Citrus Sinensis ID: 041518

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-----
MASTLRRKPNDRSFILQSRLFSVSKSGCKSDDKQQRIEKILIANRGEIAYRIMRTAKRLGIRTVAVYSDADRDSLHVKSADEAIRIGPPPARLSYLNGSSIVDAAIRTGAQAIHPGYGFLSESADFAQLCGDNGLTFIGPPVSAIRDMGDKSASKRIMGAAGVPLVPGYHGNEQDIDLMKSEAAKIGYPILIKPTHGGGGKGMRIVQSPNDFVDSFLGAQREAAASFGINTILLEKYITQPRHIEVQIFGDKYGKVLHLYERDCSVQRRHQKIIEEAPAPNVTHDFRALLGQAAVSAAKAVSYHNAGTVEFIVDTVSDQFYFMEMNTRLQVEHPVTEMIVDQDLVEWQIRVANGEPLPLSQSEVPLLGHAFEARIYAENVPKGFLPATGVLHHYHPVPVSSKAVRVETGVEQGDTVSMHYDPMIANLWYGAKTVAGVPTNINFLQKLAKHRAFESGDVETHFIEQHKDELFVKPSQSVSAEMNSAARLSATLVAACIFEKEKSTLKESPPGNHCLLSIWYTDPPFRVHHHARRIMEFEWENEHDDSGSKLLTLTVTYQADGNYLIEMGEDGSYISEVKATYLGEHKFRVEFDVVSMDVHLAVYNKGRIKHIHAWHGLHHHHFKQKLGLELPDEDETQHKTSFETATGPPGSVLSPMAGLVVKVLANDGTKVEEGQPILVLEAMKMEHVVKAPTTGVVHGLQVTAGQQVSDGSVLFRLQAVHIQLAVHGFVVQFVQDNLIHSLVVCSFAFCSEFKFRVCRFCLFMT
ccccccccccccccccccccccccccccccccccccccEEEEEccHHHHHHHHHHHHHHcccEEEEEccccccccccccccccEEccccccccccccHHHHHHHHHHHcccEEccccccccccHHHHHHHHHcccEEEcccHHHHHHHHcHHHHHHHHHHcccccccccccccccHHHHHHHHccccccEEEEccccccccccccccccHHHHHHHHHHHHHHHHccccccEEEEEccccccEEEEEEEEcccccEEEEcccccHHcccccHHHHccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccEEEEEcccccccccccccccccHHHHHHHHHHHccccccccccccccccEEEEEEEccccccccccccccEEEEEEcccccccccEEccccccccccccccccHHHEEEEEccccccccccHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEEEccccccccccEEEEEEEEEccccEEEEEcccccEEEEEEEEEccccEEEEEEEEEEEEEEEEEEEcccEEEEEEEcccEEEEEEEEEEEEccccHHHcccccccccccccccEEcccccEEEEEEccccccccccccEEEEEEcccccEEccccccEEEEEEcccccccccccEEEEEEEcccccccccccccccccccccEEEEEEEccccccccEEEEEEEEcc
ccHHHHcccccHHHcccHHHHHHHccccccccccccccEEEEcccHHHHHHHHHHHHHHccEEEEEEEccccccHHHHHccEEEEEEcccHHHccccHHHHHHHHHHHcccEEEcccccccccHHHHHHHHHcccEEccccHHHHHHHHcHHHHHHHHHHHcccEccEcccccccHHHHHHHHHHHcccEEEEEccccccccEEEEccHHHHHHHHHHHHHHHHHHcccccEEEEEcccccEEEEEEEEEEccccEEEEEEEEEEEEEccEEEEEEEccccccHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEccEEEEEEEEEEccccccHHHHHHHHcccHHHHHHHHHccccccccHHHcccccEEEEEEEEEEccccccccccccEEEEcccccccccEEEccccccccEEEEcccHHHHEEEEEccccccccccHHHHHHHHccHHHHcccccccHHHHHcHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEcccccEEEEEEEEEcEEEcccccEEEEEEEEcccccEEEEEEccccEEEEEEEccccccEEEEEEccEEEEEEEEEEcccEEEEEEEcccEEEEEEEccEEEEcccHHHHHHHcccccccccccEEEcccccEEEEEEEccccEccccccEEEEEHHHHccEEEcccccEEEEEEEccccccccccEEEEEccccHHHHHHHHHHHHHHHHHHHEEEEEEEHEHcccEEEEEEEEEEcc
mastlrrkpndrsfiLQSRLFsvsksgcksddkQQRIEKILIANRGEIAYRIMRTAKRLGIRTvavysdadrdslhvksadeairigppparlsylngsSIVDAAIRTGaqaihpgygflsesADFAQLcgdngltfigppvsairdmgdksaskrimgaagvplvpgyhgneqdIDLMKSEaakigypilikpthggggkgmrivqspndfvDSFLGAQREAAASFGINTILLEKyitqprhieVQIFGDKYGKVLHLYERDCSVQRRHQKIieeapapnvthDFRALLGQAAVSAAKAVSYHNAGTVEFIVDTVSDQFYFMEMntrlqvehpvtemivDQDLVEWQIRvangeplplsqsevpllGHAFEARIyaenvpkgflpatgvlhhyhpvpvsskavrVETGveqgdtvsmhyDPMIANLWYGaktvagvptnINFLQKLAKHrafesgdvetHFIEQhkdelfvkpsqsvsaEMNSAARLSATLVAACIFEKekstlkesppgnhcllsiwytdppfrvhhHARRIMEFewenehddsgskLLTLTVTYQADGNYLIEMGEDGSYISEVKATYLGEHKFRVEFDVVSMDVHLAVYNKGRIKhihawhglhhhhfkqklglelpdedetqhktsfetatgppgsvlspmAGLVVKVLAndgtkveegqPILVLEAMKMEHvvkapttgvvhglqvtagqqvsdgSVLFRLQAVHIQLAVHGFVVQFVQDNLIHSLVVCSFAFCSEFKFRVCRFCLFMT
mastlrrkpndrsfilqsrlfsvsksgcksddkqqrIEKIlianrgeiayRIMRTAKRLGIRTVavysdadrdslhvksadeairigppparlSYLNGSSIVDAAIRTGAQAIHPGYGFLSESADFAQLCGDNGLTFIGPPVSAIRDMGDKSASKRIMGAAGVPLVPGYHGNEQDIDLMKSEAAKIGYPILIKPTHGGGGKGMRIVQSPNDFVDSFLGAQREAAASFGINTILLEKYITQPRHIEVQIFGDKYGKVLHLYERDCSVQRRHQKIIeeapapnvTHDFRALLGQAAVSAAKAVSYHNAGTVEFIVDTVSDQFYFMEMNTRLQVEHPVTEMIVDQDLVEWQIRVANGEPLPLSQSEVPLLGHAFEARIYAENVPKGFLPATGVLHHYHPVPVSSKAVRVETGVEQGDTVSMHYDPMIANLWYGAKTVAGVPTNINFLQKLAKHRAFESGDVETHFIEQHKDELFVKPSQSVSAEMNSAARLSATLVAACIFEKEkstlkesppgnHCLLSIWYTDPPFRVHHHARRIMEFEWENEHDDSGSKLLTLTVTYQADGNYLIEMGEDGSYISEVKATYLGEHKFRVEFDVVSMDVHLAVYNKGRIKHIHAWHGLHHHHFKQKLGLELPDEDETQHKTSFetatgppgsvlsPMAGLVVKVLANDGTKVEEGQPILVLEAMKMEHVVKAPTTGVVHGLQVTAGQQVSDGSVLFRLQAVHIQLAVHGFVVQFVQDNLIHSLVVCSFAFCSEFKFRVCRFCLFMT
MASTLRRKPNDRSFILQSRLFSVSKSGCKSDDKQQRIEKILIANRGEIAYRIMRTAKRLGIRTVAVYSDADRDSLHVKSADEAIRIGPPPARLSYLNGSSIVDAAIRTGAQAIHPGYGFLSESADFAQLCGDNGLTFIGPPVSAIRDMGDKSASKRIMGAAGVPLVPGYHGNEQDIDLMKSEAAKIGYPILIKPTHGGGGKGMRIVQSPNDFVDSFLGAQREAAASFGINTILLEKYITQPRHIEVQIFGDKYGKVLHLYERDCSVQRRHQKIIEEAPAPNVTHDFRALLGQAAVSAAKAVSYHNAGTVEFIVDTVSDQFYFMEMNTRLQVEHPVTEMIVDQDLVEWQIRVANGEPLPLSQSEVPLLGHAFEARIYAENVPKGFLPATGVLHHYHPVPVSSKAVRVETGVEQGDTVSMHYDPMIANLWYGAKTVAGVPTNINFLQKLAKHRAFESGDVETHFIEQHKDELFVKPSQSVSAEMNSAARLSATLVAACIFEKEKSTLKESPPGNHCLLSIWYTDPPFRVHHHARRIMEFEWENEHDDSGSKLLTLTVTYQADGNYLIEMGEDGSYISEVKATYLGEHKFRVEFDVVSMDVHLAVYNKGRIKhihawhglhhhhFKQKLGLELPDEDETQHKTSFETATGPPGSVLSPMAGLVVKVLANDGTKVEEGQPILVLEAMKMEHVVKAPTTGVVHGLQVTAGQQVSDGSVLFRLQAVHIQLAVHGFVVQFVQDNLIHSLVVCSFAFCSEFKFRVCRFCLFMT
************************************IEKILIANRGEIAYRIMRTAKRLGIRTVAVYSDADRDSLHVK***EAIRIGPPPARLSYLNGSSIVDAAIRTGAQAIHPGYGFLSESADFAQLCGDNGLTFIGPPVSAIR**********IMGAAGVPLVPGYHGNEQDIDLMKSEAAKIGYPILIKPTHGGGGKGMRIVQSPNDFVDSFLGAQREAAASFGINTILLEKYITQPRHIEVQIFGDKYGKVLHLYERDCSVQRRHQKIIEEAPAPNVTHDFRALLGQAAVSAAKAVSYHNAGTVEFIVDTVSDQFYFMEMNTRLQVEHPVTEMIVDQDLVEWQIRVANGEPLPLSQSEVPLLGHAFEARIYAENVPKGFLPATGVLHHYHPVPVSSKAVRVETGVEQGDTVSMHYDPMIANLWYGAKTVAGVPTNINFLQKLAKHRAFESGDVETHFIEQHKDELF***************RLSATLVAACIFEK**********GNHCLLSIWYTDPPFRVHHHARRIMEFEWENEHDDSGSKLLTLTVTYQADGNYLIEMGEDGSYISEVKATYLGEHKFRVEFDVVSMDVHLAVYNKGRIKHIHAWH****************************************MAGLVVKVLANDGTKVEEGQPILVLEAMKMEHVVKAPTTGVVHGLQVTAGQQVSDGSVLFRLQAVHIQLAVHGFVVQFVQDNLIHSLVVCSFAFCSEFKFRVCRFCLF**
**************I*********************IEKILIANRGEIAYRIMRTAKRLGIRTVAVYSDADRDSLHVKSADEAIRIGPPPARLSYLNGSSIVDAAIRTGAQAIHPGYGFLSESADFAQLCGDNGLTFIGPPVSAIRDMGDKSASKRIMGAAGVPLVPGYHGNEQDIDLMKSEAAKIGYPILIKPTHGGGGKGMRIVQSPNDFVDSFLGAQREAAASFGINTILLEKYITQPRHIEVQIFGDKYGKVLHLYERDCSVQRRHQKIIEEAPAPNVTHDFRALLGQAAVSAAKAVSYHNAGTVEFIVDTVSDQFYFMEMNTRLQVEHPVTEMIVDQDLVEWQIRVANGEPLPLSQSEVPLLGHAFEARIYAENVPKGFLPATGVLHHYHPVPVSSKAVRVETGVEQGDTVSMHYDPMIANLWYGAKTVAGVPTNINFLQKLAKHRAFESGDVETHFIEQHKDELFVKPSQSVSAEMNSAARLSATLVAACIFE****************LSIWYTDPPFRVHHHARRIMEFEWENEHDDSGSKLLTLTVTYQADGNYLIEMGEDGSYISEVKATYLGEHKFRVEFDVVSMDVHLAVYNKGRIKHIHAWHGLHHHHFKQKLGLELPDED*******************SPMAGLVVKVLANDGTKVEEGQPILVLEAMKMEHVVKAPTTGVVHGLQVTAGQQVSDGSVLFRLQA******************LIHSLVVCSFAFCSEFKFRVCRFCLFMT
*********NDRSFILQSRLFSV**********QQRIEKILIANRGEIAYRIMRTAKRLGIRTVAVYSDADRDSLHVKSADEAIRIGPPPARLSYLNGSSIVDAAIRTGAQAIHPGYGFLSESADFAQLCGDNGLTFIGPPVSAIRDMGDKSASKRIMGAAGVPLVPGYHGNEQDIDLMKSEAAKIGYPILIKPTHGGGGKGMRIVQSPNDFVDSFLGAQREAAASFGINTILLEKYITQPRHIEVQIFGDKYGKVLHLYERDCSVQRRHQKIIEEAPAPNVTHDFRALLGQAAVSAAKAVSYHNAGTVEFIVDTVSDQFYFMEMNTRLQVEHPVTEMIVDQDLVEWQIRVANGEPLPLSQSEVPLLGHAFEARIYAENVPKGFLPATGVLHHYHPVPVSSKAVRVETGVEQGDTVSMHYDPMIANLWYGAKTVAGVPTNINFLQKLAKHRAFESGDVETHFIEQHKDELFVKPSQSVSAEMNSAARLSATLVAACIFEKEKSTLKESPPGNHCLLSIWYTDPPFRVHHHARRIMEFEWENEHDDSGSKLLTLTVTYQADGNYLIEMGEDGSYISEVKATYLGEHKFRVEFDVVSMDVHLAVYNKGRIKHIHAWHGLHHHHFKQKLGLELPDEDETQHKTSFETATGPPGSVLSPMAGLVVKVLANDGTKVEEGQPILVLEAMKMEHVVKAPTTGVVHGLQVTAGQQVSDGSVLFRLQAVHIQLAVHGFVVQFVQDNLIHSLVVCSFAFCSEFKFRVCRFCLFMT
*****RRKPNDRSFILQSRLFSVSKSG******QQRIEKILIANRGEIAYRIMRTAKRLGIRTVAVYSDADRDSLHVKSADEAIRIGPPPARLSYLNGSSIVDAAIRTGAQAIHPGYGFLSESADFAQLCGDNGLTFIGPPVSAIRDMGDKSASKRIMGAAGVPLVPGYHGNEQDIDLMKSEAAKIGYPILIKPTHGGGGKGMRIVQSPNDFVDSFLGAQREAAASFGINTILLEKYITQPRHIEVQIFGDKYGKVLHLYERDCSVQRRHQKIIEEAPAPNVTHDFRALLGQAAVSAAKAVSYHNAGTVEFIVDTVSDQFYFMEMNTRLQVEHPVTEMIVDQDLVEWQIRVANGEPLPLSQSEVPLLGHAFEARIYAENVPKGFLPATGVLHHYHPVPVSSKAVRVETGVEQGDTVSMHYDPMIANLWYGAKTVAGVPTNINFLQKLAKHRAFESGDVETHFIEQHKDELFVKPSQSVSAEMNSAARLSATLVAACIFEKEKSTLKES*****CLLSIWYTDPPFRVHHHARRIMEFEWENEHDDSGSKLLTLTVTYQADGNYLIEMGEDGSYISEVKATYLGEHKFRVEFDVVSMDVHLAVYNKGRIKHIHAWHGLHHHHFKQKLGLELPDEDETQHKTSFETATGPPGSVLSPMAGLVVKVLANDGTKVEEGQPILVLEAMKMEHVVKAPTTGVVHGLQVTAGQQVSDGSVLFRLQAVHIQLAVHGFVVQFVQDNLIHSLVVCSFAFCSEFKFRVCRFCLFMT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASTLRRKPNDRSFILQSRLFSVSKSGCKSDDKQQRIEKILIANRGEIAYRIMRTAKRLGIRTVAVYSDADRDSLHVKSADEAIRIGPPPARLSYLNGSSIVDAAIRTGAQAIHPGYGFLSESADFAQLCGDNGLTFIGPPVSAIRDMGDKSASKRIMGAAGVPLVPGYHGNEQDIDLMKSEAAKIGYPILIKPTHGGGGKGMRIVQSPNDFVDSFLGAQREAAASFGINTILLEKYITQPRHIEVQIFGDKYGKVLHLYERDCSVQRRHQKIIEEAPAPNVTHDFRALLGQAAVSAAKAVSYHNAGTVEFIVDTVSDQFYFMEMNTRLQVEHPVTEMIVDQDLVEWQIRVANGEPLPLSQSEVPLLGHAFEARIYAENVPKGFLPATGVLHHYHPVPVSSKAVRVETGVEQGDTVSMHYDPMIANLWYGAKTVAGVPTNINFLQKLAKHRAFESGDVETHFIEQHKDELFVKPSQSVSAEMNSAARLSATLVAACIFEKEKSTLKESPPGNHCLLSIWYTDPPFRVHHHARRIMEFEWENEHDDSGSKLLTLTVTYQADGNYLIEMGEDGSYISEVKATYLGEHKFRVEFDVVSMDVHLAVYNKGRIKHIHAWHGLHHHHFKQKLGLELPDEDETQHKTSFETATGPPGSVLSPMAGLVVKVLANDGTKVEEGQPILVLEAMKMEHVVKAPTTGVVHGLQVTAGQQVSDGSVLFRLQAVHIQLAVHGFVVQFVQDNLIHSLVVCSFAFCSEFKFRVCRFCLFMT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query765 2.2.26 [Sep-21-2011]
Q42777731 Methylcrotonoyl-CoA carbo yes no 0.922 0.965 0.712 0.0
Q42523734 Methylcrotonoyl-CoA carbo yes no 0.925 0.964 0.710 0.0
Q2QMG2737 Methylcrotonoyl-CoA carbo yes no 0.884 0.918 0.676 0.0
Q54KE6699 Methylcrotonoyl-CoA carbo yes no 0.844 0.924 0.463 1e-162
Q96RQ3725 Methylcrotonoyl-CoA carbo yes no 0.847 0.893 0.449 1e-160
Q5I0C3715 Methylcrotonoyl-CoA carbo yes no 0.828 0.886 0.451 1e-159
Q99MR8717 Methylcrotonoyl-CoA carbo yes no 0.854 0.912 0.442 1e-155
P0A508654 Acetyl-/propionyl-coenzym yes no 0.568 0.665 0.489 1e-121
P0A509654 Acetyl-/propionyl-coenzym yes no 0.568 0.665 0.489 1e-121
Q91ZA3724 Propionyl-CoA carboxylase no no 0.884 0.935 0.383 1e-118
>sp|Q42777|MCCA_SOYBN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Glycine max GN=MCCA PE=1 SV=2 Back     alignment and function desciption
 Score = 1037 bits (2682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/731 (71%), Positives = 606/731 (82%), Gaps = 25/731 (3%)

Query: 5   LRRKPNDRSFILQSRLFSVSKSGCKSDDKQQRIEKILIANRGEIAYRIMRTAKRLGIRTV 64
           LRR     S + ++R FS  KS       + RIEKIL+ANRGEIA RI RTA+RLGI+TV
Sbjct: 7   LRRTTLSHSHV-RARAFSEGKS-----SNRHRIEKILVANRGEIACRITRTARRLGIQTV 60

Query: 65  AVYSDADRDSLHVKSADEAIRIGPPPARLSYLNGSSIVDAAIRTGAQAIHPGYGFLSESA 124
           AVYSDADRDSLHV +ADEAIRIGPPPARLSYLNG+SIVDAAIR+GAQAIHPGYGFLSESA
Sbjct: 61  AVYSDADRDSLHVATADEAIRIGPPPARLSYLNGASIVDAAIRSGAQAIHPGYGFLSESA 120

Query: 125 DFAQLCGDNGLTFIGPPVSAIRDMGDKSASKRIMGAAGVPLVPGYHGNEQDIDLMKSEAA 184
           DFA+LC ++GLTFIGPP SAIRDMGDKSASKRIMGAAGVPLVPGYHG +QDI+ MK EA 
Sbjct: 121 DFAKLCEESGLTFIGPPASAIRDMGDKSASKRIMGAAGVPLVPGYHGYDQDIEKMKLEAD 180

Query: 185 KIGYPILIKPTHGGGGKGMRIVQSPNDFVDSFLGAQREAAASFGINTILLEKYITQPRHI 244
           +IGYP+LIKPTHGGGGKGMRIV +P++FV+SFL AQREAAASFG+NTILLEKYIT+PRHI
Sbjct: 181 RIGYPVLIKPTHGGGGKGMRIVHTPDEFVESFLAAQREAAASFGVNTILLEKYITRPRHI 240

Query: 245 EVQIFGDKYGKVLHLYERDCSVQRRHQKIIEEAPAPNVTHDFRALLGQAAVSAAKAVSYH 304
           EVQIFGDK+G VLHLYERDCSVQRRHQKIIEEAPAPN++ DFRA LG AAVSAAKAV+Y+
Sbjct: 241 EVQIFGDKHGNVLHLYERDCSVQRRHQKIIEEAPAPNISADFRAQLGVAAVSAAKAVNYY 300

Query: 305 NAGTVEFIVDTVSDQFYFMEMNTRLQVEHPVTEMIVDQDLVEWQIRVANGEPLPLSQSEV 364
           NAGTVEFIVDTVSD+FYFMEMNTRLQVEHPVTEMIV QDLVEWQI VANGE LPLSQS+V
Sbjct: 301 NAGTVEFIVDTVSDEFYFMEMNTRLQVEHPVTEMIVGQDLVEWQILVANGEALPLSQSQV 360

Query: 365 PLLGHAFEARIYAENVPKGFLPATGVLHHYHPVPVSSKAVRVETGVEQGDTVSMHYDPMI 424
           PL GHAFEARIYAENV KGFLPATGVLHHYH VPVSS AVRVETGV++GD VSMHYDPMI
Sbjct: 361 PLSGHAFEARIYAENVQKGFLPATGVLHHYH-VPVSS-AVRVETGVKEGDKVSMHYDPMI 418

Query: 425 ANL--WYGAKT--------------VAGVPTNINFLQKLAKHRAFESGDVETHFIEQHKD 468
           A L  W   +               VAG+PTN+NFLQKLA HRAF  G+VETHFI+ +K+
Sbjct: 419 AKLVVWGENRAAALVKLKDSLSKFQVAGLPTNVNFLQKLANHRAFAIGNVETHFIDNYKE 478

Query: 469 ELFVKPSQSVSA-EMNSAARLSATLVAACIFEKEKSTLKESPPGNHCLLSIWYTDPPFRV 527
           +LFV  + SVS  E   AARL+A+LVAAC+ EKE   L  +PPG   LL IWY+ PPFR+
Sbjct: 479 DLFVDANNSVSVKEAYEAARLNASLVAACLIEKEHFILARNPPGGSSLLPIWYSSPPFRI 538

Query: 528 HHHARRIMEFEWENEHDDSGSKLLTLTVTYQADGNYLIEMGEDGSYISEVKATYLGEHKF 587
           HH A+R ME EW+NE+    SK++ LT+TYQ DG YLIE  ++GS + EVK+TY+ ++ F
Sbjct: 539 HHQAKRRMELEWDNEYGSGSSKIMKLTITYQPDGRYLIETEQNGSPVLEVKSTYVKDNYF 598

