, protein- 1e-04
1s35_A214 Beta-I spectrin, spectrin beta chain, erythrocyte; 2e-04
1u4q_A322 Spectrin alpha chain, brain; alpha spectrin, three 5e-04
3kbt_A326 Beta-I spectrin, spectrin beta chain, erythrocyte; 6e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 64.9 bits (157), Expect = 7e-11
 Identities = 85/572 (14%), Positives = 170/572 (29%), Gaps = 163/572 (28%)

Query: 16  PLH-DSRNKAKARRTRKQERRKTQSKMEE---SEVILLNSLKSGGVSIPADVSSIKDLTS 71
            L+ D++  AK   +R Q   K +  + E   ++ +L++ +   G +          +  
Sbjct: 118 RLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTW---------VAL 168

Query: 72  ETLVSICGQSLNLIFNT--MTFGT-SLPHSMAEKF-KICTDISSAIKNLGYIGDISYYKF 127
           +  +S       + F    +     + P ++ E   K+   I     N     D S    
Sbjct: 169 DVCLSY-KVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQID---PNWTSRSDHSS-NI 223

Query: 128 LYPSEEDLYKLIRFLVERLSELPKKVKVADGKGVDVRGNINKSTLEGNGETDLDHQ-KI- 185
                    +L R L  +       + V      +V+   N            +   KI 
Sbjct: 224 KLRIHSIQAELRRLLKSK--PYENCLLVLL----NVQ---NAKAWNA-----FNLSCKIL 269

Query: 186 ---RDQ--------LEECRLENELPQSSNSEDVASD---SVSSSRVQDYNKNDVTG---- 227
              R +             +  +    + + D            R QD  +  +T     
Sbjct: 270 LTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRR 329

Query: 228 --VIRGKIKNHADNLQNRDESLMEAVTAKTSELC----DPEEEYQLLKAAAEMAF-DDSH 280
             +I   I++      N      + +T    E      +P E  ++    +   F   +H
Sbjct: 330 LSIIAESIRDGLATWDNWKHVNCDKLT-TIIESSLNVLEPAEYRKMFDRLS--VFPPSAH 386

Query: 281 -PTEFYLEQLDEQVGAKKHNLVELELQWDALKESLEEK------KRSLEE--------SL 325
            P           +         L L W  + +S          K SL E        S+
Sbjct: 387 IP---------TIL---------LSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISI 428

Query: 326 YANELEAQAKLLKLREVELERQSVLSEIRKREDEYSKLSA-DLEKQPKVASRR---SYIE 381
            +  LE + KL    E  L R  V        D Y+     D +        +   S+I 
Sbjct: 429 PSIYLELKVKLEN--EYALHRSIV--------DHYNIPKTFDSDDLIPPYLDQYFYSHIG 478

Query: 382 R-IKEITKNSRKVDTDIERILKETRELQLESNSIQERL-HRTYA------VVDDMI-FRE 432
             +K I ++  ++           R + L+   +++++ H + A      +++ +   + 
Sbjct: 479 HHLKNI-EHPERMT--------LFRMVFLDFRFLEQKIRHDSTAWNASGSILNTLQQLKF 529

Query: 433 AKKDQSFEQVSEKILATDRVRREIAEYEKKLAAVASRSLNVDKLQADVDVIMKENEFLEQ 492
            K       + +     +R+   I ++  K+      S   D L+               
Sbjct: 530 YKP-----YICDNDPKYERLVNAILDFLPKIEENLICSKYTDLLR--------------- 569

Query: 493 QFHRDGRALEEIRGALYNEIRTSDGAKRQQQK 524
                  AL     A++ E      A +Q Q+
Sbjct: 570 ------IALMAEDEAIFEE------AHKQVQR 589