Query: 588 RVEFDVVSMDVHLAVYNKGRIKHIHAWHGLHHHHFKQKLGLELPDEDETQHKTSFETATG 647
           RVE   V  DV++AVY+K +I+HIH W G  HH+F++KLGLEL +++E+QHK   ET+  
Sbjct: 599 RVEAAGVINDVNVAVYSKDQIRHIHIWQGSCHHYFREKLGLELSEDEESQHKPKVETSAN 658

Query: 648 PPGSVLSPMAGLVVKVLANDGTKVEEGQPILVLEAMKMEHVVKAPTTGVVHGLQVTAGQQ 707
           P G+V++PMAGLVVKVL  + T+VEEGQP+LVLEAMKMEHVVKAP++G VHGLQ+  G+Q
Sbjct: 659 PQGTVVAPMAGLVVKVLVENKTRVEEGQPVLVLEAMKMEHVVKAPSSGYVHGLQLMVGEQ 718

Query: 708 VSDGSVLFRLQ 718
           VSDGSVLF ++
Sbjct: 719 VSDGSVLFSVK 729

Glycine max (taxid: 3847)
EC: 6EC: .EC: 4EC: .EC: 1EC: .EC: 4
>sp|Q42523|MCCA_ARATH Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Arabidopsis thaliana GN=MCCA PE=1 SV=2 Back     alignment and function description
>sp|Q2QMG2|MCCA_ORYSJ Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica GN=MCCA PE=2 SV=2 Back     alignment and function description
>sp|Q54KE6|MCCA_DICDI Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Dictyostelium discoideum GN=mccA PE=3 SV=1 Back     alignment and function description
>sp|Q96RQ3|MCCA_HUMAN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Homo sapiens GN=MCCC1 PE=1 SV=3 Back     alignment and function description
>sp|Q5I0C3|MCCA_RAT Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Rattus norvegicus GN=Mccc1 PE=1 SV=1 Back     alignment and function description
>sp|Q99MR8|MCCA_MOUSE Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus GN=Mccc1 PE=2 SV=2 Back     alignment and function description
>sp|P0A508|BCCA_MYCTU Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium tuberculosis GN=accA1 PE=1 SV=1 Back     alignment and function description
>sp|P0A509|BCCA_MYCBO Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=accA1 PE=3 SV=1 Back     alignment and function description
>sp|Q91ZA3|PCCA_MOUSE Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus GN=Pcca PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query765
224085521760 predicted protein [Populus trichocarpa] 0.937 0.943 0.742 0.0
359479709735 PREDICTED: methylcrotonoyl-CoA carboxyla 0.933 0.971 0.752 0.0
255567518742 acetyl-CoA carboxylase, putative [Ricinu 0.937 0.966 0.746 0.0
356536272731 PREDICTED: methylcrotonoyl-CoA carboxyla 0.925 0.968 0.709 0.0
449458468735 PREDICTED: methylcrotonoyl-CoA carboxyla 0.933 0.971 0.717 0.0
20455047731 RecName: Full=Methylcrotonoyl-CoA carbox 0.922 0.965 0.712 0.0
356500176735 PREDICTED: methylcrotonoyl-CoA carboxyla 0.907 0.944 0.715 0.0
357440645743 Methylcrotonoyl-CoA carboxylase subunit 0.909 0.936 0.719 0.0
30678473734 methylcrotonoyl-CoA carboxylase subunit 0.925 0.964 0.710 0.0
297843108734 3-methylcrotonyl-CoA carboxylase 1 [Arab 0.925 0.964 0.701 0.0
>gi|224085521|ref|XP_002307604.1| predicted protein [Populus trichocarpa] gi|222857053|gb|EEE94600.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1113 bits (2878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/758 (74%), Positives = 617/758 (81%), Gaps = 41/758 (5%)

Query: 1   MASTLRRKPND-RSFILQSRLFSVSKSGCKSDDKQQRIEKILIANRGEIAYRIMRTAKRL 59
           MA+ LRRK +D R F++Q+RLFS+ +S         RIEKILIANRGEIA RIMRTAKRL
Sbjct: 4   MATILRRKLHDNRHFLIQTRLFSL-ESFSHDTKTTSRIEKILIANRGEIACRIMRTAKRL 62

Query: 60  GIRTVAVYSDADRDSLHVKSADEAIRIGPPPARLSYLNGSSIVDAAIRTGAQAIHPGYGF 119
           GIRTVAVYSDADRDSLHVKSADEA+ IGPPPARLSYLNGS+IV+AAIRTGAQAIHPGYGF
Sbjct: 63  GIRTVAVYSDADRDSLHVKSADEAVHIGPPPARLSYLNGSAIVEAAIRTGAQAIHPGYGF 122

Query: 120 LSESADFAQLCGDNGLTFIGPPVSAIRDMGDKSASKRIMGAAGVPLVPGYHGNEQDIDLM 179
           LSES+DFA LC D GLTF+GPP SAIRDMGDKSASKRIMGAAGVPLVPGYHG+EQDI+LM
Sbjct: 123 LSESSDFATLCEDKGLTFVGPPASAIRDMGDKSASKRIMGAAGVPLVPGYHGSEQDIELM 182

Query: 180 KSEAAKIGYPILIKPTHGGGGKGMRIVQSPNDFVDSFLGAQREAAASFGINTILLEKYIT 239
           KSEA KIGYPILIKPTHGGGGKGMRIVQSPN+FVDSFLGAQREAAASFGINTILLEKYIT
Sbjct: 183 KSEADKIGYPILIKPTHGGGGKGMRIVQSPNEFVDSFLGAQREAAASFGINTILLEKYIT 242

Query: 240 QPRHIEVQIFGDKYGKVLHLYERDCSVQRRHQKIIEEAPAPNVTHDFRALLGQAAVSAAK 299
           +PRHIEVQIFGDK+G VLHLYERDCSVQRRHQKIIEEAPAPNV +DFR+ LGQAAVSAAK
Sbjct: 243 KPRHIEVQIFGDKHGNVLHLYERDCSVQRRHQKIIEEAPAPNVMNDFRSHLGQAAVSAAK 302

Query: 300 AVSYHNAGTVEFIVDTVSDQFYFMEMNTRLQVEHPVTEMIVDQDLVEWQIRVANGEPLPL 359
           AV YHNAGTVEFIVDTVS QFYFMEMNTRLQVEHPVTEMIV QDLVEWQI VANGEPLP+
Sbjct: 303 AVGYHNAGTVEFIVDTVSGQFYFMEMNTRLQVEHPVTEMIVGQDLVEWQISVANGEPLPI 362

Query: 360 SQSEVPLL---------------------GHAFEARIYAENVPKGFLPATGVLHHYHPVP 398
           +QS+VPLL                     GHAFEARIYAENVPKGFLPATGVLHHY PVP
Sbjct: 363 NQSQVPLLEFLYSYEFFVGLPDNDHYDLTGHAFEARIYAENVPKGFLPATGVLHHYRPVP 422

Query: 399 VSSKAVRVETGVEQGDTVSMHYDPMIANLWYGAKT----------------VAGVPTNIN 442
           V S  VRVETGVEQGDTVSMHYDPMIA L    +                 VAGVPTNIN
Sbjct: 423 V-SPTVRVETGVEQGDTVSMHYDPMIAKLVVSGENRAAALVKLKDCLSKFQVAGVPTNIN 481

Query: 443 FLQKLAKHRAFESGDVETHFIEQHKDELFVKPSQSVSA-EMNSAARLSATLVAACIFEKE 501
           FLQKLA HRAFE+G+VETHFIE +KD+LF  P+    A E    AR SATLVAAC+ EKE
Sbjct: 482 FLQKLADHRAFENGNVETHFIEHYKDDLFTDPNNLTRAKETYDNARFSATLVAACLCEKE 541

Query: 502 KSTLKESPPGNHCLLSIWYTDPPFRVHHHARRIMEFEWENEHDDSGSKLLTLTVTYQADG 561
            S +K S PG + LL IWY+ PPFR H+ A   ME EWENE+D S S+  T ++TYQ+DG
Sbjct: 542 HSAIKSSLPGTNGLLPIWYSHPPFRAHYQASCTMELEWENEYDGSSSEFFTFSITYQSDG 601

Query: 562 NYLIEMGEDGSYISEVKATYLGEHKFRVEFDVVSMDVHLAVYNKGRIKHIHAWHGLHHHH 621
           NYLIE  E  S   EVKAT L +  FRVE D VSMDV L+ Y+K +IKHIH WHG HH+H
Sbjct: 602 NYLIETEEVNSPGLEVKATLLHDQDFRVETDGVSMDVSLSAYSKDKIKHIHLWHGSHHYH 661

Query: 622 FKQKLGLELPDEDETQHKTSFETATGPPGSVLSPMAGLVVKVLANDGTKVEEGQPILVLE 681
           F+QKL L+L D++E Q KT+FETA  PPG+V++PMAGLVVKVL  DGTKVEEGQPILVLE
Sbjct: 662 FRQKLELDLSDDNEIQQKTNFETALHPPGTVVAPMAGLVVKVLVMDGTKVEEGQPILVLE 721

Query: 682 AMKMEHVVKAPTTGVVHGLQVTAGQQVSDGSVLFRLQA 719
           AMKMEHVVKAP +G VHGLQVTAGQQVSD S LF ++ 
Sbjct: 722 AMKMEHVVKAPFSGHVHGLQVTAGQQVSDSSPLFSVKG 759

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359479709|ref|XP_003632341.1| PREDICTED: methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial-like [Vitis vinifera] gi|296085234|emb|CBI28729.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255567518|ref|XP_002524738.1| acetyl-CoA carboxylase, putative [Ricinus communis] gi|223535922|gb|EEF37581.1| acetyl-CoA carboxylase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356536272|ref|XP_003536663.1| PREDICTED: methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|449458468|ref|XP_004146969.1| PREDICTED: methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|20455047|sp|Q42777.2|MCCA_SOYBN RecName: Full=Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial; Short=MCCase subunit alpha; AltName: Full=3-methylcrotonyl-CoA carboxylase 1; AltName: Full=3-methylcrotonyl-CoA:carbon dioxide ligase subunit alpha; Flags: Precursor Back     alignment and taxonomy information
>gi|356500176|ref|XP_003518909.1| PREDICTED: methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial [Glycine max] Back     alignment and taxonomy information
>gi|357440645|ref|XP_003590600.1| Methylcrotonoyl-CoA carboxylase subunit alpha [Medicago truncatula] gi|355479648|gb|AES60851.1| Methylcrotonoyl-CoA carboxylase subunit alpha [Medicago truncatula] Back     alignment and taxonomy information
>gi|30678473|ref|NP_849583.1| methylcrotonoyl-CoA carboxylase subunit alpha [Arabidopsis thaliana] gi|20455046|sp|Q42523.2|MCCA_ARATH RecName: Full=Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial; Short=MCCase subunit alpha; AltName: Full=3-methylcrotonyl-CoA carboxylase 1; AltName: Full=3-methylcrotonyl-CoA:carbon dioxide ligase subunit alpha; Flags: Precursor gi|17979456|gb|AAL50065.1| At1g03090/F10O3_8 [Arabidopsis thaliana] gi|332189406|gb|AEE27527.1| methylcrotonoyl-CoA carboxylase subunit alpha [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297843108|ref|XP_002889435.1| 3-methylcrotonyl-CoA carboxylase 1 [Arabidopsis lyrata subsp. lyrata] gi|297335277|gb|EFH65694.1| 3-methylcrotonyl-CoA carboxylase 1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query765
TAIR|locus:2007559734 MCCA [Arabidopsis thaliana (ta 0.924 0.963 0.699 1.2e-261
DICTYBASE|DDB_G0287377699 mccA "methylcrotonyl-CoA carbo 0.849 0.929 0.473 1.7e-153
ZFIN|ZDB-GENE-050208-450711 mccc1 "methylcrotonoyl-Coenzym 0.850 0.915 0.464 3.1e-151
FB|FBgn0039877698 CG2118 [Drosophila melanogaste 0.618 0.677 0.555 1.2e-149
UNIPROTKB|F1NYK3713 MCCC1 "Uncharacterized protein 0.624 0.670 0.542 4.6e-148
UNIPROTKB|F6XFZ9725 MCCC1 "Uncharacterized protein 0.850 0.897 0.457 7.5e-148
UNIPROTKB|E2R6B7726 MCCC1 "Uncharacterized protein 0.850 0.896 0.456 6.7e-147
RGD|1310615715 Mccc1 "methylcrotonoyl-CoA car 0.839 0.897 0.451 1.4e-146
UNIPROTKB|Q5I0C3715 Mccc1 "Methylcrotonoyl-CoA car 0.839 0.897 0.451 1.4e-146
UNIPROTKB|Q96RQ3725 MCCC1 "Methylcrotonoyl-CoA car 0.841 0.888 0.460 1.8e-146
TAIR|locus:2007559 MCCA [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2504 (886.5 bits), Expect = 1.2e-261, Sum P(2) = 1.2e-261
 Identities = 512/732 (69%), Positives = 582/732 (79%)

Query:     5 LRRKPNDRSFILQSRLFSVSKSGCKSDDKQQRIEKILIANRGEIAYRIMRTAKRLGIRTV 64
             LRR    ++  +  R  S S S      K+Q IEKIL+ANRGEIA RIMRTAKRLGI+TV
Sbjct:     9 LRRNVRRKNHSMLVRYISGSAS---MKPKEQCIEKILVANRGEIACRIMRTAKRLGIQTV 65

Query:    65 AVYSDADRDSLHVKSADEAIRIGPPPARLSYLNGSSIVDAAIRTGAQAIHPGYGFLSESA 124
             AVYSDADRDSLHVKSADEA+RIGPP ARLSYL+G +I++AA RTGAQAIHPGYGFLSES+
Sbjct:    66 AVYSDADRDSLHVKSADEAVRIGPPSARLSYLSGVTIMEAAARTGAQAIHPGYGFLSESS 125

Query:   125 DFAQLCGDNGLTFIGPPVSAIRDMGDKSASKRIMGAAGVPLVPGYHGNEQDIDLMKSEAA 184
             DFAQLC D+GLTFIGPP SAIRDMGDKSASKRIMGAAGVPLVPGYHG+EQDID MKSEA 
Sbjct:   126 DFAQLCEDSGLTFIGPPASAIRDMGDKSASKRIMGAAGVPLVPGYHGHEQDIDHMKSEAE 185

Query:   185 KIGYPILIKPTHGGGGKGMRIVQSPNDFVDSFLGAQREAAASFGINTILLEKYITQPRHI 244
             KIGYPI+IKPTHGGGGKGMRIVQS  DF DSFLGAQREAAASFG+NTILLEKYIT+PRHI
Sbjct:   186 KIGYPIIIKPTHGGGGKGMRIVQSGKDFADSFLGAQREAAASFGVNTILLEKYITRPRHI 245

Query:   245 EVQIFGDKYGKVLHLYERDCSVQRRHQKIIEEAPAPNVTHDFRALLGQAAVSAAKAVSYH 304
             EVQIFGDK+G VLHLYERDCSVQRRHQKIIEEAPAPN++  FRA LGQAAVSAA+AV Y+
Sbjct:   246 EVQIFGDKHGNVLHLYERDCSVQRRHQKIIEEAPAPNISEKFRANLGQAAVSAARAVGYY 305

Query:   305 NAGTVEFIVDTVSDQFYFMEMNTRLQVEHPVTEMIVDQDLVEWQIRVANGEPLPLSQSEV 364
             NAGTVEFIVDT SDQFYFMEMNTRLQVEHPVTEMIV QDLVEWQIRVANGEPLPLSQSEV
Sbjct:   306 NAGTVEFIVDTESDQFYFMEMNTRLQVEHPVTEMIVGQDLVEWQIRVANGEPLPLSQSEV 365

Query:   365 PLLGHAFEARIYAENVPKGFLPATGVLHHYHPVPVSSKAVRVETGVEQGDTVSMHYDPMI 424
             P+ GHAFEARIYAENVPKGFLPATGVL+HY PV VS  +VRVETGVEQGDTVSMHYDPMI
Sbjct:   366 PMSGHAFEARIYAENVPKGFLPATGVLNHYRPVAVSP-SVRVETGVEQGDTVSMHYDPMI 424

Query:   425 ANL--WYGAK--------------TVAGVPTNINFLQKLAKHRAFESGDVETHFIEQHKD 468
             A L  W G +               VAGVPTNINFLQKLA H+ F  G+VETHFIE HK 
Sbjct:   425 AKLVVWGGNRGEALVKLKDCLSNFQVAGVPTNINFLQKLASHKEFAVGNVETHFIEHHKS 484

Query:   469 ELFVKPSQSVSAEMN-SAARLSATLVAACIFEKEKSTLKESPPGNHCLLSIWYTDPPFRV 527
             +LF   S   + E+   A + SA LVAACI   E ST  ES  G   + SIWY++PPFRV
Sbjct:   485 DLFADESNPAATEVAYKAVKHSAALVAACISTIEHSTWNESNHGK--VPSIWYSNPPFRV 542

Query:   528 HHHARRIMEFEWENEHDDSGSKLLTLTVTYQADGNYLIEMGEDGSYISEVKATYLGEHKF 587
             HH A++ +E EW NE + +GS L++L V YQ DG+YLIE G D   + E++ T  G+  F
Sbjct:   543 HHEAKQTIELEWNNECEGTGSNLISLGVRYQPDGSYLIEEGNDSPSL-ELRVTRAGKCDF 601

Query:   588 RVEFDVVSMDVHLAVYNKGRIKXXXXXXXXXXXXFKQKLGLELPDEDE-TQHKTSFETAT 646
             RVE   +SM+V LA Y K   K            FKQK+G+E  +++E  QH+TS ET++
Sbjct:   602 RVEAAGLSMNVSLAAYLKDGYKHIHIWHGSEHHQFKQKVGIEFSEDEEGVQHRTSSETSS 661

Query:   647 GPPGSVLSPMAGLVVKVLANDGTKVEEGQPILVLEAMKMEHVVKAPTTGVVHGLQVTAGQ 706
              PPG++++PMAGLVVKVL  +  KV++GQPILVLEAMKMEHVVKAP++G +  L+V AGQ
Sbjct:   662 HPPGTIVAPMAGLVVKVLVENEAKVDQGQPILVLEAMKMEHVVKAPSSGSIQDLKVKAGQ 721

Query:   707 QVSDGSVLFRLQ 718
             QVSDGS LFR++
Sbjct:   722 QVSDGSALFRIK 733
GO:0003824 "catalytic activity" evidence=IEA
GO:0004075 "biotin carboxylase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0008152 "metabolic process" evidence=IEA
GO:0016874 "ligase activity" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0004485 "methylcrotonoyl-CoA carboxylase activity" evidence=IDA
GO:0006552 "leucine catabolic process" evidence=IDA
GO:0022626 "cytosolic ribosome" evidence=IDA
GO:0050897 "cobalt ion binding" evidence=IDA
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0009750 "response to fructose stimulus" evidence=RCA
DICTYBASE|DDB_G0287377 mccA "methylcrotonyl-CoA carboxylase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-450 mccc1 "methylcrotonoyl-Coenzyme A carboxylase 1 (alpha)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0039877 CG2118 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NYK3 MCCC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F6XFZ9 MCCC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2R6B7 MCCC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1310615 Mccc1 "methylcrotonoyl-CoA carboxylase 1 (alpha)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5I0C3 Mccc1 "Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q96RQ3 MCCC1 "Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q99MR8MCCA_MOUSE6, ., 4, ., 1, ., 40.44290.85490.9121yesno
Q42777MCCA_SOYBN6, ., 4, ., 1, ., 40.71270.92280.9658yesno
Q54KE6MCCA_DICDI6, ., 4, ., 1, ., 40.46380.84440.9241yesno
Q5I0C3MCCA_RAT6, ., 4, ., 1, ., 40.45190.82870.8867yesno
Q2QMG2MCCA_ORYSJ6, ., 4, ., 1, ., 40.67660.88490.9185yesno
Q42523MCCA_ARATH6, ., 4, ., 1, ., 40.71070.92540.9645yesno
Q96RQ3MCCA_HUMAN6, ., 4, ., 1, ., 40.44960.84700.8937yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer6.4.1.40.991
3rd Layer6.4.10.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query765
COG4770645 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase 0.0
PRK08591451 PRK08591, PRK08591, acetyl-CoA carboxylase biotin 0.0
PRK06111450 PRK06111, PRK06111, acetyl-CoA carboxylase biotin 0.0
PRK08654499 PRK08654, PRK08654, pyruvate carboxylase subunit A 0.0
COG0439449 COG0439, AccC, Biotin carboxylase [Lipid metabolis 0.0
TIGR00514449 TIGR00514, accC, acetyl-CoA carboxylase, biotin ca 0.0
PRK05586447 PRK05586, PRK05586, biotin carboxylase; Validated 1e-175
PRK12999 1146 PRK12999, PRK12999, pyruvate carboxylase; Reviewed 1e-174
TIGR02712 1201 TIGR02712, urea_carbox, urea carboxylase 1e-167
PRK07178472 PRK07178, PRK07178, pyruvate carboxylase subunit A 1e-167
PRK08463478 PRK08463, PRK08463, acetyl-CoA carboxylase subunit 1e-160
PRK08462445 PRK08462, PRK08462, biotin carboxylase; Validated 1e-160
PRK12833467 PRK12833, PRK12833, acetyl-CoA carboxylase biotin 1e-154
COG1038 1149 COG1038, PycA, Pyruvate carboxylase [Energy produc 1e-150
TIGR01235 1143 TIGR01235, pyruv_carbox, pyruvate carboxylase 1e-134
pfam02786211 pfam02786, CPSase_L_D2, Carbamoyl-phosphate syntha 9e-83
pfam00289108 pfam00289, CPSase_L_chain, Carbamoyl-phosphate syn 2e-53
smart00878107 smart00878, Biotin_carb_C, Biotin carboxylase C-te 2e-30
pfam02785107 pfam02785, Biotin_carb_C, Biotin carboxylase C-ter 1e-29
cd0685067 cd06850, biotinyl_domain, The biotinyl-domain or b 5e-25
COG0511140 COG0511, AccB, Biotin carboxyl carrier protein [Li 1e-19
PRK09282592 PRK09282, PRK09282, pyruvate carboxylase subunit B 1e-17
pfam0036473 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme 7e-16
PRK06549130 PRK06549, PRK06549, acetyl-CoA carboxylase biotin 1e-15
PRK129991146 PRK12999, PRK12999, pyruvate carboxylase; Reviewed 1e-14
PRK14040593 PRK14040, PRK14040, oxaloacetate decarboxylase; Pr 2e-14
TIGR01108582 TIGR01108, oadA, oxaloacetate decarboxylase alpha 4e-14
COG10381149 COG1038, PycA, Pyruvate carboxylase [Energy produc 1e-13
TIGR012351143 TIGR01235, pyruv_carbox, pyruvate carboxylase 8e-13
COG0458400 COG0458, CarB, Carbamoylphosphate synthase large s 8e-13
COG1181317 COG1181, DdlA, D-alanine-D-alanine ligase and rela 2e-12
TIGR027121201 TIGR02712, urea_carbox, urea carboxylase 3e-12
PRK05641153 PRK05641, PRK05641, putative acetyl-CoA carboxylas 7e-12
PRK0822570 PRK08225, PRK08225, acetyl-CoA carboxylase biotin 2e-11
TIGR01205315 TIGR01205, D_ala_D_alaTIGR, D-alanine--D-alanine l 3e-10
PRK01372304 PRK01372, ddl, D-alanine--D-alanine ligase; Review 5e-10
pfam13535183 pfam13535, ATP-grasp_4, ATP-grasp domain 9e-10
pfam07478201 pfam07478, Dala_Dala_lig_C, D-ala D-ala ligase C-t 2e-09
PRK14042596 PRK14042, PRK14042, pyruvate carboxylase subunit B 7e-09
PRK128151068 PRK12815, carB, carbamoyl phosphate synthase large 1e-08
TIGR013691050 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synth 6e-08
cd0666373 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ 8e-08
PRK12815 1068 PRK12815, carB, carbamoyl phosphate synthase large 1e-07
TIGR01369 1050 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synth 1e-07
cd0684974 cd06849, lipoyl_domain, Lipoyl domain of the dihyd 8e-07
PRK02186 887 PRK02186, PRK02186, argininosuccinate lyase; Provi 6e-06
PRK06302155 PRK06302, PRK06302, acetyl-CoA carboxylase biotin 2e-05
TIGR02068864 TIGR02068, cya_phycin_syn, cyanophycin synthetase 2e-05
PRK01966333 PRK01966, ddl, D-alanyl-alanine synthetase A; Revi 2e-05
PRK0588971 PRK05889, PRK05889, putative acetyl-CoA carboxylas 2e-05
TIGR01348 546 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase 2e-05
PRK0674883 PRK06748, PRK06748, hypothetical protein; Validate 4e-05
TIGR01348 546 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase 8e-05
PRK14016727 PRK14016, PRK14016, cyanophycin synthetase; Provis 1e-04
PRK11855 547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 2e-04
TIGR00768277 TIGR00768, rimK_fam, alpha-L-glutamate ligases, Ri 4e-04
COG0508 404 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogena 5e-04
PRK052941066 PRK05294, carB, carbamoyl phosphate synthase large 0.001
PLN027351102 PLN02735, PLN02735, carbamoyl-phosphate synthase 0.002
PRK12767326 PRK12767, PRK12767, carbamoyl phosphate synthase-l 0.002
pfam1353350 pfam13533, Biotin_lipoyl_2, Biotin-lipoyl like 0.002
cd0685067 cd06850, biotinyl_domain, The biotinyl-domain or b 0.003
PRK05294 1066 PRK05294, carB, carbamoyl phosphate synthase large 0.003
PRK11856 411 PRK11856, PRK11856, branched-chain alpha-keto acid 0.003
pfam1353350 pfam13533, Biotin_lipoyl_2, Biotin-lipoyl like 0.004
PRK14570364 PRK14570, PRK14570, D-alanyl-alanine synthetase A; 0.004
TIGR00531156 TIGR00531, BCCP, acetyl-CoA carboxylase, biotin ca 0.004
>gnl|CDD|227111 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information 
 Score =  778 bits (2010), Expect = 0.0
 Identities = 321/699 (45%), Positives = 404/699 (57%), Gaps = 73/699 (10%)

Query: 36  RIEKILIANRGEIAYRIMRTAKRLGIRTVAVYSDADRDSLHVKSADEAIRIGPPPARLSY 95
              KILIANRGEIA R++RTA+ LGIRTVAVYSDAD D+LHV+ ADEA+ IGP PA  SY
Sbjct: 1   MFSKILIANRGEIACRVIRTARDLGIRTVAVYSDADADALHVRMADEAVHIGPAPAAESY 60

Query: 96  LNGSSIVDAAIRTGAQAIHPGYGFLSESADFAQLCGDNGLTFIGPPVSAIRDMGDKSASK 155
           L+   I+DAA RTGAQAIHPGYGFLSE+ADFAQ   D GL FIGP   AIR MGDK A+K
Sbjct: 61  LDIDKIIDAARRTGAQAIHPGYGFLSENADFAQAVEDAGLVFIGPSAGAIRAMGDKIAAK 120

Query: 156 RIMGAAGVPLVPGYHGNEQDIDLMKSEAAKIGYPILIKPTHGGGGKGMRIVQSPNDFVDS 215
           ++   AGVP VPGYHG  QD   + + A +IGYP+LIK + GGGGKGMR+V++P +F ++
Sbjct: 121 KLAAEAGVPTVPGYHGPIQDAAELVAIAEEIGYPVLIKASAGGGGKGMRVVETPEEFAEA 180

Query: 216 FLGAQREAAASFGINTILLEKYITQPRHIEVQIFGDKYGKVLHLYERDCSVQRRHQKIIE 275
              A+REA ASFG + + +EKY+ +PRHIE+Q+F D++G V+HL ERDCS+QRRHQK+IE
Sbjct: 181 LESARREAKASFGDDRVFIEKYLDKPRHIEIQVFADQHGNVVHLGERDCSLQRRHQKVIE 240

Query: 276 EAPAPNVTHDFRALLGQAAVSAAKAVSYHNAGTVEFIVDTVSDQFYFMEMNTRLQVEHPV 335
           EAPAP +T + R  +G+AAV+AAKAV Y  AGTVEFIVD     FYF+EMNTRLQVEHPV
Sbjct: 241 EAPAPFLTEETREAMGEAAVAAAKAVGYVGAGTVEFIVD-ADGNFYFLEMNTRLQVEHPV 299

Query: 336 TEMIVDQDLVEWQIRVANGEPLPLSQSEVPLLGHAFEARIYAENVPKGFLPATGVLHHYH 395
           TE+I   DLVEWQIRVA+GE LP +Q ++PL GHA EARIYAE+  +GFLP+TG L  Y 
Sbjct: 300 TELITGIDLVEWQIRVASGEKLPFTQDDIPLNGHAIEARIYAEDPARGFLPSTGRLTRYR 359

Query: 396 PVPVSSKAVRVETGVEQGDTVSMHYDPMIANLWYGAKT----------------VAGVPT 439
           P P     VRV++GV +GD +S  YDPMIA L                      V G+ T
Sbjct: 360 P-PAGP-GVRVDSGVREGDEISPFYDPMIAKLIVHGADREEALDRLRRALAEFEVEGIAT 417

Query: 440 NINFLQKLAKHRAFESGDVETHFIEQHKDELFVKPSQSVSAEMNSAARLSATLVAACIFE 499
           NI FL+ L     F  GD++T FI +  ++LF       SA+  +AA L A         
Sbjct: 418 NIPFLRALMADPRFRGGDLDTGFIAREIEDLF--APAPASADALAAAALLAQPALE---- 471

Query: 500 KEKSTLKESPPGNHCLLSIWYTDPPFRVHHHARRIMEFEWENEHDDSGSKLLTLTVTYQA 559
                 +  P         W +   + V   A  +       E            V   A
Sbjct: 472 ---RRAESDP---------WASLSGWVVTGDAAELRVLIDGEERV---------EVRLPA 510

Query: 560 DGNYLIEMGEDGSYISEVKATYLGEHKFRVEFDVVSMDVHLAVYNKGRIKHIHAWHGLHH 619
                     D  +  E+ +  L   K  V        + L             W G   
Sbjct: 511 REGRERFYV-DSDWDPELASAALSGRKRAVRVARAGGGLTL------------FWGGGSP 557

Query: 620 H-HFKQKLGLELPDEDETQHKTSFETATGPPGSVLSPMAGLVVKVLANDGTKVEEGQPIL 678
                 KLG               + A    G +L+PM G VV V   +G +V  G  ++
Sbjct: 558 RIAELDKLGGA-------------KVAAASSGELLAPMPGTVVSVAVKEGQEVSAGDLLV 604

Query: 679 VLEAMKMEHVVKAPTTGVVHGLQVTAGQQVSDGSVLFRL 717
           VLEAMKME+ ++AP  GVV  L V  G QV+ G+VL   
Sbjct: 605 VLEAMKMENTLRAPRDGVVAKLAVAEGDQVAVGTVLVEF 643

Length = 645
>gnl|CDD|236307 PRK08591, PRK08591, acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>gnl|CDD|180406 PRK06111, PRK06111, acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>gnl|CDD|236325 PRK08654, PRK08654, pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|223516 COG0439, AccC, Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|129605 TIGR00514, accC, acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>gnl|CDD|180150 PRK05586, PRK05586, biotin carboxylase; Validated Back     alignment and domain information
>gnl|CDD|237263 PRK12999, PRK12999, pyruvate carboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|233980 TIGR02712, urea_carbox, urea carboxylase Back     alignment and domain information
>gnl|CDD|180865 PRK07178, PRK07178, pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|169452 PRK08463, PRK08463, acetyl-CoA carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|236269 PRK08462, PRK08462, biotin carboxylase; Validated Back     alignment and domain information
>gnl|CDD|183781 PRK12833, PRK12833, acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>gnl|CDD|223968 COG1038, PycA, Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase Back     alignment and domain information
>gnl|CDD|190425 pfam02786, CPSase_L_D2, Carbamoyl-phosphate synthase L chain, ATP binding domain Back     alignment and domain information
>gnl|CDD|201133 pfam00289, CPSase_L_chain, Carbamoyl-phosphate synthase L chain, N-terminal domain Back     alignment and domain information
>gnl|CDD|214878 smart00878, Biotin_carb_C, Biotin carboxylase C-terminal domain Back     alignment and domain information
>gnl|CDD|202395 pfam02785, Biotin_carb_C, Biotin carboxylase C-terminal domain Back     alignment and domain information
>gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>gnl|CDD|223585 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|236449 PRK09282, PRK09282, pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>gnl|CDD|201182 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme Back     alignment and domain information
>gnl|CDD|235826 PRK06549, PRK06549, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>gnl|CDD|237263 PRK12999, PRK12999, pyruvate carboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237592 PRK14040, PRK14040, oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|233273 TIGR01108, oadA, oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>gnl|CDD|223968 COG1038, PycA, Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase Back     alignment and domain information
>gnl|CDD|223534 COG0458, CarB, Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|224102 COG1181, DdlA, D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|233980 TIGR02712, urea_carbox, urea carboxylase Back     alignment and domain information
>gnl|CDD|235540 PRK05641, PRK05641, putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>gnl|CDD|181304 PRK08225, PRK08225, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>gnl|CDD|233310 TIGR01205, D_ala_D_alaTIGR, D-alanine--D-alanine ligase Back     alignment and domain information
>gnl|CDD|234948 PRK01372, ddl, D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>gnl|CDD|222206 pfam13535, ATP-grasp_4, ATP-grasp domain Back     alignment and domain information
>gnl|CDD|203643 pfam07478, Dala_Dala_lig_C, D-ala D-ala ligase C-terminus Back     alignment and domain information
>gnl|CDD|172536 PRK14042, PRK14042, pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|237215 PRK12815, carB, carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|233379 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>gnl|CDD|237215 PRK12815, carB, carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|233379 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>gnl|CDD|235010 PRK02186, PRK02186, argininosuccinate lyase; Provisional Back     alignment and domain information
>gnl|CDD|235777 PRK06302, PRK06302, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>gnl|CDD|233705 TIGR02068, cya_phycin_syn, cyanophycin synthetase Back     alignment and domain information
>gnl|CDD|234993 PRK01966, ddl, D-alanyl-alanine synthetase A; Reviewed Back     alignment and domain information
>gnl|CDD|180306 PRK05889, PRK05889, putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|180678 PRK06748, PRK06748, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|237586 PRK14016, PRK14016, cyanophycin synthetase; Provisional Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|233121 TIGR00768, rimK_fam, alpha-L-glutamate ligases, RimK family Back     alignment and domain information
>gnl|CDD|223582 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235393 PRK05294, carB, carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|215391 PLN02735, PLN02735, carbamoyl-phosphate synthase Back     alignment and domain information
>gnl|CDD|237195 PRK12767, PRK12767, carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205711 pfam13533, Biotin_lipoyl_2, Biotin-lipoyl like Back     alignment and domain information
>gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>gnl|CDD|235393 PRK05294, carB, carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>gnl|CDD|205711 pfam13533, Biotin_lipoyl_2, Biotin-lipoyl like Back     alignment and domain information
>gnl|CDD|173034 PRK14570, PRK14570, D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>gnl|CDD|188060 TIGR00531, BCCP, acetyl-CoA carboxylase, biotin carboxyl carrier protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 765
COG4770645 Acetyl/propionyl-CoA carboxylase, alpha subunit [L 100.0
KOG0238670 consensus 3-Methylcrotonyl-CoA carboxylase, biotin 100.0
COG1038 1149 PycA Pyruvate carboxylase [Energy production and c 100.0
KOG0369 1176 consensus Pyruvate carboxylase [Energy production 100.0
KOG0368 2196 consensus Acetyl-CoA carboxylase [Lipid transport 100.0
COG0439449 AccC Biotin carboxylase [Lipid metabolism] 100.0
TIGR01235 1143 pyruv_carbox pyruvate carboxylase. This enzyme pla 100.0
PRK08654499 pyruvate carboxylase subunit A; Validated 100.0
PRK12999 1146 pyruvate carboxylase; Reviewed 100.0
PRK07178472 pyruvate carboxylase subunit A; Validated 100.0
PRK08463478 acetyl-CoA carboxylase subunit A; Validated 100.0
PRK12833467 acetyl-CoA carboxylase biotin carboxylase subunit; 100.0
PRK05586447 biotin carboxylase; Validated 100.0
TIGR00514449 accC acetyl-CoA carboxylase, biotin carboxylase su 100.0
PRK08462445 biotin carboxylase; Validated 100.0
PRK08591451 acetyl-CoA carboxylase biotin carboxylase subunit; 100.0
TIGR02712 1201 urea_carbox urea carboxylase. Members of this fami 100.0
PRK06111450 acetyl-CoA carboxylase biotin carboxylase subunit; 100.0
PF02786211 CPSase_L_D2: Carbamoyl-phosphate synthase L chain, 100.0
PLN027351102 carbamoyl-phosphate synthase 100.0
TIGR01369 1050 CPSaseII_lrg carbamoyl-phosphate synthase, large s 100.0
TIGR01142380 purT phosphoribosylglycinamide formyltransferase 2 100.0
PLN02948577 phosphoribosylaminoimidazole carboxylase 100.0
PRK07206416 hypothetical protein; Provisional 100.0
PLN02735 1102 carbamoyl-phosphate synthase 100.0
PRK06019372 phosphoribosylaminoimidazole carboxylase ATPase su 100.0
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2 100.0
TIGR01161352 purK phosphoribosylaminoimidazole carboxylase, Pur 100.0
PRK02186 887 argininosuccinate lyase; Provisional 100.0
PRK05294 1066 carB carbamoyl phosphate synthase large subunit; R 100.0
TIGR013691050 CPSaseII_lrg carbamoyl-phosphate synthase, large s 100.0
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; R 100.0
PRK052941066 carB carbamoyl phosphate synthase large subunit; R 100.0
PRK128151068 carB carbamoyl phosphate synthase large subunit; R 100.0
PRK12767326 carbamoyl phosphate synthase-like protein; Provisi 100.0
PRK06395435 phosphoribosylamine--glycine ligase; Provisional 100.0
PRK13789426 phosphoribosylamine--glycine ligase; Provisional 100.0
TIGR00877423 purD phosphoribosylamine--glycine ligase. This enz 100.0
PRK00885420 phosphoribosylamine--glycine ligase; Provisional 100.0
PLN02257434 phosphoribosylamine--glycine ligase 100.0
PRK05784486 phosphoribosylamine--glycine ligase; Provisional 100.0
COG0458400 CarB Carbamoylphosphate synthase large subunit (sp 100.0
PRK13790379 phosphoribosylamine--glycine ligase; Provisional 100.0
PF15632329 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathwa 100.0
PRK01966333 ddl D-alanyl-alanine synthetase A; Reviewed 100.0
PRK14569296 D-alanyl-alanine synthetase A; Provisional 100.0
COG0027394 PurT Formate-dependent phosphoribosylglycinamide f 99.97
PRK06524493 biotin carboxylase-like protein; Validated 99.97
PRK01372304 ddl D-alanine--D-alanine ligase; Reviewed 99.97
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 99.97
PRK14572347 D-alanyl-alanine synthetase A; Provisional 99.97
PRK14568343 vanB D-alanine--D-lactate ligase; Provisional 99.97
PRK06849389 hypothetical protein; Provisional 99.97
COG0151428 PurD Phosphoribosylamine-glycine ligase [Nucleotid 99.97
PRK14570364 D-alanyl-alanine synthetase A; Provisional 99.97
TIGR01205315 D_ala_D_alaTIGR D-alanine--D-alanine ligase. but a 99.97
PRK14571299 D-alanyl-alanine synthetase A; Provisional 99.96
PRK14573809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 99.96
PF02785107 Biotin_carb_C: Biotin carboxylase C-terminal domai 99.93
PRK10446300 ribosomal protein S6 modification protein; Provisi 99.93
KOG03701435 consensus Multifunctional pyrimidine synthesis pro 99.93
TIGR00768277 rimK_fam alpha-L-glutamate ligases, RimK family. T 99.93
PF13535184 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 99.92
PRK13278358 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D 99.92
smart00878107 Biotin_carb_C Biotin carboxylase C-terminal domain 99.92
COG2232389 Predicted ATP-dependent carboligase related to bio 99.92
TIGR02144280 LysX_arch Lysine biosynthesis enzyme LysX. The fam 99.91
PRK13277366 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribo 99.91
COG1181317 DdlA D-alanine-D-alanine ligase and related ATP-gr 99.89
PF00289110 CPSase_L_chain: Carbamoyl-phosphate synthase L cha 99.89
TIGR03103547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 99.89
PF07478203 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; In 99.88
KOG0237788 consensus Glycinamide ribonucleotide synthetase (G 99.87
PRK14016727 cyanophycin synthetase; Provisional 99.86
KOG0370 1435 consensus Multifunctional pyrimidine synthesis pro 99.86
PF02222172 ATP-grasp: ATP-grasp domain; InterPro: IPR003135 T 99.86
COG3919415 Predicted ATP-grasp enzyme [General function predi 99.83
), forming GARS-AIRS-GART. This entry represents the A-domain of the enzyme, and is related to the ATP-grasp domain of biotin carboxylase/carbamoyl phosphate synthetase.; PDB: 1GSO_A 3LP8_A 2IP4_A 1VKZ_A 2QK4_A 2XD4_A 2XCL_A 3MJF_A 2YRW_A 2YS6_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF01071">PF01071194 GARS_A: Phosphoribosylglycinamide synthetase, ATP- 99.82
PF02655161 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 99.79
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabo 99.79
COG0189318 RimK Glutathione synthase/Ribosomal protein S6 mod 99.79
PF08443190 RimK: RimK-like ATP-grasp domain; InterPro: IPR013 99.77
PRK05641153 putative acetyl-CoA carboxylase biotin carboxyl ca 99.76
PRK06549130 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.72
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl ca 99.68
COG1821307 Predicted ATP-utilizing enzyme (ATP-grasp superfam 99.67
PRK12458338 glutathione synthetase; Provisional 99.67
PRK14042596 pyruvate carboxylase subunit B; Provisional 99.66
TIGR02068864 cya_phycin_syn cyanophycin synthetase. Cyanophycin 99.65
PRK02471752 bifunctional glutamate--cysteine ligase/glutathion 99.64
TIGR01435737 glu_cys_lig_rel glutamate--cysteine ligase/gamma-g 99.63
PRK0674883 hypothetical protein; Validated 99.62
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.61
PLN02941328 inositol-tetrakisphosphate 1-kinase 99.6
PF0036474 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: 99.59
PRK09282592 pyruvate carboxylase subunit B; Validated 99.58
PRK05246316 glutathione synthetase; Provisional 99.54
TIGR01380312 glut_syn glutathione synthetase, prokaryotic. This 99.53
TIGR00531156 BCCP acetyl-CoA carboxylase, biotin carboxyl carri 99.52
COG1759361 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofu 99.51
PRK14040593 oxaloacetate decarboxylase; Provisional 99.5
PRK0705180 hypothetical protein; Validated 99.5
TIGR01108582 oadA oxaloacetate decarboxylase alpha subunit. Thi 99.5
PLN02983274 biotin carboxyl carrier protein of acetyl-CoA carb 99.49
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.46
TIGR02291317 rimK_rel_E_lig alpha-L-glutamate ligase-related pr 99.44
cd0685067 biotinyl_domain The biotinyl-domain or biotin carb 99.4
TIGR027121201 urea_carbox urea carboxylase. Members of this fami 99.25
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar 99.23
PLN02226 463 2-oxoglutarate dehydrogenase E2 component 99.22
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.18
PTZ00144 418 dihydrolipoamide succinyltransferase; Provisional 99.18
PRK05704 407 dihydrolipoamide succinyltransferase; Validated 99.06
TIGR01016386 sucCoAbeta succinyl-CoA synthetase, beta subunit. 98.98
PF14397285 ATPgrasp_ST: Sugar-transfer associated ATP-grasp 98.96
TIGR01347 403 sucB 2-oxoglutarate dehydrogenase complex dihydrol 98.96
COG0508 404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex 98.93
PRK11854 633 aceF pyruvate dehydrogenase dihydrolipoyltransacet 98.9
PRK11854 633 aceF pyruvate dehydrogenase dihydrolipoyltransacet 98.89
PF14398262 ATPgrasp_YheCD: YheC/D like ATP-grasp 98.87
PRK00696388 sucC succinyl-CoA synthetase subunit beta; Provisi 98.87
PLN02528 416 2-oxoisovalerate dehydrogenase E2 component 98.82
TIGR01348 546 PDHac_trf_long pyruvate dehydrogenase complex dihy 98.8
TIGR02927 590 SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo 98.78
TIGR01348 546 PDHac_trf_long pyruvate dehydrogenase complex dihy 98.77
PRK11855 547 dihydrolipoamide acetyltransferase; Reviewed 98.7
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl a 98.68
PRK11855 547 dihydrolipoamide acetyltransferase; Reviewed 98.6
PRK11856 411 branched-chain alpha-keto acid dehydrogenase subun 98.58
TIGR01349 435 PDHac_trf_mito pyruvate dehydrogenase complex dihy 98.54
PF13549222 ATP-grasp_5: ATP-grasp domain; PDB: 1WR2_A. 98.52
PRK11892 464 pyruvate dehydrogenase subunit beta; Provisional 98.48
PLN02744 539 dihydrolipoyllysine-residue acetyltransferase comp 98.47
TIGR02927 590 SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo 98.39
KOG0559 457 consensus Dihydrolipoamide succinyltransferase (2- 98.36
PRK14046392 malate--CoA ligase subunit beta; Provisional 98.34
PF05770307 Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6- 98.34
COG0045387 SucC Succinyl-CoA synthetase, beta subunit [Energy 98.3
KOG0557 470 consensus Dihydrolipoamide acetyltransferase [Ener 98.23
PRK13380144 glycine cleavage system protein H; Provisional 98.22
PRK09783 409 copper/silver efflux system membrane fusion protei 98.21
PLN00124422 succinyl-CoA ligase [GDP-forming] subunit beta; Pr 98.16
TIGR00998334 8a0101 efflux pump membrane protein (multidrug res 98.13
cd0684896 GCS_H Glycine cleavage H-protein. Glycine cleavage 98.13
PRK01202127 glycine cleavage system protein H; Provisional 98.06
PF02955173 GSH-S_ATP: Prokaryotic glutathione synthetase, ATP 98.05
PRK10476346 multidrug resistance protein MdtN; Provisional 98.05
PRK10559310 p-hydroxybenzoic acid efflux subunit AaeA; Provisi 98.05
PLN02235423 ATP citrate (pro-S)-lyase 98.03
PF08442202 ATP-grasp_2: ATP-grasp domain; InterPro: IPR013650 98.03
TIGR03077110 not_gcvH glycine cleavage protein H-like protein, 97.96
TIGR01730 322 RND_mfp RND family efflux transporter, MFP subunit 97.92
PRK15136390 multidrug efflux system protein EmrA; Provisional 97.9
PRK03598331 putative efflux pump membrane fusion protein; Prov 97.9
PF14305239 ATPgrasp_TupA: TupA-like ATPgrasp 97.88
PF1353350 Biotin_lipoyl_2: Biotin-lipoyl like 97.88
KOG0558 474 consensus Dihydrolipoamide transacylase (alpha-ket 97.88
PRK15030 397 multidrug efflux system transporter AcrA; Provisio 97.87
PRK09578 385 periplasmic multidrug efflux lipoprotein precursor 97.83
PRK09859 385 multidrug efflux system protein MdtE; Provisional 97.8
), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02844">PF02844100 GARS_N: Phosphoribosylglycinamide synthetase, N do 97.7
PRK00624114 glycine cleavage system protein H; Provisional 97.7
TIGR00527127 gcvH glycine cleavage system H protein. The genome 97.67
PRK1278484 hypothetical protein; Provisional 97.61
PRK11578 370 macrolide transporter subunit MacA; Provisional 97.6
PRK11556 415 multidrug efflux system subunit MdtA; Provisional 97.59
TIGR03309256 matur_yqeB selenium-dependent molybdenum hydroxyla 97.52
PF02750203 Synapsin_C: Synapsin, ATP binding domain; InterPro 97.45
PF12700 328 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 97.43
PRK05641153 putative acetyl-CoA carboxylase biotin carboxyl ca 97.34
PF1353350 Biotin_lipoyl_2: Biotin-lipoyl like 97.34
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 97.31
TIGR02971 327 heterocyst_DevB ABC exporter membrane fusion prote 97.29
TIGR03794421 NHPM_micro_HlyD NHPM bacteriocin system secretion 96.99
PF03133292 TTL: Tubulin-tyrosine ligase family; InterPro: IPR 96.91
PF14403445 CP_ATPgrasp_2: Circularly permuted ATP-grasp type 96.91
COG1566352 EmrA Multidrug resistance efflux pump [Defense mec 96.89
PF01597122 GCV_H: Glycine cleavage H-protein; InterPro: IPR00 96.87
PF13375101 RnfC_N: RnfC Barrel sandwich hybrid domain 96.86
KOG3895488 consensus Synaptic vesicle protein Synapsin [Signa 96.78
PF06973188 DUF1297: Domain of unknown function (DUF1297); Int 96.67
PF06849124 DUF1246: Protein of unknown function (DUF1246); In 96.61
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl ca 96.58
PF11379355 DUF3182: Protein of unknown function (DUF3182); In 96.5
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier pro 96.46
COG0509131 GcvH Glycine cleavage system H protein (lipoate-bi 96.38
cd06252316 M14_ASTE_ASPA_like_2 A functionally uncharacterize 96.21
cd06253298 M14_ASTE_ASPA_like_3 A functionally uncharacterize 96.14
TIGR00999265 8a0102 Membrane Fusion Protein cluster 2 (function 96.14
cd06251287 M14_ASTE_ASPA_like_1 A functionally uncharacterize 96.09
PF13437105 HlyD_3: HlyD family secretion protein 96.07
PRK0705180 hypothetical protein; Validated 96.03
TIGR012351143 pyruv_carbox pyruvate carboxylase. This enzyme pla 95.94
TIGR02994325 ectoine_eutE ectoine utilization protein EutE. Mem 95.9
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 95.84
PRK0674883 hypothetical protein; Validated 95.8
PRK08057248 cobalt-precorrin-6x reductase; Reviewed 95.78
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabo 95.72
COG3608331 Predicted deacylase [General function prediction o 95.63
PRK09282592 pyruvate carboxylase subunit B; Validated 95.58
cd06250359 M14_PaAOTO_like An uncharacterized subgroup of the 95.55
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 95.3
cd06254288 M14_ASTE_ASPA_like_4 A functionally uncharacterize 95.28
PF13437105 HlyD_3: HlyD family secretion protein 95.11
cd00210124 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose s 95.07
cd0685067 biotinyl_domain The biotinyl-domain or biotin carb 95.03
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 95.02
PF02571249 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: 95.0
COG2099257 CobK Precorrin-6x reductase [Coenzyme metabolism] 94.8
PRK09439169 PTS system glucose-specific transporter subunit; P 94.72
TIGR00830121 PTBA PTS system, glucose subfamily, IIA component. 94.67
PF0036474 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: 94.3
PF05896 257 NQRA: Na(+)-translocating NADH-quinone reductase s 94.19
PRK06549130 acetyl-CoA carboxylase biotin carboxyl carrier pro 94.09
PF14243130 DUF4343: Domain of unknown function (DUF4343) 94.02
PF00529 305 HlyD: HlyD family secretion protein the correspond 93.79
COG2190156 NagE Phosphotransferase system IIA components [Car 93.56
PF00358132 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar ph 93.49
TIGR00998334 8a0101 efflux pump membrane protein (multidrug res 93.44
PRK14042596 pyruvate carboxylase subunit B; Provisional 92.96
PF09891150 DUF2118: Uncharacterized protein conserved in arch 92.94
PRK10476346 multidrug resistance protein MdtN; Provisional 92.93
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier pro 92.8
TIGR00531156 BCCP acetyl-CoA carboxylase, biotin carboxyl carri 92.78
TIGR01936 447 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo 92.64
PRK05352 448 Na(+)-translocating NADH-quinone reductase subunit 92.33
PRK09439169 PTS system glucose-specific transporter subunit; P 92.12
COG2190156 NagE Phosphotransferase system IIA components [Car 91.96
PRK04148134 hypothetical protein; Provisional 91.89
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar 91.84
PRK05849 783 hypothetical protein; Provisional 91.71
PRK11556 415 multidrug efflux system subunit MdtA; Provisional 91.69
cd06255293 M14_ASTE_ASPA_like_5 A functionally uncharacterize 91.67
PRK03598331 putative efflux pump membrane fusion protein; Prov 91.47
KOG2156662 consensus Tubulin-tyrosine ligase-related protein 91.45
PF00529 305 HlyD: HlyD family secretion protein the correspond 91.22
CHL00194317 ycf39 Ycf39; Provisional 91.02
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 90.98
KOG0368 2196 consensus Acetyl-CoA carboxylase [Lipid transport 90.79
TIGR01945 435 rnfC electron transport complex, RnfABCDGE type, C 90.73
PRK11578 370 macrolide transporter subunit MacA; Provisional 90.7
PRK09578 385 periplasmic multidrug efflux lipoprotein precursor 90.59
PRK09859 385 multidrug efflux system protein MdtE; Provisional 90.57
PLN02983274 biotin carboxyl carrier protein of acetyl-CoA carb 90.56
COG1726 447 NqrA Na+-transporting NADH:ubiquinone oxidoreducta 90.4
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 90.34
KOG2799434 consensus Succinyl-CoA synthetase, beta subunit [E 90.07
TIGR02971 327 heterocyst_DevB ABC exporter membrane fusion prote 89.98
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 89.97
COG0569225 TrkA K+ transport systems, NAD-binding component [ 89.9
PF04952292 AstE_AspA: Succinylglutamate desuccinylase / Aspar 89.82
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 89.51
PRK15136 390 multidrug efflux system protein EmrA; Provisional 89.51
TIGR03794421 NHPM_micro_HlyD NHPM bacteriocin system secretion 89.38
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 89.34
PRK10255648 PTS system N-acetyl glucosamine specific transport 89.1
PRK10559 310 p-hydroxybenzoic acid efflux subunit AaeA; Provisi 89.02
KOG0559 457 consensus Dihydrolipoamide succinyltransferase (2- 88.96
TIGR01730 322 RND_mfp RND family efflux transporter, MFP subunit 88.88
PRK05035 695 electron transport complex protein RnfC; Provision 88.77
KOG3373172 consensus Glycine cleavage system H protein (lipoa 88.72
PRK15030 397 multidrug efflux system transporter AcrA; Provisio 88.66
TIGR01995610 PTS-II-ABC-beta PTS system, beta-glucoside-specifi 88.56
TIGR00999265 8a0102 Membrane Fusion Protein cluster 2 (function 88.51
PRK14040593 oxaloacetate decarboxylase; Provisional 88.46
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 88.44
TIGR01995610 PTS-II-ABC-beta PTS system, beta-glucoside-specifi 88.19
TIGR00830121 PTBA PTS system, glucose subfamily, IIA component. 88.18
PRK09824627 PTS system beta-glucoside-specific transporter sub 88.16
PRK06988312 putative formyltransferase; Provisional 88.13
PLN02226 463 2-oxoglutarate dehydrogenase E2 component 88.11
PRK09824627 PTS system beta-glucoside-specific transporter sub 88.1
PF06898385 YqfD: Putative stage IV sporulation protein YqfD; 87.99
TIGR01108582 oadA oxaloacetate decarboxylase alpha subunit. Thi 87.9
PF12700 328 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 87.53
PRK129991146 pyruvate carboxylase; Reviewed 87.27
KOG2157497 consensus Predicted tubulin-tyrosine ligase [Postt 87.03
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 86.93
COG2910211 Putative NADH-flavin reductase [General function p 86.72
TIGR02876382 spore_yqfD sporulation protein YqfD. YqfD is part 86.71
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 86.69
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 86.55
PTZ00144 418 dihydrolipoamide succinyltransferase; Provisional 86.34
PF00358132 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar ph 86.23
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 85.96
KOG0238670 consensus 3-Methylcrotonyl-CoA carboxylase, biotin 85.82
PF01820117 Dala_Dala_lig_N: D-ala D-ala ligase N-terminus; In 85.58
PRK10255648 PTS system N-acetyl glucosamine specific transport 85.43
COG4656 529 RnfC Predicted NADH:ubiquinone oxidoreductase, sub 85.37
COG4770645 Acetyl/propionyl-CoA carboxylase, alpha subunit [L 85.26
cd00210124 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose s 85.22
PLN00016378 RNA-binding protein; Provisional 85.05
KOG1057 1018 consensus Arp2/3 complex-interacting protein VIP1/ 84.96
PRK06719157 precorrin-2 dehydrogenase; Validated 84.9
PRK10669558 putative cation:proton antiport protein; Provision 84.46
PLN02775286 Probable dihydrodipicolinate reductase 84.36
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 84.27
PF07065299 D123: D123; InterPro: IPR009772 This family contai 83.58
PRK06718202 precorrin-2 dehydrogenase; Reviewed 83.51
PLN02695370 GDP-D-mannose-3',5'-epimerase 83.27
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 83.16
PRK13303265 L-aspartate dehydrogenase; Provisional 82.99
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 82.84
PRK12446352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 82.7
COG4072161 Uncharacterized protein conserved in archaea [Func 82.6
TIGR03309256 matur_yqeB selenium-dependent molybdenum hydroxyla 82.56
TIGR03025445 EPS_sugtrans exopolysaccharide biosynthesis polypr 82.42
PLN02572442 UDP-sulfoquinovose synthase 82.36
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 82.34
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 82.27
KOG03691176 consensus Pyruvate carboxylase [Energy production 82.27
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 82.07
PRK09783 409 copper/silver efflux system membrane fusion protei 82.05
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 81.99
COG0508 404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex 81.69
PRK05878530 pyruvate phosphate dikinase; Provisional 81.66
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 81.51
PRK03562621 glutathione-regulated potassium-efflux system prot 81.5
COG10381149 PycA Pyruvate carboxylase [Energy production and c 81.4
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 81.39
PRK05704 407 dihydrolipoamide succinyltransferase; Validated 80.47
PF0155196 Peptidase_M23: Peptidase family M23; InterPro: IPR 80.38
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl a 80.35
PRK05693274 short chain dehydrogenase; Provisional 80.27
COG0845 372 AcrA Membrane-fusion protein [Cell envelope biogen 80.08
TIGR03023451 WcaJ_sugtrans Undecaprenyl-phosphate glucose phosp 80.02
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information 
Probab=100.00  E-value=8.2e-141  Score=1139.73  Aligned_cols=629  Identities=49%  Similarity=0.780  Sum_probs=564.3