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 Length = 602 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 Back     alignment and structure
>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 Back     alignment and structure
>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query762
2i68_A137 Protein EMRE; transmembrane protein, small-multidr 97.24
3b5d_A110 Multidrug transporter EMRE; helical membrane prote 97.23
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 96.8
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 95.9
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 95.83
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 94.48
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 94.02
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 93.56
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 93.46
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 93.4
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 92.65
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 92.65
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 92.4
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 92.22
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 91.67
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 90.21
2k48_A107 Nucleoprotein; viral protein; NMR {Andes virus} 86.7
3ghg_A562 Fibrinogen alpha chain; triple-stranded coiled coi 85.82
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 85.56
3zx6_A341 HAMP, methyl-accepting chemotaxis protein I; signa 84.2
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 82.82
1vcs_A102 Vesicle transport through interaction with T- snar 82.61
2ch7_A309 Methyl-accepting chemotaxis protein; receptor, fou 81.83
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 81.2
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 80.89
2qyw_A102 Vesicle transport through interaction with T-SNAR 80.54
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 80.47
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 80.07
>2i68_A Protein EMRE; transmembrane protein, small-multidrug resistance, transporter, homodimer, dual topology, transport protein; NMR {Escherichia coli} Back     alignment and structure
Probab=97.24  E-value=0.00042  Score=65.50  Aligned_cols=66  Identities=12%  Similarity=0.200  Sum_probs=45.4

Q ss_pred             HHHHHHHHHHHHhhhhcchhHHHHHH-HhhhHHHH-HHHHHHHhcccccHHHHHHHHHHHHhhheeeec
Q 041515          600 GVVMSFATGLANTSLKHNSVGFYQMS-KIAVTPTI-VLAEFILFSKTISYKKVLALAIVSVGVAVATVT  666 (762)
Q Consensus       600 gl~~~l~i~l~N~SL~yvsVs~~qml-Ksas~P~~-vll~~l~lgek~s~~~~lsLlli~~GV~la~~~  666 (762)
                      .++++++..+.+.++++++++....+ . ...|++ +++++++|||++++.++++++++++||++....
T Consensus        37 i~~~~ls~~l~~~alk~i~~s~ay~iw~-~l~pv~~~l~g~l~lgE~ls~~~~~Gi~LIi~GV~ll~~~  104 (137)
T 2i68_A           37 IICYCASFWLLAQTLAYIPTGIAYAIWS-GVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLL  104 (137)
T ss_dssp             HHHHHHHHHHHHHHHC-----CHHHHHH-HHHHHHHHHHHHHHHC------CHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHhCChhHHHHHHH-HHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHHHHhcC
Confidence            34577888999999999999976666 6 468875 788999999999999999999999999987653



>3b5d_A Multidrug transporter EMRE; helical membrane protein, multidrug resistance transporter, SMR, antiport, inner membrane, transmembrane; HET: P4P; 3.80A {Escherichia coli K12} PDB: 3b61_A 3b62_A* Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2k48_A Nucleoprotein; viral protein; NMR {Andes virus} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3zx6_A HAMP, methyl-accepting chemotaxis protein I; signaling, HAMP domain, TSR receptor, fusion; 2.65A {Archaeoglobus fulgidus} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>1vcs_A Vesicle transport through interaction with T- snares homolog 1A; HABC domain, VTI1, UP and DOWN three helix bundle, LEFT-handed twist; NMR {Mus musculus} SCOP: a.47.2.1 Back     alignment and structure
>2ch7_A Methyl-accepting chemotaxis protein; receptor, four-helix bundle, signal transduction, methyl-accepting receptor; 2.5A {Thermotoga maritima} SCOP: h.4.5.1 PDB: 2ch7_B Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>2qyw_A Vesicle transport through interaction with T-SNAR homolog; HABC domain, protein transport, endocytosis; 2.00A {Mus musculus} PDB: 2v8s_V Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query762
d2efla1288 Formin-binding protein 1, FNBP1 {Human (Homo sapie 80.87
>d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: BAR/IMD domain-like
superfamily: BAR/IMD domain-like
family: FCH domain
domain: Formin-binding protein 1, FNBP1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=80.87  E-value=22  Score=33.18  Aligned_cols=31  Identities=13%  Similarity=-0.057  Sum_probs=13.7

Q ss_pred             HHHHHHHHHhhHHHHHHHHHHHhhHHHHHHH
Q 041515          288 QLDEQVGAKKHNLVELELQWDALKESLEEKK  318 (762)
Q Consensus       288 kL~~~~~~~~~~l~~L~~qWe~~r~pl~~~~  318 (762)
                      .|...+....+....+..+|.+....+.+..
T Consensus       101 ~l~~~~~~~~~~~K~~~~~~~k~~k~~~~~~  131 (288)
T d2efla1         101 DLARYVQELKQERKSNFHDGRKAQQHIETCW  131 (288)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3444444444444444444444444444333