Q ss_pred             CCCEEEEEcCcHHHHHHHHHHHHCCCeEEEEecCCCCCCcccccccEEEEcCCCCcCcCCCCHHHHHHHHHHhCCCEEEe
Q 041518           36 RIEKILIANRGEIAYRIMRTAKRLGIRTVAVYSDADRDSLHVKSADEAIRIGPPPARLSYLNGSSIVDAAIRTGAQAIHP  115 (765)
Q Consensus        36 ~~kkILI~g~G~~a~~iiraar~~Gi~vvav~s~~d~~~~~~~~aD~~~~i~~~~~~~syld~~~Il~~a~~~~~DaV~p  115 (765)
                      ||+||||+||||||||+||+||++|+++|+||+++|.+++|+++||++++|+|.+..+||++.++|+++|++.++|+|||
T Consensus         1 mf~KiLIANRGEIAcRVIRtar~lGi~tVAVYSdaDa~A~hV~~ADEAv~iGpapaaeSYL~~dkIi~Aa~~tGA~AIHP   80 (645)
T COG4770           1 MFSKILIANRGEIACRVIRTARDLGIRTVAVYSDADADALHVRMADEAVHIGPAPAAESYLDIDKIIDAARRTGAQAIHP   80 (645)
T ss_pred             CcceEEEeccchhhHHHHHHHHHcCCceEEEEecCCCCchhhhhcchhhhcCCCchhhhhccHHHHHHHHHHhCcccccC
Confidence            78999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcccccHHHHHHHHHCCCcEECCcHHHHHHhcCHHHHHHHHHHCCCCCCCccccCCCCHHHHHHHHHHhCCcEEEeec
Q 041518          116 GYGFLSESADFAQLCGDNGLTFIGPPVSAIRDMGDKSASKRIMGAAGVPLVPGYHGNEQDIDLMKSEAAKIGYPILIKPT  195 (765)
Q Consensus       116 g~g~lsE~~~~a~~~~~~Gl~~~Gp~~eai~~~~DK~~~r~~l~~~Gvpvp~~~~~~~~s~~e~~~~~~~ig~PvVVKP~  195 (765)
                      ||||||||+.|+++|++.|+.|+||++++++.|+||...|+++.++|+|+.|++....++.+++.++++++|||++||++
T Consensus        81 GYGFLSENa~FA~a~~~aGlvfIGP~~~aI~aMGdK~~AK~l~~~AgVp~VPG~~g~~qd~~~~~~~A~eiGyPVlIKAs  160 (645)
T COG4770          81 GYGFLSENADFAQAVEDAGLVFIGPSAGAIRAMGDKIAAKKLAAEAGVPTVPGYHGPIQDAAELVAIAEEIGYPVLIKAS  160 (645)
T ss_pred             CccccccCHHHHHHHHHCCcEEECCCHHHHHHhccHHHHHHHHHHcCCCccCCCCCcccCHHHHHHHHHhcCCcEEEEec
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCccEEEECChhHHHHHHHHHHHHHHhcCCCCcEEEecccCCCeeEEEEEEEeccccEEEEEeeeccccccceeeee
Q 041518          196 HGGGGKGMRIVQSPNDFVDSFLGAQREAAASFGINTILLEKYITQPRHIEVQIFGDKYGKVLHLYERDCSVQRRHQKIIE  275 (765)
Q Consensus       196 ~g~Gg~Gv~~v~s~~el~~a~~~~~~ea~~~fg~~~vlVEeyI~ggrei~v~v~~d~~g~vv~l~~r~~s~~~~~~k~~e  275 (765)
                      .|+|||||+++++.+|+.++++.+++|+.++||++.++||+|+..+||+++|||+|+|||++++++||||+||||||++|
T Consensus       161 aGGGGKGMRvv~~~~e~~e~l~sarrEA~asFGddrv~iEkyl~~PRHIEiQV~aD~HGNvv~LgERdCSlQRRhQKVIE  240 (645)
T COG4770         161 AGGGGKGMRVVETPEEFAEALESARREAKASFGDDRVFIEKYLDKPRHIEIQVFADQHGNVVHLGERDCSLQRRHQKVIE  240 (645)
T ss_pred             cCCCCCceEeecCHHHHHHHHHHHHHHHHhhcCCceEehhhhcCCCceEEEEEEecCCCCEEEeeccccchhhhcchhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecCCCCCCHHHHHHHHHHHHHHHHHcCCCceeEEEEEEECCCCcEEEEEecccCCccccccceecCCCHHHHHHHHHcCC
Q 041518          276 EAPAPNVTHDFRALLGQAAVSAAKAVSYHNAGTVEFIVDTVSDQFYFMEMNTRLQVEHPVTEMIVDQDLVEWQIRVANGE  355 (765)
Q Consensus       276 ~~Pa~~l~~~~~~~l~~~a~~i~~alg~~G~~~vEf~~~~~~g~~~~iEiN~R~~~~~~~~e~~tGvDl~~~~i~~a~G~  355 (765)
                      ++|+|.|+++++++|.+.++++++++||.|++||||+++. ++.|||||||+|+|++||+||++||+||++||+|+|.|+
T Consensus       241 EAPaP~l~~~~R~amg~aAv~~a~avgY~gAGTVEFivd~-~~~f~FlEMNTRLQVEHPVTE~iTGiDLVewqiRVA~Ge  319 (645)
T COG4770         241 EAPAPFLTEETREAMGEAAVAAAKAVGYVGAGTVEFIVDA-DGNFYFLEMNTRLQVEHPVTELITGIDLVEWQIRVASGE  319 (645)
T ss_pred             cCCCCCCCHHHHHHHHHHHHHHHHhcCCCcCceEEEEEcC-CCcEEEEEeecceeccccchhhhhhhHHHHHHHHHhcCC
Confidence            9999999999999999999999999999999999999998 888999999999999999999999999999999999999


Q ss_pred             CCCCCCCCcccceEEEEEEecccCCCCCCCCCCcceeEEeeCCCCCCcEEEEecccCCCeeCCccCCcceEEEEEe----
Q 041518          356 PLPLSQSEVPLLGHAFEARIYAENVPKGFLPATGVLHHYHPVPVSSKAVRVETGVEQGDTVSMHYDPMIANLWYGA----  431 (765)
Q Consensus       356 ~l~~~~~~~~~~g~ai~~ri~ae~p~~~f~p~~G~i~~~~~p~~~~~~vrv~~~v~~G~~v~~~~d~~~~~~i~~g----  431 (765)
                      +|++.|.+++++||||++|||+|||.++|+|++|+|..+++|. +++ ||+|++|..|+.|++||||||+|||+||    
T Consensus       320 kL~~~Q~di~l~GhAiE~RiyAEDp~r~FLPs~G~l~~~~~P~-~~~-vRvDsGV~~G~~Is~~YDpMiAKLi~~G~dR~  397 (645)
T COG4770         320 KLPFTQDDIPLNGHAIEARIYAEDPARGFLPSTGRLTRYRPPA-GPG-VRVDSGVREGDEISPFYDPMIAKLIVHGADRE  397 (645)
T ss_pred             cCCcccccccccceeEEEEEeccCcccCccCCCceeEeecCCC-CCc-eecccCcccCCccccccchHHHHHhhcCCCHH
Confidence            9999999999999999999999999999999999999999998 688 9999999999999999999999999999    


Q ss_pred             -----------e-EEeccccCHHHHHHHhcCcCcccCccccccccccccccccCCCCchhhhhhhhhhHHHHHHHHHHHH
Q 041518          432 -----------K-TVAGVPTNINFLQKLAKHRAFESGDVETHFIEQHKDELFVKPSQSVSAEMNSAARLSATLVAACIFE  499 (765)
Q Consensus       432 -----------~-~i~g~~tn~~~l~~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~aa~~~~~  499 (765)
                                 + .|.|+.||++||++++.||+|+.|+.+|+||.+++++++.....           ...+++++++..
T Consensus       398 eAl~rl~~AL~~~~v~Gi~tn~~Fl~al~~~~~F~~g~~~T~~i~r~~~~~~~~~~~-----------~~~~~aa~~~~~  466 (645)
T COG4770         398 EALDRLRRALAEFEVEGIATNIPFLRALMADPRFRGGDLDTGFIAREIEDLFAPAPA-----------SADALAAAALLA  466 (645)
T ss_pred             HHHHHHHHHHHhhEecCccccHHHHHHHhcCcccccCCCcceeeeecccccccCCCc-----------hhhhHHHHHhhh
Confidence                       6 99999999999999999999999999999999999999843332           123333333333


Q ss_pred             hhhccccCCCCCCCcccCccccCCCceeccCceeEEEEEECCcccCCCceeEEEEEEEecCccEEEEECCCceEEEEEEE
Q 041518          500 KEKSTLKESPPGNHCLLSIWYTDPPFRVHHHARRIMEFEWENEHDDSGSKLLTLTVTYQADGNYLIEMGEDGSYISEVKA  579 (765)
Q Consensus       500 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~v~~~~~~~~~v~~~~~~~~~v~~~~  579 (765)
                      ..... .+    ..  .+||+...+|+++........+...+.       ...+++... ++...+        .+..  
T Consensus       467 ~~~~~-~~----~~--~~pw~~~~~w~~~~~~~~~~~~~~~~~-------~~~v~l~~~-~g~~~~--------~~~~--  521 (645)
T COG4770         467 QPALE-RR----AE--SDPWASLSGWVVTGDAAELRVLIDGEE-------RVEVRLPAR-EGRERF--------YVDS--  521 (645)
T ss_pred             chhhh-cc----cc--cCcccccCCceeecceeeeeEEecCCc-------ceEEEEecc-CCccee--------eeec--
Confidence            22100 11    12  379999899999876554333332332       333444322 221111        1111  


Q ss_pred             EEeCCceEEEEECCEEEEEEEEEeecccceEEEEEeCCeeEEEEEecCCCCCCccccccccccccCCCCCCcccCCCcce
Q 041518          580 TYLGEHKFRVEFDVVSMDVHLAVYNKGRIKHIHAWHGLHHHHFKQKLGLELPDEDETQHKTSFETATGPPGSVLSPMAGL  659 (765)
Q Consensus       580 ~~~~~~~l~~~~~G~~~~~~~~~~~~~~~~~~~v~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~ap~~G~  659 (765)
                       ........+.++|.....++...+    +.++|+..|..+.+...++...           .+...+.+..|+|||||+
T Consensus       522 -~~~~~~~~~~~~~~~~~~~~~~~~----~~~~l~~~g~~~~~~~~~~~~~-----------~~~~~~~~~~l~aPMpG~  585 (645)
T COG4770         522 -DWDPELASAALSGRKRAVRVARAG----GGLTLFWGGGSPRIAELDKLGG-----------AKVAAASSGELLAPMPGT  585 (645)
T ss_pred             -cCCccceeEEecCccccceeeecC----CceEEecCCcCccccccccccc-----------ccccCCCCCceecCCCce
Confidence             122245778899999888888887    8999999998777765544332           344556678899999999


Q ss_pred             EEEEEcCCCCeecCCCeEEEEEecceEEEEEcCCCeEEEEEEcCCCCccCCCCeEEEEEe
Q 041518          660 VVKVLANDGTKVEEGQPILVLEAMKMEHVVKAPTTGVVHGLQVTAGQQVSDGSVLFRLQA  719 (765)
Q Consensus       660 v~~~~v~~Gd~V~~G~~l~~~eamKm~~~i~ap~~G~v~~~~~~~G~~v~~g~~l~~i~~  719 (765)
                      |+.|.|++|+.|.+||+|++||||||||.|+||.+|+|+++.+++|++|..|++|++|++
T Consensus       586 v~~v~V~~G~~V~~G~~lvvlEAMKME~~l~A~~dG~V~~v~v~~Gd~V~~g~vLve~~~  645 (645)
T COG4770         586 VVSVAVKEGQEVSAGDLLVVLEAMKMENTLRAPRDGVVAKLAVAEGDQVAVGTVLVEFEE  645 (645)
T ss_pred             EEEEEecCCCEecCCCeEEEeEehhcccceecCcCcEEEEEEecCCCccccCceEEEecC
Confidence            999999999999999999999999999999999999999999999999999999999863

>KOG0238 consensus 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>KOG0369 consensus Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>KOG0368 consensus Acetyl-CoA carboxylase [Lipid transport and metabolism] Back     alignment and domain information
>COG0439 AccC Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PRK08654 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK07178 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK08463 acetyl-CoA carboxylase subunit A; Validated Back     alignment and domain information
>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>PRK05586 biotin carboxylase; Validated Back     alignment and domain information
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>PRK08462 biotin carboxylase; Validated Back     alignment and domain information
>PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase Back     alignment and domain information
>PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PF02786 CPSase_L_D2: Carbamoyl-phosphate synthase L chain, ATP binding domain; InterPro: IPR005479 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>PRK07206 hypothetical protein; Provisional Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>PRK02186 argininosuccinate lyase; Provisional Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>PRK06395 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK13789 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>TIGR00877 purD phosphoribosylamine--glycine ligase Back     alignment and domain information
>PRK00885 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PLN02257 phosphoribosylamine--glycine ligase Back     alignment and domain information
>PRK05784 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>COG0458 CarB Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13790 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PF15632 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathway with Ter operon Back     alignment and domain information
>PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed Back     alignment and domain information
>PRK14569 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06524 biotin carboxylase-like protein; Validated Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14572 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK14568 vanB D-alanine--D-lactate ligase; Provisional Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14570 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase Back     alignment and domain information
>PRK14571 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PF02785 Biotin_carb_C: Biotin carboxylase C-terminal domain; InterPro: IPR005482 Acetyl-CoA carboxylase is found in all animals, plants, and bacteria and catalyzes the first committed step in fatty acid synthesis Back     alignment and domain information
>PRK10446 ribosomal protein S6 modification protein; Provisional Back     alignment and domain information
>KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>TIGR00768 rimK_fam alpha-L-glutamate ligases, RimK family Back     alignment and domain information
>PF13535 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 3LN7_B 2PN1_A 4DIM_A Back     alignment and domain information
>PRK13278 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase; Provisional Back     alignment and domain information
>smart00878 Biotin_carb_C Biotin carboxylase C-terminal domain Back     alignment and domain information
>COG2232 Predicted ATP-dependent carboligase related to biotin carboxylase [General function prediction only] Back     alignment and domain information
>TIGR02144 LysX_arch Lysine biosynthesis enzyme LysX Back     alignment and domain information
>PRK13277 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase-like protein; Provisional Back     alignment and domain information
>COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF00289 CPSase_L_chain: Carbamoyl-phosphate synthase L chain, N-terminal domain; InterPro: IPR005481 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PF07478 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; InterPro: IPR011095 This entry represents the C-terminal, catalytic domain of the D-alanine--D-alanine ligase enzyme 6 Back     alignment and domain information
>KOG0237 consensus Glycinamide ribonucleotide synthetase (GARS)/Aminoimidazole ribonucleotide synthetase (AIRS) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14016 cyanophycin synthetase; Provisional Back     alignment and domain information
>KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>PF02222 ATP-grasp: ATP-grasp domain; InterPro: IPR003135 The ATP-grasp domain has an unusual nucleotide-binding fold, also referred to as palmate, and is found in a superfamily of enzymes including D-alanine-D-alanine ligase, glutathione synthetase, biotin carboxylase, and carbamoyl phosphate synthetase, the ribosomal protein S6 modification enzyme (RimK), urea amidolyase, tubulin-tyrosine ligase, and three enzymes of purine biosynthesis Back     alignment and domain information
>COG3919 Predicted ATP-grasp enzyme [General function prediction only] Back     alignment and domain information
>PF01071 GARS_A: Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain; InterPro: IPR020561 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PF02655 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 The ATP-grasp fold is one of several distinct ATP-binding folds, and is found in enzymes that catalyze the formation of amide bonds, catalyzing the ATP-dependent ligation of a carboxylate-containing molecule to an amino or thiol group-containing molecule [] Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08443 RimK: RimK-like ATP-grasp domain; InterPro: IPR013651 This ATP-grasp domain is found in the ribosomal S6 modification enzyme RimK [] Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>COG1821 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) [General function prediction only] Back     alignment and domain information
>PRK12458 glutathione synthetase; Provisional Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>TIGR02068 cya_phycin_syn cyanophycin synthetase Back     alignment and domain information
>PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional Back     alignment and domain information
>TIGR01435 glu_cys_lig_rel glutamate--cysteine ligase/gamma-glutamylcysteine synthetase, Streptococcus agalactiae type Back     alignment and domain information
>PRK06748 hypothetical protein; Validated Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PLN02941 inositol-tetrakisphosphate 1-kinase Back     alignment and domain information
>PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK05246 glutathione synthetase; Provisional Back     alignment and domain information
>TIGR01380 glut_syn glutathione synthetase, prokaryotic Back     alignment and domain information
>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein Back     alignment and domain information
>COG1759 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate synthetase (purine biosynthesis) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR02291 rimK_rel_E_lig alpha-L-glutamate ligase-related protein Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>PLN02226 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>TIGR01016 sucCoAbeta succinyl-CoA synthetase, beta subunit Back     alignment and domain information
>PF14397 ATPgrasp_ST: Sugar-transfer associated ATP-grasp Back     alignment and domain information
>TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>PF14398 ATPgrasp_YheCD: YheC/D like ATP-grasp Back     alignment and domain information
>PRK00696 sucC succinyl-CoA synthetase subunit beta; Provisional Back     alignment and domain information
>PLN02528 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>PF13549 ATP-grasp_5: ATP-grasp domain; PDB: 1WR2_A Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>KOG0559 consensus Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion] Back     alignment and domain information
>PRK14046 malate--CoA ligase subunit beta; Provisional Back     alignment and domain information
>PF05770 Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6-kinase; InterPro: IPR008656 This entry represents inositol-tetrakisphosphate 1-kinase which is also called inositol 1,3,4-trisphosphate 5/6-kinase Back     alignment and domain information
>COG0045 SucC Succinyl-CoA synthetase, beta subunit [Energy production and conversion] Back     alignment and domain information
>KOG0557 consensus Dihydrolipoamide acetyltransferase [Energy production and conversion] Back     alignment and domain information
>PRK13380 glycine cleavage system protein H; Provisional Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>PLN00124 succinyl-CoA ligase [GDP-forming] subunit beta; Provisional Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>cd06848 GCS_H Glycine cleavage H-protein Back     alignment and domain information
>PRK01202 glycine cleavage system protein H; Provisional Back     alignment and domain information
>PF02955 GSH-S_ATP: Prokaryotic glutathione synthetase, ATP-grasp domain; InterPro: IPR004218 Prokaryotic glutathione synthetase 6 Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>PLN02235 ATP citrate (pro-S)-lyase Back     alignment and domain information
>PF08442 ATP-grasp_2: ATP-grasp domain; InterPro: IPR013650 The ATP-grasp superfamily currently includes 17 groups of enzymes, catalyzing ATP-dependent ligation of a carboxylate containing molecule to an amino or thiol group-containing molecule [] Back     alignment and domain information
>TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial Back     alignment and domain information
>TIGR01730 RND_mfp RND family efflux transporter, MFP subunit Back     alignment and domain information
>PRK15136 multidrug efflux system protein EmrA; Provisional Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>PF14305 ATPgrasp_TupA: TupA-like ATPgrasp Back     alignment and domain information
>PF13533 Biotin_lipoyl_2: Biotin-lipoyl like Back     alignment and domain information
>KOG0558 consensus Dihydrolipoamide transacylase (alpha-keto acid dehydrogenase E2 subunit) [Energy production and conversion] Back     alignment and domain information
>PRK15030 multidrug efflux system transporter AcrA; Provisional Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>PF02844 GARS_N: Phosphoribosylglycinamide synthetase, N domain; InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PRK00624 glycine cleavage system protein H; Provisional Back     alignment and domain information
>TIGR00527 gcvH glycine cleavage system H protein Back     alignment and domain information
>PRK12784 hypothetical protein; Provisional Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family Back     alignment and domain information
>PF02750 Synapsin_C: Synapsin, ATP binding domain; InterPro: IPR020898 The synapsins are a family of neuron-specific phosphoproteins that coat synaptic vesicles and are involved in the binding between these vesicles and the cytoskeleton (including actin filaments) Back     alignment and domain information
>PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PF13533 Biotin_lipoyl_2: Biotin-lipoyl like Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>PF03133 TTL: Tubulin-tyrosine ligase family; InterPro: IPR004344 Tubulins and microtubules are subjected to several post-translational modifications of which the reversible detyrosination/tyrosination of the carboxy-terminal end of most alpha-tubulins has been extensively analysed Back     alignment and domain information
>PF14403 CP_ATPgrasp_2: Circularly permuted ATP-grasp type 2 Back     alignment and domain information
>COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] Back     alignment and domain information
>PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes Back     alignment and domain information
>PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain Back     alignment and domain information
>KOG3895 consensus Synaptic vesicle protein Synapsin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06973 DUF1297: Domain of unknown function (DUF1297); InterPro: IPR009720 The last two steps of de novo purine biosynthesis are: i) conversion of 5-aminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate (AICAR) to 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate (FAICAR) ii) conversion of FAICAR to inosine5'-monophopsphate (IMP) In bacteria and eukaryotes, these steps are catalysed by the well-characterised bifunctional enzyme PurH [] Back     alignment and domain information
>PF06849 DUF1246: Protein of unknown function (DUF1246); InterPro: IPR010672 The last two steps of de novo purine biosynthesis are: i) conversion of 5-aminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate (AICAR) to 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate (FAICAR) ii) conversion of FAICAR to inosine5'-monophopsphate (IMP) In bacteria and eukaryotes, these steps are catalysed by the well-characterised bifunctional enzyme PurH [] Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>PF11379 DUF3182: Protein of unknown function (DUF3182); InterPro: IPR021519 This family of proteins with unknown function appears to be restricted to Proteobacteria Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] Back     alignment and domain information
>cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) Back     alignment and domain information
>cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PF13437 HlyD_3: HlyD family secretion protein Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>TIGR02994 ectoine_eutE ectoine utilization protein EutE Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PRK06748 hypothetical protein; Validated Back     alignment and domain information
>PRK08057 cobalt-precorrin-6x reductase; Reviewed Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>COG3608 Predicted deacylase [General function prediction only] Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PF13437 HlyD_3: HlyD family secretion protein Back     alignment and domain information
>cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF02571 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: IPR003723 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>COG2099 CobK Precorrin-6x reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK09439 PTS system glucose-specific transporter subunit; Provisional Back     alignment and domain information
>TIGR00830 PTBA PTS system, glucose subfamily, IIA component Back     alignment and domain information
>PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid Back     alignment and domain information
>PF05896 NQRA: Na(+)-translocating NADH-quinone reductase subunit A (NQRA); InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PF14243 DUF4343: Domain of unknown function (DUF4343) Back     alignment and domain information
>PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry Back     alignment and domain information
>COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00358 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>PF09891 DUF2118: Uncharacterized protein conserved in archaea (DUF2118); InterPro: IPR019217 This entry represents a family of hypothetical proteins of unknown function Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein Back     alignment and domain information
>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit Back     alignment and domain information
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional Back     alignment and domain information
>PRK09439 PTS system glucose-specific transporter subunit; Provisional Back     alignment and domain information
>COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>PRK05849 hypothetical protein; Provisional Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>KOG2156 consensus Tubulin-tyrosine ligase-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG0368 consensus Acetyl-CoA carboxylase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>KOG2799 consensus Succinyl-CoA synthetase, beta subunit [Energy production and conversion] Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF04952 AstE_AspA: Succinylglutamate desuccinylase / Aspartoacylase family; InterPro: IPR007036 This family describes both succinylglutamate desuccinylase that catalyses the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway and also includes aspartoacylase 3 Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>PRK15136 multidrug efflux system protein EmrA; Provisional Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK10255 PTS system N-acetyl glucosamine specific transporter subunits IIABC; Provisional Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>KOG0559 consensus Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion] Back     alignment and domain information
>TIGR01730 RND_mfp RND family efflux transporter, MFP subunit Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>KOG3373 consensus Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15030 multidrug efflux system transporter AcrA; Provisional Back     alignment and domain information
>TIGR01995 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIABC component Back     alignment and domain information
>TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>TIGR01995 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIABC component Back     alignment and domain information
>TIGR00830 PTBA PTS system, glucose subfamily, IIA component Back     alignment and domain information
>PRK09824 PTS system beta-glucoside-specific transporter subunits IIABC; Provisional Back     alignment and domain information
>PRK06988 putative formyltransferase; Provisional Back     alignment and domain information
>PLN02226 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>PRK09824 PTS system beta-glucoside-specific transporter subunits IIABC; Provisional Back     alignment and domain information
>PF06898 YqfD: Putative stage IV sporulation protein YqfD; InterPro: IPR010690 This family consists of several putative bacterial stage IV sporulation (SpoIV) proteins Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>KOG2157 consensus Predicted tubulin-tyrosine ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>TIGR02876 spore_yqfD sporulation protein YqfD Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>PF00358 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>KOG0238 consensus 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PF01820 Dala_Dala_lig_N: D-ala D-ala ligase N-terminus; InterPro: IPR011127 This entry represents the N-terminal region of the D-alanine--D-alanine ligase enzyme (6 Back     alignment and domain information
>PRK10255 PTS system N-acetyl glucosamine specific transporter subunits IIABC; Provisional Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>KOG1057 consensus Arp2/3 complex-interacting protein VIP1/Asp1, involved in regulation of actin cytoskeleton [Cytoskeleton] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PLN02775 Probable dihydrodipicolinate reductase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PF07065 D123: D123; InterPro: IPR009772 This family contains a number of eukaryotic D123 proteins approximately 330 residues long Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>COG4072 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family Back     alignment and domain information
>TIGR03025 EPS_sugtrans exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>KOG0369 consensus Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK05878 pyruvate phosphate dikinase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>PF01551 Peptidase_M23: Peptidase family M23; InterPro: IPR016047 Members of this family are zinc metallopeptidases with a range of specificities Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03023 WcaJ_sugtrans Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query765
3u9s_A655 Crystal Structure Of P. Aeruginosa 3-methylcrotonyl 1e-125
3u9s_A655 Crystal Structure Of P. Aeruginosa 3-methylcrotonyl 5e-10
3n6r_A681 Crystal Structure Of The Holoenzyme Of Propionyl-co 1e-125
2vpq_A451 Crystal Structure Of Biotin Carboxylase From S. Aur 1e-109
1ulz_A451 Crystal Structure Of The Biotin Carboxylase Subunit 1e-106
2vqd_A464 Crystal Structure Of Biotin Carboxylase From Pseudo 1e-101
2gps_A469 Crystal Structure Of The Biotin Carboxylase Subunit 1e-99
2gpw_A469 Crystal Structure Of The Biotin Carboxylase Subunit 3e-99
3jzf_A486 Crystal Structure Of Biotin Carboxylase From E. Col 4e-99
3g8c_A444 Crystal Stucture Of Biotin Carboxylase In Complex W 4e-99
3rup_B452 Crystal Structure Of E.Coli Biotin Carboxylase In C 5e-99
1bnc_A449 Three-Dimensional Structure Of The Biotin Carboxyla 5e-99
1dv2_A452 The Structure Of Biotin Carboxylase, Mutant E288k, 2e-98
3g8d_A444 Crystal Structure Of The Biotin Carboxylase Subunit 2e-98
3rv4_A452 Crystal Structure Of E.Coli Biotin Carboxylase R16e 3e-98
3va7_A 1236 Crystal Structure Of The Kluyveromyces Lactis Urea 7e-98
4hnt_A 1173 Crystal Structure Of F403a Mutant Of S. Aureus Pyru 2e-96
4hnt_A1173 Crystal Structure Of F403a Mutant Of S. Aureus Pyru 3e-06
3hb9_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 3e-96
3hb9_A1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 2e-06
3hbl_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 3e-96
3hbl_A1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 2e-06
3ho8_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 3e-96
3ho8_A1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 2e-06
3bg5_A 1173 Crystal Structure Of Staphylococcus Aureus Pyruvate 4e-96
3bg5_A1173 Crystal Structure Of Staphylococcus Aureus Pyruvate 3e-06
4hnu_A 1173 Crystal Structure Of K442e Mutant Of S. Aureus Pyru 4e-96
4hnu_A1173 Crystal Structure Of K442e Mutant Of S. Aureus Pyru 3e-06
4hnv_A 1173 Crystal Structure Of R54e Mutant Of S. Aureus Pyruv 2e-95
4hnv_A1173 Crystal Structure Of R54e Mutant Of S. Aureus Pyruv 3e-06
2dzd_A461 Crystal Structure Of The Biotin Carboxylase Domain 4e-92
2qf7_A 1165 Crystal Structure Of A Complete Multifunctional Pyr 6e-91
3tw7_A 1165 Structure Of Rhizobium Etli Pyruvate Carboxylase T8 7e-91
3ouz_A446 Crystal Structure Of Biotin Carboxylase-Adp Complex 5e-88
2yl2_A540 Crystal Structure Of Human Acetyl-Coa Carboxylase 1 3e-62
3jrx_A587 Crystal Structure Of The Bc Domain Of Acc2 In Compl 1e-59
3jrw_A587 Phosphorylated Bc Domain Of Acc2 Length = 587 1e-59
2hjw_A573 Crystal Structure Of The Bc Domain Of Acc2 Length = 2e-59
3gid_A540 The Biotin Carboxylase (Bc) Domain Of Human Acetyl- 2e-59
1w96_A554 Crystal Structure Of Biotin Carboxylase Domain Of A 1e-52
1w93_A553 Crystal Structure Of Biotin Carboxylase Domain Of A 1e-52
2cqy_A108 Solution Structure Of B Domain From Human Propionyl 4e-11
1o78_A84 Biotin Carboxyl Carrier Domain Of Transcarboxylase 8e-08
1dcz_A77 Biotin Carboxyl Carrier Domain Of Transcarboxylase 1e-07
2d5d_A74 Structure Of Biotin Carboxyl Carrier Protein (74val 2e-07
2jku_A94 Crystal Structure Of The N-Terminal Region Of The B 4e-07
3bg3_A718 Crystal Structure Of Human Pyruvate Carboxylase (Mi 3e-06
3bg9_A718 Crystal Structure Of Human Pyruvate Carboxylase (Mi 3e-06
2ejm_A99 Solution Structure Of Ruh-072, An Apo-Biotnyl Domai 6e-06
3aw8_A369 Crystal Structure Of N5-Carboxyaminoimidazole Ribon 3e-05
3v4z_A309 D-Alanine--D-Alanine Ligase From Yersinia Pestis Le 4e-05
1z6h_A72 Solution Structure Of Bacillus Subtilis Blap Biotin 1e-04
1iov_A306 Complex Of D-Ala:d-Ala Ligase With Adp And A Phosph 2e-04
1iow_A306 Complex Of Y216f D-Ala:d-Ala Ligase With Adp And A 3e-04
>pdb|3U9S|A Chain A, Crystal Structure Of P. Aeruginosa 3-methylcrotonyl-coa Carboxylase (mcc) 750 Kd Holoenzyme, Coa Complex Length = 655 Back     alignment and structure 
Iteration: 1

 Score =  447 bits (1150), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 237/454 (52%), Positives = 317/454 (69%), Gaps = 18/454 (3%)
Query: 37  IEKILIANRGEIAYRIMRTAKRLGIRTVAVYSDADRDSLHVKSADEAIRIGPPPARLSYL 96
           I+++L+ANRGEIA R+MR+A+ LGI +VAV+SD DR + HV  AD A+ +G      SYL
Sbjct: 8   IQRLLVANRGEIACRVMRSARALGIGSVAVHSDIDRHARHVAEADIAVDLGGAKPADSYL 67
Query: 97  NGSSIVDAAIRTGAQAIHPGYGFLSESADFAQLCGDNGLTFIGPPVSAIRDMGDKSASKR 156
            G  I+ AA+ +GAQAIHPGYGFLSE+ADFA+ C + GL F+GPP +AI  MG KSA+K 
Sbjct: 68  RGDRIIAAALASGAQAIHPGYGFLSENADFARACEEAGLLFLGPPAAAIDAMGSKSAAKA 127
Query: 157 IMGAAGVPLVPGYHGNEQDIDLMKSEAAKIGYPILIKPTHGGGGKGMRIVQSPNDFVDSF 216
           +M  AGVPLVPGYHG  QD++  + EA +IGYP+L+K   GGGGKGM++V+   +  ++ 
Sbjct: 128 LMEEAGVPLVPGYHGEAQDLETFRREAGRIGYPVLLKAAAGGGGKGMKVVEREAELAEAL 187
Query: 217 LGAQREAAASFGINTILLEKYITQPRHIEVQIFGDKYGKVLHLYERDCSVQRRHQKIIEE 276
             AQREA A+FG   +L+EKY+ +PRH+E+Q+F D++G  L+L ERDCS+QRRHQK++EE
Sbjct: 188 SSAQREAKAAFGDARMLVEKYLLKPRHVEIQVFADRHGHCLYLNERDCSIQRRHQKVVEE 247
Query: 277 APAPNVTHDFRALLGQAAVSAAKAVSYHNAGTVEFIVDTVSDQFYFMEMNTRLQVEHPVT 336
           APAP +  + R  +G+AAV AA+A+ Y  AGTVEF++D    QF+FMEMNTRLQVEHPVT
Sbjct: 248 APAPGLGAELRRAMGEAAVRAAQAIGYVGAGTVEFLLDE-RGQFFFMEMNTRLQVEHPVT 306
Query: 337 EMIVDQDLVEWQIRVANGEPLPLSQSEVPLLGHAFEARIYAENVPKGFLPATGVLHHYHP 396
           E I   DLV WQIRVA GE LPL+Q +VPL GHA E R+YAE+    FLPA+G L  Y  
Sbjct: 307 EAITGLDLVAWQIRVARGEALPLTQEQVPLNGHAIEVRLYAEDPEGDFLPASGRLMLYRE 366
Query: 397 VPVSSKAVRVETGVEQGDTVSMHYDPMIANL--W--------------YGAKTVAGVPTN 440
              +    RV++GV +GD VS  YDPM+A L  W                  +V G+ TN
Sbjct: 367 A-AAGPGRRVDSGVREGDEVSPFYDPMLAKLIAWGETREEARQRLLAMLAETSVGGLRTN 425
Query: 441 INFLQKLAKHRAFESGDVETHFIEQHKDELFVKP 474
           + FL+++  H AF + +++T FI +H+D+L   P
Sbjct: 426 LAFLRRILGHPAFAAAELDTGFIARHQDDLLPAP 459
>pdb|3U9S|A Chain A, Crystal Structure Of P. Aeruginosa 3-methylcrotonyl-coa Carboxylase (mcc) 750 Kd Holoenzyme, Coa Complex Length = 655 Back     alignment and structure
>pdb|3N6R|A Chain A, Crystal Structure Of The Holoenzyme Of Propionyl-coa Carboxylase (pcc) Length = 681 Back     alignment and structure
>pdb|2VPQ|A Chain A, Crystal Structure Of Biotin Carboxylase From S. Aureus Complexed With Amppnp Length = 451 Back     alignment and structure
>pdb|1ULZ|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit Of Pyruvate Carboxylase Length = 451 Back     alignment and structure
>pdb|2VQD|A Chain A, Crystal Structure Of Biotin Carboxylase From Pseudomonas Aeruginosa Complexed With Ampcp Length = 464 Back     alignment and structure
>pdb|2GPS|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, E23r Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli. Length = 469 Back     alignment and structure
>pdb|2GPW|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, F363a Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli. Length = 469 Back     alignment and structure
>pdb|3JZF|A Chain A, Crystal Structure Of Biotin Carboxylase From E. Coli In Complex With Benzimidazoles Series Length = 486 Back     alignment and structure
>pdb|3G8C|A Chain A, Crystal Stucture Of Biotin Carboxylase In Complex With Biotin, Bicarbonate, Adp And Mg Ion Length = 444 Back     alignment and structure
>pdb|1BNC|A Chain A, Three-Dimensional Structure Of The Biotin Carboxylase Subunit Of Acetyl-Coa Carboxylase Length = 449 Back     alignment and structure
>pdb|1DV2|A Chain A, The Structure Of Biotin Carboxylase, Mutant E288k, Complexed With Atp Length = 452 Back     alignment and structure
>pdb|3G8D|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, E296a Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli Length = 444 Back     alignment and structure
>pdb|3VA7|A Chain A, Crystal Structure Of The Kluyveromyces Lactis Urea Carboxylase Length = 1236 Back     alignment and structure
>pdb|4HNT|A Chain A, Crystal Structure Of F403a Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|4HNT|A Chain A, Crystal Structure Of F403a Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|3HB9|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase A610t Mutant Length = 1150 Back     alignment and structure
>pdb|3HB9|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase A610t Mutant Length = 1150 Back     alignment and structure
>pdb|3HBL|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase T908a Mutant Length = 1150 Back     alignment and structure
>pdb|3HBL|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase T908a Mutant Length = 1150 Back     alignment and structure
>pdb|3HO8|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase In Complex With Coenzyme A Length = 1150 Back     alignment and structure
>pdb|3HO8|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase In Complex With Coenzyme A Length = 1150 Back     alignment and structure
>pdb|3BG5|A Chain A, Crystal Structure Of Staphylococcus Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|3BG5|A Chain A, Crystal Structure Of Staphylococcus Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|4HNU|A Chain A, Crystal Structure Of K442e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|4HNU|A Chain A, Crystal Structure Of K442e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|4HNV|A Chain A, Crystal Structure Of R54e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|4HNV|A Chain A, Crystal Structure Of R54e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|2DZD|A Chain A, Crystal Structure Of The Biotin Carboxylase Domain Of Pyruvate Carboxylase Length = 461 Back     alignment and structure
>pdb|2QF7|A Chain A, Crystal Structure Of A Complete Multifunctional Pyruvate Carboxylase From Rhizobium Etli Length = 1165 Back     alignment and structure
>pdb|3TW7|A Chain A, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a Crystallized Without Acetyl Coenzyme-A Length = 1165 Back     alignment and structure
>pdb|3OUZ|A Chain A, Crystal Structure Of Biotin Carboxylase-Adp Complex From Campylobacter Jejuni Length = 446 Back     alignment and structure
>pdb|2YL2|A Chain A, Crystal Structure Of Human Acetyl-Coa Carboxylase 1, Biotin Carboxylase (Bc) Domain Length = 540 Back     alignment and structure
>pdb|3JRX|A Chain A, Crystal Structure Of The Bc Domain Of Acc2 In Complex With Soraphen A Length = 587 Back     alignment and structure
>pdb|3JRW|A Chain A, Phosphorylated Bc Domain Of Acc2 Length = 587 Back     alignment and structure
>pdb|2HJW|A Chain A, Crystal Structure Of The Bc Domain Of Acc2 Length = 573 Back     alignment and structure
>pdb|3GID|A Chain A, The Biotin Carboxylase (Bc) Domain Of Human Acetyl-Coa Carboxylase 2 (Acc2) In Complex With Soraphen A Length = 540 Back     alignment and structure
>pdb|1W96|A Chain A, Crystal Structure Of Biotin Carboxylase Domain Of Acetyl- Coenzyme A Carboxylase From Saccharomyces Cerevisiae In Complex With Soraphen A Length = 554 Back     alignment and structure
>pdb|1W93|A Chain A, Crystal Structure Of Biotin Carboxylase Domain Of Acetyl- Coenzyme A Carboxylase From Saccharomyces Cerevisiae Length = 553 Back     alignment and structure
>pdb|2CQY|A Chain A, Solution Structure Of B Domain From Human Propionyl-Coa Carboxylase Alpha Subunit Length = 108 Back     alignment and structure
>pdb|1O78|A Chain A, Biotin Carboxyl Carrier Domain Of Transcarboxylase (1.3s) [10-48] Deletion Mutant Length = 84 Back     alignment and structure
>pdb|1DCZ|A Chain A, Biotin Carboxyl Carrier Domain Of Transcarboxylase (Tc 1.3s) Length = 77 Back     alignment and structure
>pdb|2D5D|A Chain A, Structure Of Biotin Carboxyl Carrier Protein (74val Start) From Pyrococcus Horikoshi Ot3 Ligand Free Form Ii Length = 74 Back     alignment and structure
>pdb|2JKU|A Chain A, Crystal Structure Of The N-Terminal Region Of The Biotin Acceptor Domain Of Human Propionyl-Coa Carboxylase Length = 94 Back     alignment and structure
>pdb|3BG3|A Chain A, Crystal Structure Of Human Pyruvate Carboxylase (Missing The Biotin Carboxylase Domain At The N-Terminus) Length = 718 Back     alignment and structure
>pdb|3BG9|A Chain A, Crystal Structure Of Human Pyruvate Carboxylase (Missing The Biotin Carboxylase Domain At The N-Terminus) F1077a Mutant Length = 718 Back     alignment and structure
>pdb|2EJM|A Chain A, Solution Structure Of Ruh-072, An Apo-Biotnyl Domain Form Human Acetyl Coenzyme A Carboxylase Length = 99 Back     alignment and structure
>pdb|3AW8|A Chain A, Crystal Structure Of N5-Carboxyaminoimidazole Ribonucleotide Synthetase From Thermus Thermophilus Hb8 Length = 369 Back     alignment and structure
>pdb|3V4Z|A Chain A, D-Alanine--D-Alanine Ligase From Yersinia Pestis Length = 309 Back     alignment and structure
>pdb|1Z6H|A Chain A, Solution Structure Of Bacillus Subtilis Blap Biotinylated- Form Length = 72 Back     alignment and structure
>pdb|1IOV|A Chain A, Complex Of D-Ala:d-Ala Ligase With Adp And A Phosphoryl Phosphonate Length = 306 Back     alignment and structure
>pdb|1IOW|A Chain A, Complex Of Y216f D-Ala:d-Ala Ligase With Adp And A Phosphoryl Phosphinate Length = 306 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query765
3u9t_A675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 0.0
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein 0.0
3va7_A 1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 0.0
3va7_A1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 6e-22
2vpq_A451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain 0.0
1ulz_A451 Pyruvate carboxylase N-terminal domain; biotin car 0.0
3ouz_A446 Biotin carboxylase; structural genomics, center fo 0.0
2w70_A449 Biotin carboxylase; ligase, ATP-binding, fatty aci 0.0
1w96_A554 ACC, acetyl-coenzyme A carboxylase; ligase, obesit 0.0
2dzd_A461 Pyruvate carboxylase; biotin carboxylase, ligase; 0.0
3jrx_A587 Acetyl-COA carboxylase 2; BC domain, soraphen A, a 0.0
3glk_A540 Acetyl-COA carboxylase 2; ATP binding, alternative 0.0
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 0.0
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi- 2e-18
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 0.0
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 5e-18
2cqy_A108 Propionyl-COA carboxylase alpha chain, mitochondri 4e-48
4dim_A403 Phosphoribosylglycinamide synthetase; structural g 5e-28
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondri 7e-28
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 8e-27
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 2e-26
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 3e-26
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 5e-25
2pn1_A331 Carbamoylphosphate synthase large subunit; ZP_0053 3e-24
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 1e-21
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 2e-20
3vmm_A474 Alanine-anticapsin ligase BACD; ATP-grAsp domain, 7e-20
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 9e-20
4eg0_A317 D-alanine--D-alanine ligase; structural genomics, 6e-14
2fb9_A322 D-alanine:D-alanine ligase; 1.90A {Thermus caldoph 1e-12
3df7_A305 Putative ATP-grAsp superfamily protein; putative p 1e-12
3r5x_A307 D-alanine--D-alanine ligase; alpha-beta structure, 2e-12
1ehi_A377 LMDDL2, D-alanine:D-lactate ligase; ATP-binding. g 3e-12
2pvp_A367 D-alanine-D-alanine ligase; 2.40A {Helicobacter py 5e-12
1iow_A306 DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho 2e-11
3lwb_A373 D-alanine--D-alanine ligase; DDL, D-alanyl--D-alan 2e-10
3i12_A364 D-alanine-D-alanine ligase A; D-alanyl-alanine syn 3e-09
3e5n_A386 D-alanine-D-alanine ligase A; bacterial blight; 2. 3e-09
2i87_A364 D-alanine-D-alanine ligase; APO; 2.00A {Staphyloco 5e-09
1uc8_A280 LYSX, lysine biosynthesis enzyme; alpha-aminoadipa 6e-09
1e4e_A343 Vancomycin/teicoplanin A-type resistance protein; 7e-09
3se7_A346 VANA; alpha-beta structure, D-alanine-D-lactate li 8e-09
3tqt_A372 D-alanine--D-alanine ligase; cell envelope; 1.88A 1e-08
3k3p_A383 D-alanine--D-alanine ligase; D-alanyl-alanine synt 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
3ln7_A757 Glutathione biosynthesis bifunctional protein GSH; 3e-07
1kjq_A391 GART 2, phosphoribosylglycinamide formyltransferas 9e-07
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 1e-06
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 1e-06
2dwc_A433 PH0318, 433AA long hypothetical phosphoribosylglyc 2e-06
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 2e-06
3aw8_A369 PURK, phosphoribosylaminoimidazole carboxylase, AT 2e-06
2r85_A334 PURP protein PF1517; ATP-grAsp superfamily, unknow 3e-06
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 3e-06
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transfera 3e-06
4e4t_A419 Phosphoribosylaminoimidazole carboxylase, ATPase; 5e-06
3ln6_A750 Glutathione biosynthesis bifunctional protein GSH; 7e-06
3k5i_A403 Phosphoribosyl-aminoimidazole carboxylase; purine 8e-05
3dva_I 428 Dihydrolipoyllysine-residue acetyltransferase comp 9e-05
1a9x_A1073 Carbamoyl phosphate synthetase (large chain); amid 3e-04
2p0a_A344 Synapsin-3, synapsin III; neurotransmitter release 4e-04
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 6e-04
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Length = 681 Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 Back     alignment and structure
>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Length = 451 Back     alignment and structure
>1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Length = 451 Back     alignment and structure
>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Length = 446 Back     alignment and structure
>2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... Length = 449 Back     alignment and structure
>1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A Length = 554 Back     alignment and structure
>2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} Length = 461 Back     alignment and structure
>3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* Length = 587 Back     alignment and structure
>3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A Length = 540 Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Length = 1165 Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Length = 1165 Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 Back     alignment and structure
>2cqy_A Propionyl-COA carboxylase alpha chain, mitochondrial; PCCA, B domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} Length = 403 Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Length = 94 Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Length = 77 Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Length = 74 Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Length = 72 Back     alignment and structure
>2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, carbamoylphosphate synthase subunit (split gene in MJ); 2.00A {Exiguobacterium sibiricum} Length = 331 Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis} Length = 474 Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Length = 718 Back     alignment and structure
>4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A Length = 317 Back     alignment and structure
>2fb9_A D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} PDB: 2zdh_A* 2yzg_A 2yzn_A* 2yzm_A* 2zdg_A* 2zdq_A* Length = 322 Back     alignment and structure
>3df7_A Putative ATP-grAsp superfamily protein; putative protein, PSI-II, nysgrc., structural genomics, protein structure initiative; 1.87A {Archaeoglobus fulgidus} Length = 305 Back     alignment and structure
>3r5x_A D-alanine--D-alanine ligase; alpha-beta structure, cytosol, structural genomics, for structural genomics of infectious diseases, csgid; HET: MSE ATP; 2.00A {Bacillus anthracis} PDB: 3r23_A* Length = 307 Back     alignment and structure
>1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 Length = 377 Back     alignment and structure
>2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori} Length = 367 Back     alignment and structure
>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* Length = 306 Back     alignment and structure
>3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase RV2981C, structural genomics, TB structural GENO consortium, TBSGC; 2.10A {Mycobacterium tuberculosis} Length = 373 Back     alignment and structure
>3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, A binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} PDB: 3q1k_A* Length = 364 Back     alignment and structure
>3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} PDB: 3r5f_A* 3rfc_A* Length = 386 Back     alignment and structure
>2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 3n8d_A* 2i80_A* Length = 364 Back     alignment and structure
>1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* Length = 280 Back     alignment and structure
>1e4e_A Vancomycin/teicoplanin A-type resistance protein; ligase, cell WALL, antibiotic resistance, membrane, peptidog synthesis; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* Length = 343 Back     alignment and structure
>3se7_A VANA; alpha-beta structure, D-alanine-D-lactate ligase, ligase; HET: ATP; 3.07A {} Length = 346 Back     alignment and structure
>3tqt_A D-alanine--D-alanine ligase; cell envelope; 1.88A {Coxiella burnetii} Length = 372 Back     alignment and structure
>3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans} Length = 383 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ln7_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamylcysteine ligase domain, ATP-grAsp domain, HYBR enzyme, ATP-binding; 3.20A {Pasteurella multocida} Length = 757 Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Length = 391 Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Length = 85 Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Length = 433 Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Length = 81 Back     alignment and structure
>3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} Length = 369 Back     alignment and structure
>2r85_A PURP protein PF1517; ATP-grAsp superfamily, unknown function; HET: AMP; 1.70A {Pyrococcus furiosus} SCOP: c.30.1.8 d.142.1.9 PDB: 2r84_A* 2r86_A* 2r87_A* Length = 334 Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Length = 79 Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Length = 80 Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Length = 419 Back     alignment and structure
>3ln6_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamyl cysteine ligase domain, ATP-grAsp domain, HYB enzyme; 2.95A {Streptococcus agalactiae serogroup V} Length = 750 Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Length = 403 Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Length = 1073 Back     alignment and structure
>2p0a_A Synapsin-3, synapsin III; neurotransmitter release, schizophrenia, vesicle T structural genomics, structural genomics consortium, SGC, neuropeptide; HET: ANP; 1.90A {Homo sapiens} Length = 344 Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Length = 389 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query765
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein 100.0
3u9t_A675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 100.0
3jrx_A587 Acetyl-COA carboxylase 2; BC domain, soraphen A, a 100.0
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 100.0
3glk_A540 Acetyl-COA carboxylase 2; ATP binding, alternative 100.0
3ouz_A446 Biotin carboxylase; structural genomics, center fo 100.0
3va7_A 1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 100.0
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 100.0
2vpq_A451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain 100.0
1ulz_A451 Pyruvate carboxylase N-terminal domain; biotin car 100.0
1w96_A554 ACC, acetyl-coenzyme A carboxylase; ligase, obesit 100.0
2dzd_A461 Pyruvate carboxylase; biotin carboxylase, ligase; 100.0
2w70_A449 Biotin carboxylase; ligase, ATP-binding, fatty aci 100.0
4dim_A403 Phosphoribosylglycinamide synthetase; structural g 100.0
3vot_A425 L-amino acid ligase, BL00235; ATP-grAsp motif, ATP 100.0
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amid 100.0
1kjq_A391 GART 2, phosphoribosylglycinamide formyltransferas 100.0
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 100.0
2dwc_A433 PH0318, 433AA long hypothetical phosphoribosylglyc 100.0
4e4t_A419 Phosphoribosylaminoimidazole carboxylase, ATPase; 100.0
3aw8_A369 PURK, phosphoribosylaminoimidazole carboxylase, AT 100.0
3k5i_A403 Phosphoribosyl-aminoimidazole carboxylase; purine 100.0
3vmm_A474 Alanine-anticapsin ligase BACD; ATP-grAsp domain, 100.0
3ax6_A380 Phosphoribosylaminoimidazole carboxylase, ATPase; 100.0
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 100.0
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 100.0
3eth_A355 Phosphoribosylaminoimidazole carboxylase ATPase su 100.0
2yw2_A424 Phosphoribosylamine--glycine ligase; glycinamide r 100.0
2qk4_A452 Trifunctional purine biosynthetic protein adenosi; 100.0
2ip4_A417 PURD, phosphoribosylamine--glycine ligase; GAR syn 100.0
2z04_A365 Phosphoribosylaminoimidazole carboxylase ATPase su 100.0
1a9x_A1073 Carbamoyl phosphate synthetase (large chain); amid 100.0
2yrx_A451 Phosphoribosylglycinamide synthetase; glycinamide 100.0
1vkz_A412 Phosphoribosylamine--glycine ligase; TM1250, struc 100.0
3lp8_A442 Phosphoribosylamine-glycine ligase; ssgcid, NIH, n 100.0
2xcl_A422 Phosphoribosylamine--glycine ligase; GAR-SYN, ATP- 100.0
3mjf_A431 Phosphoribosylamine--glycine ligase; structural ge 100.0
4fu0_A357 D-alanine--D-alanine ligase 7; vancomycin resistan 100.0
2pn1_A331 Carbamoylphosphate synthase large subunit; ZP_0053 100.0
4eg0_A317 D-alanine--D-alanine ligase; structural genomics, 100.0
1ehi_A377 LMDDL2, D-alanine:D-lactate ligase; ATP-binding. g 100.0
3e5n_A386 D-alanine-D-alanine ligase A; bacterial blight; 2. 100.0
3i12_A364 D-alanine-D-alanine ligase A; D-alanyl-alanine syn 100.0
2i87_A364 D-alanine-D-alanine ligase; APO; 2.00A {Staphyloco 100.0
1iow_A306 DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho 100.0
3k3p_A383 D-alanine--D-alanine ligase; D-alanyl-alanine synt 100.0
3lwb_A373 D-alanine--D-alanine ligase; DDL, D-alanyl--D-alan 100.0
3tqt_A372 D-alanine--D-alanine ligase; cell envelope; 1.88A 99.98
3r5x_A307 D-alanine--D-alanine ligase; alpha-beta structure, 99.97
1e4e_A343 Vancomycin/teicoplanin A-type resistance protein; 99.97
3se7_A346 VANA; alpha-beta structure, D-alanine-D-lactate li 99.97
2fb9_A322 D-alanine:D-alanine ligase; 1.90A {Thermus caldoph 99.97
2pvp_A367 D-alanine-D-alanine ligase; 2.40A {Helicobacter py 99.97
1uc8_A280 LYSX, lysine biosynthesis enzyme; alpha-aminoadipa 99.96
2r85_A334 PURP protein PF1517; ATP-grAsp superfamily, unknow 99.95
2r7k_A361 5-formaminoimidazole-4-carboxamide-1-(beta)-D- rib 99.94
2pbz_A320 Hypothetical protein; NYSGXRC, PSI-II, IMP biosynt 99.92
3df7_A305 Putative ATP-grAsp superfamily protein; putative p 99.91
1gsa_A316 Glutathione synthetase; ligase; HET: ADP GSH; 2.00 99.86
1z2n_X324 Inositol 1,3,4-trisphosphate 5/6-kinase; inositol 99.84
3ln7_A757 Glutathione biosynthesis bifunctional protein GSH; 99.84
1wr2_A238 Hypothetical protein PH1789; structural genomics, 99.77
3ln6_A750 Glutathione biosynthesis bifunctional protein GSH; 99.77
1i7n_A309 Synapsin II; synapse, phosphorylation, neuropeptid 99.73
2p0a_A344 Synapsin-3, synapsin III; neurotransmitter release 99.71
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 99.71
2q7d_A346 Inositol-tetrakisphosphate 1-kinase; inositol kina 99.68
2cqy_A108 Propionyl-COA carboxylase alpha chain, mitochondri 99.64
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 99.58
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 99.53
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 99.51
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 99.5
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transfera 99.5
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 99.48
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 99.47
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 99.47
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 99.46
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 99.45
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 99.44
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondri 99.43
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 99.43
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 99.42
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 99.41
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 99.41
2fp4_B395 Succinyl-COA ligase [GDP-forming] beta-chain, mito 99.4
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi- 99.39
2nu8_B388 SCS-beta, succinyl-COA synthetase beta chain; citr 99.39
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 99.38
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 99.37
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 99.36
3t7a_A330 Inositol pyrophosphate kinase; ATP-grAsp fold, tra 99.35
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 99.34
3va7_A1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 99.34
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate 99.3
1zko_A136 Glycine cleavage system H protein; TM0212, structu 99.13
3ufx_B397 Succinyl-COA synthetase beta subunit; ATP-grAsp fo 99.07
3dva_I 428 Dihydrolipoyllysine-residue acetyltransferase comp 99.0
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 98.99
1zy8_K 229 Pyruvate dehydrogenase protein X component, mitoch 98.97
1hpc_A131 H protein of the glycine cleavage system; transit 98.8
1onl_A128 Glycine cleavage system H protein; hybrid barrel-s 98.7
3a7l_A128 H-protein, glycine cleavage system H protein; lipo 98.63
3ne5_B 413 Cation efflux system protein CUSB; transmembrane h 98.17
3lnn_A 359 Membrane fusion protein (MFP) heavy metal cation Z 98.12
2f1m_A277 Acriflavine resistance protein A; helical hairpin, 98.11
3fpp_A 341 Macrolide-specific efflux protein MACA; hexameric 98.07
3klr_A125 Glycine cleavage system H protein; antiparallel be 98.02
1vf7_A 369 Multidrug resistance protein MEXA; alpha hairpin, 97.87
3mxu_A143 Glycine cleavage system H protein; seattle structu 97.79
3tzu_A137 GCVH, glycine cleavage system H protein 1; ssgcid, 97.78
1ax3_A162 Iiaglc, glucose permease IIA domain; phosphotransf 97.66
4dk0_A 369 Putative MACA; alpha-hairpin, lipoyl, beta-barrel, 97.63
3tig_A380 TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Si 97.61
1f3z_A161 EIIA-GLC, glucose-specific phosphocarrier; phospho 97.47
2gpr_A154 Glucose-permease IIA component; phosphotransferase 97.43
3cdx_A354 Succinylglutamatedesuccinylase/aspartoacylase; str 97.39
3hgb_A155 Glycine cleavage system H protein; ssgcid, niaid, 97.37
3na6_A331 Succinylglutamate desuccinylase/aspartoacylase; st 97.24
3mwd_A425 ATP-citrate synthase; ATP-grAsp, phosphohistidine, 96.85
3fmc_A368 Putative succinylglutamate desuccinylase / aspart; 96.74
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 96.7
3pff_A 829 ATP-citrate synthase; phosphohistidine, organic ac 96.54
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 95.9
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 95.87
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transfera 95.79
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 95.74
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 95.62
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 95.55
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 95.42
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 95.41
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 95.4
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 95.37
2qj8_A332 MLR6093 protein; structural genomics, joint center 95.35
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 95.06
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 95.03
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 94.91
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 94.84
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 94.81
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 94.73
2gpr_A154 Glucose-permease IIA component; phosphotransferase 94.64
3our_B183 EIIA, phosphotransferase system IIA component; exh 94.3
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 94.29
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 94.13
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 94.13
1ax3_A162 Iiaglc, glucose permease IIA domain; phosphotransf 93.85
1f3z_A161 EIIA-GLC, glucose-specific phosphocarrier; phospho 93.81
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein 93.8
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 93.7
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 93.69
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 93.66
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 93.54
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondri 93.5
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate 93.48
2duw_A145 Putative COA-binding protein; ligand binding prote 93.46
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 93.32
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 93.3
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 93.27
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 93.08
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 92.95
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 92.85
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 92.71
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 92.7
3fpp_A 341 Macrolide-specific efflux protein MACA; hexameric 92.68
2xha_A193 NUSG, transcription antitermination protein NUSG; 92.56
2f1m_A 277 Acriflavine resistance protein A; helical hairpin, 92.49
2d59_A144 Hypothetical protein PH1109; COA binding, structur 92.38
3d4r_A169 Domain of unknown function from the PFAM-B_34464; 91.63
3our_B183 EIIA, phosphotransferase system IIA component; exh 91.48
3u9t_A675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 91.44
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 91.01
3slg_A372 PBGP3 protein; structural genomics, seattle struct 90.9
3lnn_A 359 Membrane fusion protein (MFP) heavy metal cation Z 90.87
1iuk_A140 Hypothetical protein TT1466; structural genomics, 90.87
2io8_A619 Bifunctional glutathionylspermidine synthetase/ami 90.79
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 90.54
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 90.53
3s2u_A365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 90.4
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 90.17
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 90.12
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 90.09
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 89.81
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 89.71
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 89.64
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 89.54
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 89.17
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 88.88
2xhc_A 352 Transcription antitermination protein NUSG; 2.45A 88.76
3n6x_A474 Putative glutathionylspermidine synthase; domain o 88.61
1id1_A153 Putative potassium channel protein; RCK domain, E. 88.61
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 88.56
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 88.51
1vf7_A 369 Multidrug resistance protein MEXA; alpha hairpin, 88.4
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 88.29
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 88.23
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 88.15
3ne5_B 413 Cation efflux system protein CUSB; transmembrane h 87.81
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 87.63
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 87.56
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 87.48
2xha_A193 NUSG, transcription antitermination protein NUSG; 87.27
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 86.96
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 86.88
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 86.79
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 86.77
2wm3_A299 NMRA-like family domain containing protein 1; unkn 86.68
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 86.66
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 86.21
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 86.2
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 86.04
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 85.85
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 85.64
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 85.61
3c85_A183 Putative glutathione-regulated potassium-efflux S 85.44
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 85.39
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 85.14
4dk0_A 369 Putative MACA; alpha-hairpin, lipoyl, beta-barrel, 84.98
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 84.9
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 84.72
1lss_A140 TRK system potassium uptake protein TRKA homolog; 84.65
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 84.63
3ius_A286 Uncharacterized conserved protein; APC63810, silic 84.55
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 84.37
3pdi_B458 Nitrogenase MOFE cofactor biosynthesis protein NI; 84.13
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 83.83
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 83.78
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 83.68
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 83.4
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 83.37
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 83.3
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 83.24
2we8_A386 Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc 83.18
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 82.87
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 82.32
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 82.24
2auk_A190 DNA-directed RNA polymerase beta' chain; sandwich- 81.83
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 81.72
3lu0_D 1407 DNA-directed RNA polymerase subunit beta'; E. coli 81.69
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 81.6
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 81.27
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 81.2
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 80.83
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 80.81
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 80.63
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 80.5
2bco_A350 Succinylglutamate desuccinylase; NESG, VPR14, stru 80.31
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 80.02
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
Probab=100.00  E-value=1.8e-109  Score=979.20  Aligned_cols=645  Identities=40%  Similarity=0.625  Sum_probs=501.4

Q ss_pred             CCCEEEEEcCcHHHHHHHHHHHHCCCeEEEEecCCCCCCcccccccEEEEcCCCCcCcCCCCHHHHHHHHHHhCCCEEEe
Q 041518           36 RIEKILIANRGEIAYRIMRTAKRLGIRTVAVYSDADRDSLHVKSADEAIRIGPPPARLSYLNGSSIVDAAIRTGAQAIHP  115 (765)
Q Consensus        36 ~~kkILI~g~G~~a~~iiraar~~Gi~vvav~s~~d~~~~~~~~aD~~~~i~~~~~~~syld~~~Il~~a~~~~~DaV~p  115 (765)
                      |||||||+|+|++|++++++|+++|+++++++++++..+++.++||+++.+++.+..++|+|.+.|++++++.++|+|||
T Consensus         1 m~~kiLIanrGeia~riiraar~lGi~~vav~sd~d~~a~~~~~aD~~~~i~p~~~~~syld~~~i~~~a~~~~~daI~p   80 (681)
T 3n6r_A            1 MFNKILIANRGEIACRVIKTARKMGISTVAIYSDADKQALHVQMADEAVHIGPPPANQSYIVIDKVMAAIRATGAQAVHP   80 (681)
T ss_dssp             -CCCBCBSCCHHHHHHHHHHHGGGSCCBCCEECSTTSSCHHHHHSSCCEECSSSSGGGTTSCHHHHHHHHHHTCCSCCBC
T ss_pred             CCCEEEEECCcHHHHHHHHHHHHcCCEEEEEEcCCCCCChhHHhCCEEEEcCCCCcccCccCHHHHHHHHHHhCcCEEEE
Confidence            78999999999999999999999999999999999999999999999999998888899999999999999999999999


Q ss_pred             CCCcccccHHHHHHHHHCCCcEECCcHHHHHHhcCHHHHHHHHHHCCCCCCCccccCCCCHHHHHHHHHHhCCcEEEeec
Q 041518          116 GYGFLSESADFAQLCGDNGLTFIGPPVSAIRDMGDKSASKRIMGAAGVPLVPGYHGNEQDIDLMKSEAAKIGYPILIKPT  195 (765)
Q Consensus       116 g~g~lsE~~~~a~~~~~~Gl~~~Gp~~eai~~~~DK~~~r~~l~~~Gvpvp~~~~~~~~s~~e~~~~~~~ig~PvVVKP~  195 (765)
                      +|||++|++.+++.|++.|++|+||++++++.++||..+|++|+++|||+||++.....+.+++.++++++|||+||||.
T Consensus        81 g~gflsE~~~~a~~le~~Gi~~iGp~~~ai~~~~dK~~~k~~l~~~GVPvpp~~~~~~~s~~e~~~~a~~igyPvVvKp~  160 (681)
T 3n6r_A           81 GYGFLSENSKFAEALEAEGVIFVGPPKGAIEAMGDKITSKKIAQEANVSTVPGYMGLIEDADEAVKISNQIGYPVMIKAS  160 (681)
T ss_dssp             CSSSSTTCHHHHHHHHTTTCCCSSSCHHHHHHTTSHHHHHHHHHTTTCCCCCC---------------------------
T ss_pred             CCCccccCHHHHHHHHHcCCceECCCHHHHHHhCCHHHHHHHHHHcCcCcCCccccCcCCHHHHHHHHHhcCCcEEEEEC
Confidence            99999999999999999999999999999999999999999999999999998754456889999999999999999999


Q ss_pred             CCCCCccEEEECChhHHHHHHHHHHHHHHhcCCCCcEEEecccCCCeeEEEEEEEeccccEEEEEeeeccccccceeeee
Q 041518          196 HGGGGKGMRIVQSPNDFVDSFLGAQREAAASFGINTILLEKYITQPRHIEVQIFGDKYGKVLHLYERDCSVQRRHQKIIE  275 (765)
Q Consensus       196 ~g~Gg~Gv~~v~s~~el~~a~~~~~~ea~~~fg~~~vlVEeyI~ggrei~v~v~~d~~g~vv~l~~r~~s~~~~~~k~~e  275 (765)
                      .|+||+||+++++.+|+.++++.+.+++.+.|+++.+|||+||+|++|+++++++|++|+++++++|+|+++++|++.++
T Consensus       161 ~ggggkGv~iv~~~~el~~a~~~~~~ea~~~fg~~~vlvEe~I~g~rei~V~v~~d~~G~vv~l~~rd~s~qr~~~k~~e  240 (681)
T 3n6r_A          161 AGGGGKGMRIAWNDQEAREGFQSSKNEAANSFGDDRIFIEKFVTQPRHIEIQVLCDSHGNGIYLGERECSIQRRNQKVVE  240 (681)
T ss_dssp             ------------------------------------------CCSCEEEEEEEECCSSSCCEEEEEEECCCEETTEECEE
T ss_pred             CCCCCCCEEEECCHHHHHHHHHHHHHHHHHhCCCCcEEEEeccCCCcEEEEEEEEeCCCCEEEEeeeecceeccCccEEE
Confidence            99999999999999999999999999888889889999999999889999999999999999999999999999999999


Q ss_pred             ecCCCCCCHHHHHHHHHHHHHHHHHcCCCceeEEEEEEECCCCcEEEEEecccCCccccccceecCCCHHHHHHHHHcCC
Q 041518          276 EAPAPNVTHDFRALLGQAAVSAAKAVSYHNAGTVEFIVDTVSDQFYFMEMNTRLQVEHPVTEMIVDQDLVEWQIRVANGE  355 (765)
Q Consensus       276 ~~Pa~~l~~~~~~~l~~~a~~i~~alg~~G~~~vEf~~~~~~g~~~~iEiN~R~~~~~~~~e~~tGvDl~~~~i~~a~G~  355 (765)
                      .+|++.++++.+++|.+.+.++++++||+|++++||++++ +|++||||||||+|++|+++++++|+|++++++++++|+
T Consensus       241 ~~Pa~~l~~~~~~~l~~~a~~~~~alg~~G~~~vEf~~d~-dg~~~~lEiNpR~~~~~~~te~~tGvdl~~~~l~~a~G~  319 (681)
T 3n6r_A          241 EAPSPFLDEATRRAMGEQAVALAKAVGYASAGTVEFIVDG-QKNFYFLEMNTRLQVEHPVTELITGVDLVEQMIRVAAGE  319 (681)
T ss_dssp             EESCSSCCHHHHHHHHHHHHHHHHTTTCCSEEEEEEEECT-TSCCCCCEEECSCCTTHHHHHHHHTCCHHHHHHHHHTSC
T ss_pred             ecCCCCCCHHHHHHHHHHHHHHHHHcCCCceEEEEEEEeC-CCCEEEEecccccCCCcHHhHHHhCCCHHHHHHHHHCCC
Confidence            9999889999999999999999999999999999999997 788999999999999999999999999999999999999


Q ss_pred             CCCCCCCCcccceEEEEEEecccCCCCCCCCCCcceeEEeeCCCC-------------------CCcEEEEecccCCCee
Q 041518          356 PLPLSQSEVPLLGHAFEARIYAENVPKGFLPATGVLHHYHPVPVS-------------------SKAVRVETGVEQGDTV  416 (765)
Q Consensus       356 ~l~~~~~~~~~~g~ai~~ri~ae~p~~~f~p~~G~i~~~~~p~~~-------------------~~~vrv~~~v~~G~~v  416 (765)
                      ++++.+.++...||++++|+|||||.++|.|++|+|..++.|..+                   ++ ||+|+++.+|+.|
T Consensus       320 ~l~~~~~~~~~~g~ai~~ri~aedp~~~f~p~~G~i~~~~~p~~~~~~~~~~~~~w~~d~~~~~~~-vr~d~~~~~g~~v  398 (681)
T 3n6r_A          320 PLSITQGDVKLTGWAIENRLYAEDPYRGFLPSIGRLTRYRPPAETAAGPLLVNGKWQGDAPSGEAA-VRNDTGVYEGGEI  398 (681)
T ss_dssp             CCSSCTTTCCCCSEEEEEEEESEEGGGTTEECCEECSCEECCCC--------------------CC-EEEEESCCTTCEE
T ss_pred             CCCCCccccceeEEEEEEEEecCCcccccCCCCcEEEEEECCCCCcccccccccccccccccCCCc-EEEEccccCCCcc
Confidence            999988889999999999999999999999999999999999733                   37 9999999999999


Q ss_pred             CCccCCcceEEEEEe---------------e-EEeccccCHHHHHHHhcCcCcccCccccccccccccccccCCCCchhh
Q 041518          417 SMHYDPMIANLWYGA---------------K-TVAGVPTNINFLQKLAKHRAFESGDVETHFIEQHKDELFVKPSQSVSA  480 (765)
Q Consensus       417 ~~~~d~~~~~~i~~g---------------~-~i~g~~tn~~~l~~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~  480 (765)
                      +++|||||||||+||               + .|.|++||++||++|++||+|++|+++|+||++++++++.....++. 
T Consensus       399 ~~~yd~~iak~i~~g~~r~~a~~~~~~al~~~~i~g~~tn~~~~~~~~~~~~f~~~~~~t~~~~~~~~~~~~~~~~~~~-  477 (681)
T 3n6r_A          399 SMYYDPMIAKLCTWAPTRAAAIEAMRIALDSFEVEGIGHNLPFLSAVMDHPKFISGDMTTAFIAEEYPEGFEGVNLPET-  477 (681)
T ss_dssp             CTTSCCEEEEEEEEESSHHHHHHHHHHHHHHCEECSSCCSHHHHHHHHHCHHHHHCCCCSSHHHHHCTTSCCCCCCCHH-
T ss_pred             CCCCCCceeEEEEEcCCHHHHHHHHHHHHhcCEEECccCCHHHHHHHhCCHhhccCCcccchhhhccccccCCCCCChh-
Confidence            999999999999999               6 99999999999999999999999999999999999888766544320 


Q ss_pred             hhhhhhhHHHHHHHHHHHHhhhccccCCCCCCCcccCccccCCCceeccCceeEEEEEECCcccCCCceeEEEEEEEecC
Q 041518          481 EMNSAARLSATLVAACIFEKEKSTLKESPPGNHCLLSIWYTDPPFRVHHHARRIMEFEWENEHDDSGSKLLTLTVTYQAD  560 (765)
Q Consensus       481 ~~~~~~~~~~~~aa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~v~~~~~  560 (765)
                           ....++++|+++.....   .+.       ..++...+|||.+....+.+.+  ++.       .+.++++.. +
T Consensus       478 -----~~~~~~~~~~~~~~~~~---~~~-------~~~~~~~~~~~~~~~~~~~~~~--~~~-------~~~~~~~~~-~  532 (681)
T 3n6r_A          478 -----DLRRVAAAAAAMHRVAE---IRR-------TRVSGRMDNHERRVGTEWVVTL--QGA-------DFPVTIAAD-H  532 (681)
T ss_dssp             -----HHHHHHHHHHHHHHHHH---HHH-------TTCTTCCTTCCCCCCSEEEEEC--SSC-------EEEEEEEEC-S
T ss_pred             -----HHHHHHHHHHHHHHHhh---hcc-------cccccCCCccccCCCcCEEEEE--CCE-------EEEEEEEEc-C
Confidence                 01122222222222211   010       1122335789987766655554  666       788988874 4


Q ss_pred             ccEEEEE-CCCceEEEEEEEEEeCCceEEEEECCEEEEEEEEEeecccceEEEEEeCCeeEEEEEecCCCCCCccccccc
Q 041518          561 GNYLIEM-GEDGSYISEVKATYLGEHKFRVEFDVVSMDVHLAVYNKGRIKHIHAWHGLHHHHFKQKLGLELPDEDETQHK  639 (765)
Q Consensus       561 ~~~~v~~-~~~~~~~v~~~~~~~~~~~l~~~~~G~~~~~~~~~~~~~~~~~~~v~~~g~~~~~~~~~~~~~~~~~~~~~~  639 (765)
                      +.|.+.+ ++ ..+.+.. .+..++..+.+++||+++.+++...+    +.++++.+|..+.+...++...   .....+
T Consensus       533 ~~~~~~~~~~-~~~~~~~-~~~~~~~~~~~~~dG~~~~~~~~~~~----~~~~l~~~g~~~~v~~~~~~~~---~~~~~~  603 (681)
T 3n6r_A          533 DGSTVSFDDG-SSMRVTS-DWTPGDQLANLMVDGAPLVLKVGKIS----GGFRIRTRGADLKVHVRTPRQA---ELARLM  603 (681)
T ss_dssp             SCEEEEETTS-CEEEEEE-CCCTTCSEEEEEETTEEEEEEEEEET----TEEEEECSSCCEEEEEECHHHH---HHHTTS
T ss_pred             CeEEEEEeCC-cEEEEEE-EecCCCeEEEEEECCEEEEEEEEEeC----CEEEEEECCeEEEEEecCchhh---hhcccc
Confidence            4599998 55 5555542 01123345889999999999998877    8999999999999987765321   000111


Q ss_pred             cccccCCCCCCcccCCCcceEEEEEcCCCCeecCCCeEEEEEecceEEEEEcCCCeEEEEEEcCCCCccCCCCeEEEEE
Q 041518          640 TSFETATGPPGSVLSPMAGLVVKVLANDGTKVEEGQPILVLEAMKMEHVVKAPTTGVVHGLQVTAGQQVSDGSVLFRLQ  718 (765)
Q Consensus       640 ~~~~~~~~~~~~v~ap~~G~v~~~~v~~Gd~V~~G~~l~~~eamKm~~~i~ap~~G~v~~~~~~~G~~v~~g~~l~~i~  718 (765)
                       ......++...|+|||||+|++|+|++||.|++||+|++||+|||+++|+||.+|+|+++++++||+|..|++|++|+
T Consensus       604 -~~~~~~~~~~~v~ap~~G~v~~~~v~~Gd~V~~g~~l~~iEamKm~~~i~ap~~G~v~~i~~~~G~~v~~g~~l~~i~  681 (681)
T 3n6r_A          604 -PEKLPPDTSKMLLCPMPGLIVKVDVEVGQEVQEGQALCTIEAMKMENILRAEKKGVVAKINASAGNSLAVDDVIMEFE  681 (681)
T ss_dssp             -CCCCCCCCCSEEECCSCEEEEEECCCTTCEECTTCEEEEEECSSCEEEEECSSSEEEEEECCCTTCEECTTCEEEEEC
T ss_pred             -ccccCCCCCCeEECCCcEEEEEEEeCCCCEEcCCCEEEEEEecCceeEEECCCCeEEEEEEeCCcCEeCCCCEEEEEC
Confidence             122344567889999999999999999999999999999999999999999999999999999999999999999884
>3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A Back     alignment and structure
>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Back     alignment and structure
>1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A Back     alignment and structure
>2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} Back     alignment and structure
>2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... Back     alignment and structure
>4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} Back     alignment and structure
>3vot_A L-amino acid ligase, BL00235; ATP-grAsp motif, ATP-binding; HET: ADP PG4; 1.80A {Bacillus licheniformis} Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis} Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* Back     alignment and structure
>2yw2_A Phosphoribosylamine--glycine ligase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP B purine nucleotide biosynthetic pathway; HET: ATP; 1.80A {Aquifex aeolicus} PDB: 2yya_A Back     alignment and structure
>2qk4_A Trifunctional purine biosynthetic protein adenosi; purine synthesis, enzyme, protein-ATP complex, structural GE structural genomics consortium, SGC; HET: ATP; 2.45A {Homo sapiens} Back     alignment and structure
>2ip4_A PURD, phosphoribosylamine--glycine ligase; GAR synthetase, purine nucleotid structural genomics, NPPSFA; 2.80A {Thermus thermophilus} Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>2yrx_A Phosphoribosylglycinamide synthetase; glycinamide ribonucleotide synthetase, GAR synthetase; HET: AMP; 1.90A {Geobacillus kaustophilus} PDB: 2yrw_A* 2ys6_A* 2ys7_A Back     alignment and structure
>1vkz_A Phosphoribosylamine--glycine ligase; TM1250, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>3lp8_A Phosphoribosylamine-glycine ligase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2xcl_A Phosphoribosylamine--glycine ligase; GAR-SYN, ATP-grAsp, metal binding; HET: ANP; 2.10A {Bacillus subtilis} PDB: 2xd4_A* Back     alignment and structure
>3mjf_A Phosphoribosylamine--glycine ligase; structural genomics, CEN structural genomics of infectious diseases, csgid; HET: MSE PGE; 1.47A {Yersinia pestis} PDB: 1gso_A Back     alignment and structure
>4fu0_A D-alanine--D-alanine ligase 7; vancomycin resistance, peptidoglycan synthesis, D-Ala:D-Ser ATP-grAsp domain; HET: ADP; 2.35A {Enterococcus faecalis} Back     alignment and structure
>2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, carbamoylphosphate synthase subunit (split gene in MJ); 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A 4egj_A Back     alignment and structure
>1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 Back     alignment and structure
>3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} PDB: 3r5f_A* 3rfc_A* Back     alignment and structure
>3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, A binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} PDB: 3q1k_A* Back     alignment and structure
>2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 3n8d_A* 2i80_A* Back     alignment and structure
>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* Back     alignment and structure
>3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans} Back     alignment and structure
>3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase RV2981C, structural genomics, TB structural GENO consortium, TBSGC; 2.10A {Mycobacterium tuberculosis} Back     alignment and structure
>3tqt_A D-alanine--D-alanine ligase; cell envelope; 1.88A {Coxiella burnetii} Back     alignment and structure
>3r5x_A D-alanine--D-alanine ligase; alpha-beta structure, cytosol, structural genomics, for structural genomics of infectious diseases, csgid; HET: MSE ATP; 2.00A {Bacillus anthracis} PDB: 3r23_A* Back     alignment and structure
>1e4e_A Vancomycin/teicoplanin A-type resistance protein; ligase, cell WALL, antibiotic resistance, membrane, peptidog synthesis; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* Back     alignment and structure
>3se7_A VANA; alpha-beta structure, D-alanine-D-lactate ligase, ligase; HET: ATP; 3.07A {} Back     alignment and structure
>2fb9_A D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} PDB: 2zdh_A* 2yzg_A 2yzn_A* 2yzm_A* 2zdg_A* 2zdq_A* Back     alignment and structure
>2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori} Back     alignment and structure
>1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* Back     alignment and structure
>2r85_A PURP protein PF1517; ATP-grAsp superfamily, unknown function; HET: AMP; 1.70A {Pyrococcus furiosus} SCOP: c.30.1.8 d.142.1.9 PDB: 2r84_A* 2r86_A* 2r87_A* Back     alignment and structure
>2r7k_A 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofuranosyl 5'-monophosphate synthetase...; ATP-grAsp superfamily, ATP-binding; HET: ACP AMZ; 2.10A {Methanocaldococcus jannaschii} SCOP: c.30.1.8 d.142.1.9 PDB: 2r7l_A* 2r7m_A* 2r7n_A* Back     alignment and structure
>2pbz_A Hypothetical protein; NYSGXRC, PSI-II, IMP biosynthesis, ATP binding protein, PURP structural genomics, protein structure initiative; HET: ATP; 2.50A {Thermococcus kodakarensis} SCOP: c.30.1.8 d.142.1.9 Back     alignment and structure
>3df7_A Putative ATP-grAsp superfamily protein; putative protein, PSI-II, nysgrc., structural genomics, protein structure initiative; 1.87A {Archaeoglobus fulgidus} Back     alignment and structure
>1gsa_A Glutathione synthetase; ligase; HET: ADP GSH; 2.00A {Escherichia coli} SCOP: c.30.1.3 d.142.1.1 PDB: 1gsh_A 2glt_A 1glv_A Back     alignment and structure
>1z2n_X Inositol 1,3,4-trisphosphate 5/6-kinase; inositol phosphate kinase, ATP-grAsp, transferase; HET: ADP; 1.20A {Entamoeba histolytica} PDB: 1z2o_X* 1z2p_X* Back     alignment and structure
>3ln7_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamylcysteine ligase domain, ATP-grAsp domain, HYBR enzyme, ATP-binding; 3.20A {Pasteurella multocida} Back     alignment and structure
>1wr2_A Hypothetical protein PH1789; structural genomics, NPPSFA, national on protein structural and functional analyses; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3ln6_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamyl cysteine ligase domain, ATP-grAsp domain, HYB enzyme; 2.95A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>1i7n_A Synapsin II; synapse, phosphorylation, neuropeptide; 1.90A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1i7l_A 1auv_A 1aux_A* Back     alignment and structure
>2p0a_A Synapsin-3, synapsin III; neurotransmitter release, schizophrenia, vesicle T structural genomics, structural genomics consortium, SGC, neuropeptide; HET: ANP; 1.90A {Homo sapiens} Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Back     alignment and structure
>2q7d_A Inositol-tetrakisphosphate 1-kinase; inositol kinase, ITPK1, inositol 1,3,4-5/6 phosphate, inositol phosphate, inositolphosphate; HET: ANP; 1.60A {Homo sapiens} PDB: 2qb5_A* 2odt_X Back     alignment and structure
>2cqy_A Propionyl-COA carboxylase alpha chain, mitochondrial; PCCA, B domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2fp4_B Succinyl-COA ligase [GDP-forming] beta-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.23.4.1 d.142.1.4 PDB: 2fpg_B* 2fpi_B* 2fpp_B* 1euc_B* 1eud_B* Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>2nu8_B SCS-beta, succinyl-COA synthetase beta chain; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.23.4.1 d.142.1.4 PDB: 1scu_B* 2nu6_B* 1jkj_B* 2nu7_B* 2nu9_B* 2nua_B* 2scu_B* 1jll_B* 1cqj_B* 1cqi_B* Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>3t7a_A Inositol pyrophosphate kinase; ATP-grAsp fold, transferase; HET: ADP; 1.70A {Homo sapiens} PDB: 3t9a_A* 3t9b_A* 3t9c_A* 3t9d_A* 3t9e_A* 3t9f_A* 4gb4_A* 4hn2_A* 3t54_A* 3t99_A* Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A Back     alignment and structure
>3ufx_B Succinyl-COA synthetase beta subunit; ATP-grAsp fold, ligase; HET: GDP; 2.35A {Thermus aquaticus} Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* Back     alignment and structure
>1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 Back     alignment and structure
>3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* Back     alignment and structure
>3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
>3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A Back     alignment and structure
>1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A Back     alignment and structure
>3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} Back     alignment and structure
>3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} Back     alignment and structure
>1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A Back     alignment and structure
>4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A Back     alignment and structure
>3tig_A TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Silurana} PDB: 3tii_A* 3tin_A* Back     alignment and structure
>1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A Back     alignment and structure
>2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 Back     alignment and structure
>3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A Back     alignment and structure
>3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} Back     alignment and structure
>3mwd_A ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_A* Back     alignment and structure
>3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3pff_A ATP-citrate synthase; phosphohistidine, organic acid, ATP-grAsp, lyase, transferas; HET: TLA ADP; 2.30A {Homo sapiens} Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 Back     alignment and structure
>3our_B EIIA, phosphotransferase system IIA component; exhibit no hydrolase activity1, lyase-transferase complex; 2.20A {Vibrio vulnificus} SCOP: b.84.3.1 Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A Back     alignment and structure
>1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
>2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>3d4r_A Domain of unknown function from the PFAM-B_34464; structural genomics, joint center for structural genomics; HET: MSE; 2.20A {Methanococcus maripaludis} Back     alignment and structure
>3our_B EIIA, phosphotransferase system IIA component; exhibit no hydrolase activity1, lyase-transferase complex; 2.20A {Vibrio vulnificus} SCOP: b.84.3.1 Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>2io8_A Bifunctional glutathionylspermidine synthetase/amidase; ligase, hydrolase; HET: ADP; 2.10A {Escherichia coli} SCOP: c.30.1.7 d.3.1.15 d.142.1.8 PDB: 2io7_A* 2io9_A* 2ioa_A* 2iob_A 3o98_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} Back     alignment and structure
>3n6x_A Putative glutathionylspermidine synthase; domain of unknown function (DUF404), structural genomics; 2.35A {Methylobacillus flagellatus} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>3pdi_B Nitrogenase MOFE cofactor biosynthesis protein NI; nitrogenase cofactor maturation, NIFB, nifdk, NIFH; HET: CZL; 2.40A {Azotobacter vinelandii} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2auk_A DNA-directed RNA polymerase beta' chain; sandwich-barrel hybrid motif, transferase; 2.30A {Escherichia coli} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3lu0_D DNA-directed RNA polymerase subunit beta'; E. coli RNA polymerase, nucleotidyltransferase, transcription, transferase; 11.20A {Escherichia coli} PDB: 3iyd_D* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>2bco_A Succinylglutamate desuccinylase; NESG, VPR14, structural genomics, PSI, protein structure initiative; 2.33A {Vibrio parahaemolyticus} SCOP: c.56.5.7 PDB: 2g9d_A Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 765
d2j9ga3216 d.142.1.2 (A:115-330) Biotin carboxylase (BC), dom 4e-59
d1ulza3214 d.142.1.2 (A:115-328) Biotin carboxylase (BC), dom 2e-58
d1a9xa5275 d.142.1.2 (A:128-402) Carbamoyl phosphate syntheta 6e-57
d2r7ka2238 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carbo 2e-43
d1ulza2114 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-term 4e-43
d2j9ga2114 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-term 7e-39
d1w96a3267 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M 7e-39
d1w96a2170 c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N s 3e-38
d1a9xa6259 d.142.1.2 (A:677-935) Carbamoyl phosphate syntheta 1e-34
d2r85a2235 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carbo 2e-32
d1uc8a2192 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme Ly 3e-26
d1kjqa3206 d.142.1.2 (A:113-318) Glycinamide ribonucleotide t 5e-23
d2j9ga1116 b.84.2.1 (A:331-446) Biotin carboxylase (BC), C-do 2e-22
d1i7na2206 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus nor 1e-21
d3etja3198 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribo 1e-21
d1ulza1123 b.84.2.1 (A:329-451) Biotin carboxylase (BC), C-do 3e-21
d1w96a1116 b.84.2.1 (A:451-566) Acetyl-CoA carboxylase, BC-C 1e-20
d1gsoa3224 d.142.1.2 (A:104-327) Glycinamide ribonucleotide s 8e-18
d1ehia2228 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase V 1e-17
d1iowa2210 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain 3e-17
d1dcza_77 b.84.1.1 (A:) Biotin carboxyl carrier domain of tr 2e-16
d1vkza3220 d.142.1.2 (A:94-313) Glycinamide ribonucleotide sy 4e-16
d1e4ea2211 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase V 6e-11
d1bdoa_80 b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carbox 7e-11
d1iyua_79 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 2e-10
d1qjoa_80 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 2e-10
d1k8ma_87 b.84.1.1 (A:) Lipoyl domain of the mitochondrial b 4e-10
d1laba_80 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 4e-10
d1gjxa_81 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 8e-10
d1pmra_80 b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate 8e-09
d1ghja_79 b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate 4e-08
>d2j9ga3 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} Length = 216 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: ATP-grasp
superfamily: Glutathione synthetase ATP-binding domain-like
family: BC ATP-binding domain-like
domain: Biotin carboxylase (BC), domain 2
species: Escherichia coli [TaxId: 562]

 Score =  197 bits (502), Expect = 4e-59
 Identities = 100/218 (45%), Positives = 145/218 (66%), Gaps = 3/218 (1%)

Query: 150 DKSASKRIMGAAGVPLVPGYHGN-EQDIDLMKSEAAKIGYPILIKPTHGGGGKGMRIVQS 208
           DK ++   M  AGVP VPG  G    D+D  ++ A +IGYP++IK + GGGG+GMR+V+ 
Sbjct: 1   DKVSAIAAMKKAGVPCVPGSDGPLGDDMDKNRAIAKRIGYPVIIKASGGGGGRGMRVVRG 60

Query: 209 PNDFVDSFLGAQREAAASFGINTILLEKYITQPRHIEVQIFGDKYGKVLHLYERDCSVQR 268
             +   S    + EA A+F  + + +EKY+  PRH+E+Q+  D  G  ++L ERDCS+QR
Sbjct: 61  DAELAQSISMTRAEAKAAFSNDMVYMEKYLENPRHVEIQVLADGQGNAIYLAERDCSMQR 120

Query: 269 RHQKIIEEAPAPNVTHDFRALLGQAAVSAAKAVSYHNAGTVEFIVDTVSDQFYFMEMNTR 328
           RHQK++EEAPAP +T + R  +G+    A   + Y  AGT EF+ +  + +FYF+EMNTR
Sbjct: 121 RHQKVVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFE--NGEFYFIEMNTR 178

Query: 329 LQVEHPVTEMIVDQDLVEWQIRVANGEPLPLSQSEVPL 366
           +QVEHPVTEMI   DL++ Q+R+A G+PL + Q EV +
Sbjct: 179 IQVEHPVTEMITGVDLIKEQLRIAAGQPLSIKQEEVHV 216
>d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus [TaxId: 63363]} Length = 214 Back     information, alignment and structure
>d1a9xa5 d.142.1.2 (A:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Length = 275 Back     information, alignment and structure
>d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} Length = 238 Back     information, alignment and structure
>d1ulza2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 114 Back     information, alignment and structure
>d2j9ga2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 114 Back     information, alignment and structure
>d1w96a3 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 267 Back     information, alignment and structure
>d1w96a2 c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 Back     information, alignment and structure
>d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d2r85a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} Length = 235 Back     information, alignment and structure
>d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]} Length = 192 Back     information, alignment and structure
>d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d2j9ga1 b.84.2.1 (A:331-446) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]} Length = 116 Back     information, alignment and structure
>d1i7na2 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 206 Back     information, alignment and structure
>d3etja3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]} Length = 198 Back     information, alignment and structure
>d1ulza1 b.84.2.1 (A:329-451) Biotin carboxylase (BC), C-domain {Aquifex aeolicus [TaxId: 63363]} Length = 123 Back     information, alignment and structure
>d1w96a1 b.84.2.1 (A:451-566) Acetyl-CoA carboxylase, BC-C subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 116 Back     information, alignment and structure
>d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Escherichia coli [TaxId: 562]} Length = 224 Back     information, alignment and structure
>d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} Length = 228 Back     information, alignment and structure
>d1iowa2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 Back     information, alignment and structure
>d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]} Length = 220 Back     information, alignment and structure
>d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]} Length = 211 Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 79 Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Length = 79 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query765
d1a9xa5275 Carbamoyl phosphate synthetase (CPS), large subuni 100.0
d2j9ga3216 Biotin carboxylase (BC), domain 2 {Escherichia col 100.0
d1ulza3214 Biotin carboxylase (BC), domain 2 {Aquifex aeolicu 100.0
d1w96a3267 Acetyl-CoA carboxylase, BC-M subdomain {Baker's ye 100.0
d1a9xa6259 Carbamoyl phosphate synthetase (CPS), large subuni 100.0
d1ulza1123 Biotin carboxylase (BC), C-domain {Aquifex aeolicu 99.96
d2j9ga1116 Biotin carboxylase (BC), C-domain {Escherichia col 99.96
d2j9ga2114 Biotin carboxylase (BC), N-terminal domain {Escher 99.95
d1ulza2114 Biotin carboxylase (BC), N-terminal domain {Aquife 99.95
d1kjqa3206 Glycinamide ribonucleotide transformylase PurT, do 99.95
d1w96a1116 Acetyl-CoA carboxylase, BC-C subdomain {Baker's ye 99.95
d1vkza3220 Glycinamide ribonucleotide synthetase (GAR-syn), d 99.94
d3etja3198 N5-carboxyaminoimidazole ribonucleotide synthetase 99.94
d1gsoa3224 Glycinamide ribonucleotide synthetase (GAR-syn), d 99.93
d1w96a2170 Acetyl-CoA carboxylase, BC-N subdomain {Baker's ye 99.92
d2r7ka2238 5-formaminoimidazole-4-carboxamide ribonucleotide 99.92
d1ehia2228 D-alanine:D-lactate ligase VanA, C-domain {Leucono 99.92
d1iowa2210 D-ala-D-ala ligase, C-domain {Escherichia coli, ge 99.92
d1e4ea2211 D-alanine:D-lactate ligase VanA, C-domain {Enteroc 99.9
d2r85a2235 5-formaminoimidazole-4-carboxamide ribonucleotide 99.88
d1uc8a2192 Lysine biosynthesis enzyme LysX ATP-binding domain 99.88
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase 99.8
d1i7na2206 Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116 99.75
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escheri 99.75
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferas 99.66
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferas 99.56
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase 99.53
d1laba_80 Lipoyl domain of dihydrolipoamide acetyltransferas 99.52
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain 99.51
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferas 99.46
d1pmra_80 Lipoyl domain of the 2-oxoglutarate dehydrogenase 99.38
d1y8ob1102 Lipoyl domain of dihydrolipoamide acetyltransferas 99.36
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 99.04
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 98.92
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 98.91
d1gsaa2192 Prokaryotic glutathione synthetase, C-domain {Esch 98.78
d2nu7b2238 Succinyl-CoA synthetase, beta-chain, N-terminal do 98.38
d2pbza2213 5-formaminoimidazole-4-carboxamide ribonucleotide 98.27
d1eucb2246 Succinyl-CoA synthetase, beta-chain, N-terminal do 98.02
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 97.6
d1iowa196 D-Ala-D-Ala ligase, N-domain {Escherichia coli, ge 97.5
d1vf7a_237 Multidrug resistance protein MexA domain {Pseudomo 97.16
d1onla_127 Protein H of glycine cleavage system {Thermus ther 96.94
d1hpca_131 Protein H of glycine cleavage system {Pea (Pisum s 96.84
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 96.7
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escheri 96.69
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 96.43
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferas 96.37
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase 96.3
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferas 95.8
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.73
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase 95.72
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain 95.6
d1ehia1132 D-alanine:D-lactate ligase VanA, N-domain {Leucono 95.24
d1laba_80 Lipoyl domain of dihydrolipoamide acetyltransferas 95.16
d1gpra_158 Glucose permease IIa domain, IIa-glc {Bacillus sub 95.1
d1pmra_80 Lipoyl domain of the 2-oxoglutarate dehydrogenase 94.8
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferas 94.76
d2f3ga_150 Glucose-specific factor III (glsIII) {Escherichia 94.54
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 93.92
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 93.82
d1gpra_158 Glucose permease IIa domain, IIa-glc {Bacillus sub 93.54
d2f3ga_150 Glucose-specific factor III (glsIII) {Escherichia 93.5
d1vf7a_ 237 Multidrug resistance protein MexA domain {Pseudomo 93.48
d2gpra_154 Glucose permease IIa domain, IIa-glc {Mycoplasma c 93.45
d1uc8a188 Lysine biosynthesis enzyme LysX, N-terminal domain 93.39
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 93.23
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 93.16
d2gpra_154 Glucose permease IIa domain, IIa-glc {Mycoplasma c 93.03
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 92.38
d1vkza290 Glycinamide ribonucleotide synthetase (GAR-syn), N 91.91
d1y8ob1102 Lipoyl domain of dihydrolipoamide acetyltransferas 91.56
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 91.1
d1e4ea1130 D-alanine:D-lactate ligase VanA, N-domain {Enteroc 90.67
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 88.83
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 88.21
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 88.02
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 87.36
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 87.28
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 87.21
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 86.29
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 86.19
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 86.14
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 86.04
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 85.88
d2r7ka1123 5-formaminoimidazole-4-carboxamide ribonucleotide 85.69
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 85.39
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 85.33
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 85.04
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 84.27
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 84.22
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 84.16
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 83.88
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 83.87
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 83.83
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 83.78
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 83.59
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 83.47
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 83.44
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 83.34
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 83.08
d1m1na_477 Nitrogenase iron-molybdenum protein, alpha chain { 83.03
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 82.96
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 82.08
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 82.01
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 81.9
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 81.82
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 81.51
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 81.34
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 80.96
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 80.66
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 80.44
d1id1a_153 Rck domain from putative potassium channel Kch {Es 80.43
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 80.29
>d1a9xa5 d.142.1.2 (A:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ATP-grasp
superfamily: Glutathione synthetase ATP-binding domain-like
family: BC ATP-binding domain-like
domain: Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=1.9e-39  Score=341.12  Aligned_cols=258  Identities=16%  Similarity=0.235  Sum_probs=221.5

Q ss_pred             CHHHHHHHHHHCCCCCCCccccCCCCHHHHHHHHHHhCCcEEEeecCCCCCccEEEECChhHHHHHHHHHHHHHHhcCCC
Q 041518          150 DKSASKRIMGAAGVPLVPGYHGNEQDIDLMKSEAAKIGYPILIKPTHGGGGKGMRIVQSPNDFVDSFLGAQREAAASFGI  229 (765)
Q Consensus       150 DK~~~r~~l~~~Gvpvp~~~~~~~~s~~e~~~~~~~ig~PvVVKP~~g~Gg~Gv~~v~s~~el~~a~~~~~~ea~~~fg~  229 (765)
                      ||.++|++|+++|||+|++..+.  +.+++.++++++|||+||||..|+||+|+++|++.+|+.++++++...    +++
T Consensus         1 Dr~~~r~~~~~~gip~~~~~~~~--~~~ea~~~~~~ig~PvviKp~~~~gg~G~~~v~~~~el~~~~~~a~~~----~~~   74 (275)
T d1a9xa5           1 DRRRFDVAMKKIGLETARSGIAH--TMEEALAVAADVGFPCIIRPSFTMGGSGGGIAYNREEFEEICARGLDL----SPT   74 (275)
T ss_dssp             SHHHHHHHHHHTTCCCCSEEEES--SHHHHHHHHHHHCSSEEEEETTCCTTTTCEEESSHHHHHHHHHHHHHH----CTT
T ss_pred             CHHHHHHHHHHCCCCCCCceEeC--CHHHHHHHHHHcCCCEEEEECCCCCCCceEEeeCHHHHHHHHHHHHhh----CCC
Confidence            89999999999999999987655  999999999999999999999999999999999999999998876653    567


Q ss_pred             CcEEEecccCCCeeEEEEEEEeccccEE--EEEeeeccccccceeeeeecCCCCCCHHHHHHHHHHHHHHHHHcCCC-ce
Q 041518          230 NTILLEKYITQPRHIEVQIFGDKYGKVL--HLYERDCSVQRRHQKIIEEAPAPNVTHDFRALLGQAAVSAAKAVSYH-NA  306 (765)
Q Consensus       230 ~~vlVEeyI~ggrei~v~v~~d~~g~vv--~l~~r~~s~~~~~~k~~e~~Pa~~l~~~~~~~l~~~a~~i~~alg~~-G~  306 (765)
                      +.++||+||+|++|+++++++|++|+.+  .+.+++|+.++++++.++.+|++.++++.+++|.+.+.++++++||. |.
T Consensus        75 ~~v~iEe~l~g~~e~~v~~~~d~~g~~~~~~~~~~~~~~~~~~~~~~~~aP~~~L~~~~~~~i~~~a~~i~~~lg~~~G~  154 (275)
T d1a9xa5          75 KELLIDESLIGWKEYEMEVVRDKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG  154 (275)
T ss_dssp             SCEEEEECCTTSEEEEEEEEECTTCCEEEEEEEEESSCTTSCGGGSCEEESCCSCCHHHHHHHHHHHHHHHHHHTCCSEE
T ss_pred             CcEEEeeecCCchhheeeeEEecCCCEEEEEeeccccccCcccCceeEEcCCCcCCHHHHHHHHHHHHHHHHHcCceECc
Confidence            8999999999889999999999988854  56789999999999999999999999999999999999999999996 99


Q ss_pred             eEEEEEEECCCCcEEEEEecccCCccccccceecCCCHHHHHHHHHcCCCCCCCCCCcccceEEEEEEecccCCCCCCCC
Q 041518          307 GTVEFIVDTVSDQFYFMEMNTRLQVEHPVTEMIVDQDLVEWQIRVANGEPLPLSQSEVPLLGHAFEARIYAENVPKGFLP  386 (765)
Q Consensus       307 ~~vEf~~~~~~g~~~~iEiN~R~~~~~~~~e~~tGvDl~~~~i~~a~G~~l~~~~~~~~~~g~ai~~ri~ae~p~~~f~p  386 (765)
                      +++||+++++++++||+|+|||+|++|++++.+||+|++++++++++|.+++..+....           .......+.|
T Consensus       155 ~~~ef~~~~~~~~~~~iE~npR~~~~~~~~~~~tgidlv~~~~~~a~G~~l~~~~~~~~-----------~~~~~~~~~~  223 (275)
T d1a9xa5         155 SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT-----------GGRTPASFEP  223 (275)
T ss_dssp             EEEEEEECTTTCCEEEEEEESSCCHHHHHHHHHHSCCHHHHHHHHHTTCCGGGSBCTTT-----------TTCSBSCSCC
T ss_pred             eEEEEEEeCCCCEEEEEEecCCCCceehhhhHhhCCCHHHHHHHHHcCCCCcccccccc-----------cccCccccCC
Confidence            99999999768899999999999999999999999999999999999999875443321           1122233555


Q ss_pred             CCcceeEEeeCCCCCCcEEEEecccCCCeeCCccCCcceEEEEEe
Q 041518          387 ATGVLHHYHPVPVSSKAVRVETGVEQGDTVSMHYDPMIANLWYGA  431 (765)
Q Consensus       387 ~~G~i~~~~~p~~~~~~vrv~~~v~~G~~v~~~~d~~~~~~i~~g  431 (765)
                      ..+.+.. ..|.     .+++....+|..+++.||| +|++|++|
T Consensus       224 ~~~~~~~-k~~~-----~~~~~~~~~~~~l~~~~~s-~g~vi~~G  261 (275)
T d1a9xa5         224 SIDYVVT-KIPR-----FNFEKFAGANDRLTTQMKS-VGEVMAIG  261 (275)
T ss_dssp             BCSSEEE-EEEE-----CCGGGCTTSCCBCCSSCCC-CEEEEEEE
T ss_pred             CCCcEec-Cccc-----eecCCCCCCCCEeCCCccc-CEEEEEEE
Confidence            5554431 2221     2334445677888899999 99999998
>d2j9ga3 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w96a3 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulza1 b.84.2.1 (A:329-451) Biotin carboxylase (BC), C-domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2j9ga1 b.84.2.1 (A:331-446) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j9ga2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulza2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w96a1 b.84.2.1 (A:451-566) Acetyl-CoA carboxylase, BC-C subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3etja3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w96a2 c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} Back     information, alignment and structure
>d1iowa2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]} Back     information, alignment and structure
>d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d2r85a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1i7na2 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsaa2 d.142.1.1 (A:123-314) Prokaryotic glutathione synthetase, C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nu7b2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pbza2 d.142.1.9 (A:100-312) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1eucb2 d.142.1.4 (B:0-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1iowa1 c.30.1.2 (A:1-96) D-Ala-D-Ala ligase, N-domain {Escherichia coli, gene ddlB [TaxId: 562]} Back     information, alignment and structure
>d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ehia1 c.30.1.2 (A:3-134) D-alanine:D-lactate ligase VanA, N-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} Back     information, alignment and structure
>d1uc8a1 c.30.1.6 (A:1-88) Lysine biosynthesis enzyme LysX, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e4ea1 c.30.1.2 (A:2-131) D-alanine:D-lactate ligase VanA, N-domain {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2r7ka1 c.30.1.8 (A:1-123) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1m1na_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha chain {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure