Citrus Sinensis ID: 041519


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-
TNILQVPALNKEIINEVVEECGCLPLAIVTVAASMSGEEEIYEWQNALNELRGRLRSLNDVDTKVFGRLEFSYHRLKDEKLQQCFLYCALGHTILNRLVNCCLLESAKDGSCVKMHDLIRDMALRITSKSPLFMVTAGLRLLKFPGEQEWEENLERVSLMENDFEEIPSNMSPHCEILSTLLLQHNKYLQRIPECFFVHMHGLKVLNLCHTSIEVLPNSVSDLTNLRSLLLRWCGILKRVPSLAKLLALQYLDLEGTWIEEVPEGMEMLENLSHLSLFMAAEEAARLSDRLDTFVGYFSTLNDFNIYVKSTDGRGSKNYCLLLSASGKRGFLEVDKSVRLFACKICETEETIVLPEDVQYLEMFGVDDVASLNDVLPREQGLNLFSLRLLPALQNLEVLAVGYCFLIEEIVAVEDEETEKELATNTIINTVTLPRLKKLHLEDLREFKSICSDNGVLVCNSLQEIEVYNCPKLKRLSLSLPLLDNGQPSPPPALEVIEIKKELWESLEWDQPNAKDVLNPY
cccccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccEEcccccEEEccHHHHHHHHHHHHcccEEEEEcccEEEcccccccccccEEEEEccccccccccccccccccccEEEEccccccccccccHHHccccccEEEEccccccccccccccccccccEEEccccccccccccHHccccccEEEccccccccccccccccccccccccEEEccHHHHHHHHHHHHHHcccccccccEEEEEccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccEEEEcccccccccccccccccccccccccccEEEEccHHHHccccccccccccccccc
cccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccHHHHEEcHcccccHHHHHHHHHHHHcHHHHHHHHHHHHHccccccccEEHHHHHHHHHHHHHHccccEEEEcccccccccccccHHHHHEEEEcccccHHHccccccccccccEEEEEEccccccEccHHHHHccccEEEEEccccccHcccHHHcccHHccEEEccccccccccHHHccccccEEEEEcccccHHccccHcccHccEEEEEcccccccccccccHHHHHHHHHHHHHHcHcccccHHcccHHHHHHHHHccccccHHHHHHHHHccccccccHHHcccccHHcHccccccccccccHHHccccccccccccccHcccccccEEEEcccHcHHHccccccccHHHHEcccccccccccccccEEEEcccHcHHHccccccccccccccEEEEcccccHHccccccccHHHcccccccccEEEcccHHHHHHcccccHHHHHHcccc
tnilqvpaLNKEIINEVVEECGCLPLAIVTVAASMSGEEEIYEWQNALNELRGRLrslndvdtkvfGRLEFSYHRLKDEKLQQCFLYCALGHTILNRLVNCCLlesakdgscvkMHDLIRDMALRITSKSPLFMVTAGLRllkfpgeqeWEENLERVSLMEndfeeipsnmsphCEILSTLLLQHNKYLQRIPECFFVHMHGLKVLNLCHTSIevlpnsvsdLTNLRSLLLRWCGILKRVPSLAKLLALQYLDlegtwieevPEGMEMLENLSHLSLFMAAEEAARLSDRLDTFVGYFSTLNDFNiyvkstdgrgsknyclllsasgkrgflevDKSVRLFACKIceteetivlpedvqylemfgvddvaslndvlpreqglnlFSLRLLPALQNLEVLAVGYCFLIEEIvavedeetekELATntiintvtlprlkklhLEDLREFKsicsdngvlvcnslqeievyncpklkrlslslplldngqpspppalEVIEIKKELWESLewdqpnakdvlnpy
tnilqvpalNKEIINEVVEECGCLPLAIVTVAASMSGEEEIYEWQNALNELRGRLRSLNDVDTKVFGRLEFSYHRLKDEKLQQCFLYCALGHTILNRLVNCCLLESAKDGSCVKMHDLIRDMALRITSKSPLFMVTAGLRLLKFPGEQEWEENLERVSLMENDFEEIPSNMSPHCEILSTLLLQHNKYLQRIPECFFVHMHGLKVLNLCHTSIEVLPNSVSDLTNLRSLLLRWCGILKRVPSLAKLLALQYLDLEGTWIEEVPEGMEMLENLSHLSLFMAAEEAARLSDRLDTFVGYFSTLNDFNIYVkstdgrgsKNYCLLLSASGKRGFLEVDKSVRLFACKICEteetivlpedVQYLEMFGVDDVASLNDVLPREQGLNLFSLRLLPALQNLEVLAVGYCFLIEEIVAVedeetekelatntiintvtlprlKKLHLEDLREFKSICSDNGVLVCNSLQEIEVYNCPKLKRLSLSLPLLDNGQPSPPPALEVIEIKKELWeslewdqpnakdvlnpy
TNILQVPALNKEIINEVVEECGCLPLAIVTVAASMSGEEEIYEWQNALNELRGRLRSLNDVDTKVFGRLEFSYHRLKDEKLQQCFLYCALGHTILNRLVNCCLLESAKDGSCVKMHDLIRDMALRITSKSPLFMVTAGLRLLKFPGEQEWEENLERVSLMENDFEEIPSNMSPHCEILSTLLLQHNKYLQRIPECFFVHMHGLKVLNLCHTSIEVLPNSVSDLTNLRSLLLRWCGILKRVPSlakllalqyldlEGTWIEEVPEGMEMLENLSHLSLFMAAEEAARLSDRLDTFVGYFSTLNDFNIYVKSTDGRGSKNYCLLLSASGKRGFLEVDKSVRLFACKICETEETIVLPEDVQYLEMFGVDDVASLNDVLPREQGLNLFSLRLLPALQNLEVLAVGYCFlieeivavedeetekelatNTIINTVTLPRLKKLHLEDLREFKSICSDNGVLVCNSLQEIEVYNCpklkrlslslpllDNGQPSPPPALEVIEIKKELWESLEWDQPNAKDVLNPY
***LQVPALNKEIINEVVEECGCLPLAIVTVAASMSGEEEIYEWQNALNELRGRLRSLNDVDTKVFGRLEFSYHRLKDEKLQQCFLYCALGHTILNRLVNCCLLESAKDGSCVKMHDLIRDMALRITSKSPLFMVTAGLRLLKFPGEQEWEENLERVSLM***F******MSPHCEILSTLLLQHNKYLQRIPECFFVHMHGLKVLNLCHTSIEVLPNSVSDLTNLRSLLLRWCGILKRVPSLAKLLALQYLDLEGTWIEEVPEGMEMLENLSHLSLFMAAEEAARLSDRLDTFVGYFSTLNDFNIYVKSTDGRGSKNYCLLLSASGKRGFLEVDKSVRLFACKICETEETIVLPEDVQYLEMFGVDDVASLNDVLPREQGLNLFSLRLLPALQNLEVLAVGYCFLIEEIVAVEDEETEKELATNTIINTVTLPRLKKLHLEDLREFKSICSDNGVLVCNSLQEIEVYNCPKLKRLSLSL*****************************************
**ILQVPALNKEIINEVVEECGCLPLAIVTVAASMSGEEEIYEWQNALNELRGRLRS**DVDTKVFGRLEFSYHRLKDEKLQQCFLYCALGHTILNRLVNCCLLESAKDGSCVKMHDLIRDMALRITSKSPLFMVTAGLRLLKFPGEQEWEENLERVSLMENDFEEIPSNMSPHCEILSTLLLQHNKYLQRIPECFFVHMHGLKVLNLCHTSIEVLPNSVSDLTNLRSLLLRWCGILKRVPSLAKLLALQYLDLEGTWIEEVPEGMEMLENLSHLSLFMAAEEAA**********GYFSTLNDFNIYVKSTDGRGSKNYCLLLSASGKRGFLEVDKSVRLFACKICETEETIVLPEDVQYLEMFGVDDVASLNDVLPREQGLNLFSLRLLPALQNLEVLAVGYCFLIEEIVAVEDEETE**********TVTLPRLKKLHLEDLREFKSICSDNGVLVCNSLQEIEVYNCPKLKRLSLSLPLLDNGQPSPPPALEVIEIKKELWESLEWDQPNAKDVLNPY
TNILQVPALNKEIINEVVEECGCLPLAIVTVAASMSGEEEIYEWQNALNELRGRLRSLNDVDTKVFGRLEFSYHRLKDEKLQQCFLYCALGHTILNRLVNCCLLESAKDGSCVKMHDLIRDMALRITSKSPLFMVTAGLRLLKFPGEQEWEENLERVSLMENDFEEIPSNMSPHCEILSTLLLQHNKYLQRIPECFFVHMHGLKVLNLCHTSIEVLPNSVSDLTNLRSLLLRWCGILKRVPSLAKLLALQYLDLEGTWIEEVPEGMEMLENLSHLSLFMAAEEAARLSDRLDTFVGYFSTLNDFNIYVKSTDGRGSKNYCLLLSASGKRGFLEVDKSVRLFACKICETEETIVLPEDVQYLEMFGVDDVASLNDVLPREQGLNLFSLRLLPALQNLEVLAVGYCFLIEEIVAVEDEETEKELATNTIINTVTLPRLKKLHLEDLREFKSICSDNGVLVCNSLQEIEVYNCPKLKRLSLSLPLLDNGQPSPPPALEVIEIKKELWESLEWDQPNAKDVLNPY
*****VPALNKEIINEVVEECGCLPLAIVTVAASMSGEEEIYEWQNALNELRGRLRSLNDVDTKVFGRLEFSYHRLKDEKLQQCFLYCALGHTILNRLVNCCLLESAKDGSCVKMHDLIRDMALRITSKSPLFMVTAGLRLLKFPGEQEWEENLERVSLMENDFEEIPSNMSPHCEILSTLLLQHNKYLQRIPECFFVHMHGLKVLNLCHTSIEVLPNSVSDLTNLRSLLLRWCGILKRVPSLAKLLALQYLDLEGTWIEEVPEGMEMLENLSHLSLFMAAEEAARLSDRLDTFVGYFSTLNDFNIYVKSTDGRGSKNYCLLLSASGKRGFLEVDKSVRLFACKICETEETIVLPEDVQYLEMFGVDDVASLNDVLPREQGLNLFSLRLLPALQNLEVLAVGYCFLIEEIVAVEDEETEKELATNTIINTVTLPRLKKLHLEDLREFKSICSDNGVLVCNSLQEIEVYNCPKLKRLSLSLPLLDNGQPSPPPALEVIEIKKELWESLEWDQPNAKDVLNPY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TNILQVPALNKEIINEVVEECGCLPLAIVTVAASMSGEEEIYEWQNALNELRGRLRSLNDVDTKVFGRLEFSYHRLKDEKLQQCFLYCALGHTILNRLVNCCLLESAKDGSCVKMHDLIRDMALRITSKSPLFMVTAGLRLLKFPGEQEWEENLERVSLMENDFEEIPSNMSPHCEILSTLLLQHNKYLQRIPECFFVHMHGLKVLNLCHTSIEVLPNSVSDLTNLRSLLLRWCGILKRVPSLAKLLALQYLDLEGTWIEEVPEGMEMLENLSHLSLFMAAEEAARLSDRLDTFVGYFSTLNDFNIYVKSTDGRGSKNYCLLLSASGKRGFLEVDKSVRLFACKICETEETIVLPEDVQYLEMFGVDDVASLNDVLPREQGLNLFSLRLLPALQNLEVLAVGYCFLIEEIVAVEDEETEKELATNTIINTVTLPRLKKLHLEDLREFKSICSDNGVLVCNSLQEIEVYNCPKLKRLSLSLPLLDNGQPSPPPALEVIEIKKELWESLEWDQPNAKDVLNPY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query521 2.2.26 [Sep-21-2011]
O81825919 Probable disease resistan yes no 0.497 0.281 0.358 2e-41
Q9T048985 Disease resistance protei no no 0.932 0.493 0.293 2e-36
Q42484909 Disease resistance protei no no 0.892 0.511 0.259 1e-31
O82484892 Putative disease resistan no no 0.460 0.269 0.323 3e-28
Q9FG91848 Probable disease resistan no no 0.834 0.512 0.280 3e-28
Q940K0889 Probable disease resistan no no 0.871 0.510 0.255 4e-28
Q9SI85893 Probable disease resistan no no 0.844 0.492 0.282 2e-27
Q8L3R3885 Disease resistance protei no no 0.489 0.288 0.325 4e-27
Q8RXS5888 Probable disease resistan no no 0.921 0.540 0.274 4e-26
Q9FLB4874 Putative disease resistan no no 0.894 0.533 0.256 6e-26
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function desciption
 Score =  171 bits (432), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 109/304 (35%), Positives = 169/304 (55%), Gaps = 45/304 (14%)

Query: 11  KEIINEVVEECGCLPLAIVTVAASMSGEEEIYEWQNALNELRGRLRSLNDVDT--KVFGR 68
           K I  +V  EC  LPLAI+T+  ++ G+ ++  W++ LN L+   RS   +DT  K+FG 
Sbjct: 295 KPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVWKHTLNLLK---RSAPSIDTEEKIFGT 351

Query: 69  LEFSYHRLKDEKLQQCFLYCAL----------------------------------GHTI 94
           L+ SY  L+D  ++ CFL+CAL                                  G T+
Sbjct: 352 LKLSYDFLQD-NMKSCFLFCALFPEDYSIKVSELIMYWVAEGLLDGQHHYEDMMNEGVTL 410

Query: 95  LNRLVNCCLLESAKDGSCVKMHDLIRDMALR-ITSKSPLF--MVTAGLRLLKFPGEQEWE 151
           + RL + CLLE       VKMHD++RD A+  ++S+   F  +V AG  L++FP + ++ 
Sbjct: 411 VERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEFP-QDKFV 469

Query: 152 ENLERVSLMENDFEEIPSNMSPHCEILSTLLLQHNKYLQRIPECFFVHMHGLKVLNLCHT 211
            +++RVSLM N  E +P+N+    E L  LLLQ N +++ +P  F      L++L+L   
Sbjct: 470 SSVQRVSLMANKLERLPNNVIEGVETL-VLLLQGNSHVKEVPNGFLQAFPNLRILDLSGV 528

Query: 212 SIEVLPNSVSDLTNLRSLLLRWCGILKRVPSLAKLLALQYLDLEGTWIEEVPEGMEMLEN 271
            I  LP+S S+L +LRSL+LR C  L+ +PSL  L+ LQ+LDL  + I E+P G+E L +
Sbjct: 529 RIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKLQFLDLHESAIRELPRGLEALSS 588

Query: 272 LSHL 275
           L ++
Sbjct: 589 LRYI 592




Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG91|DRL32_ARATH Probable disease resistance protein At5g43730 OS=Arabidopsis thaliana GN=At5g43730 PE=2 SV=1 Back     alignment and function description
>sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 Back     alignment and function description
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description
>sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|Q9FLB4|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query521
224109372 1077 BED finger-nbs-lrr resistance protein [P 0.975 0.471 0.367 4e-93
224108229 900 BED finger-nbs-lrr resistance protein [P 0.953 0.552 0.375 1e-91
224112395 1062 nbs-lrr resistance protein [Populus tric 0.953 0.467 0.389 4e-91
224115986 1093 BED finger-nbs-lrr resistance protein [P 0.967 0.461 0.383 6e-91
224110812 681 predicted protein [Populus trichocarpa] 0.975 0.745 0.370 1e-90
105922577 1183 NBS-LRR type disease resistance protein 0.959 0.422 0.357 3e-88
224113569 1139 BED finger-nbs-lrr resistance protein [P 0.953 0.436 0.364 4e-84
224144595 1176 BED finger-nbs-lrr resistance protein [P 0.955 0.423 0.355 5e-84
224105081 957 nbs-lrr resistance protein [Populus tric 0.955 0.520 0.382 2e-83
224106119 880 nbs-lrr resistance protein [Populus tric 0.944 0.559 0.371 2e-80
>gi|224109372|ref|XP_002333267.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222835868|gb|EEE74289.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  348 bits (893), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 250/680 (36%), Positives = 338/680 (49%), Gaps = 172/680 (25%)

Query: 1    TNIL-QVPALNKEIINEVVEECGCLPLAIVTVAASMSGEEEIYEWQNALNELRGRLRSLN 59
            T IL ++P+  +EI   +  EC  LPL I T+A +M G ++I EW+NAL EL+     L 
Sbjct: 406  TKILGRIPSEVEEIAKSMARECAGLPLGIKTMAGTMRGVDDICEWRNALEELKQSRVRLE 465

Query: 60   DVDTKVFGRLEFSYHRLKDEKLQQCFLYCAL----------------------------- 90
            D+D +VF  L FSY  LK+  LQQCFL+CAL                             
Sbjct: 466  DMDEEVFQILRFSYMHLKESALQQCFLHCALFPEDFMIPREDLIAYLIDEGVIKGLTRRE 525

Query: 91   -----GHTILNRLVNCCLLESAKDGS------CVKMHDLIRDMALRITSKSPLFMVTAGL 139
                 GHT+LN+L + CLLE AK  S       VKMHDLIRDMA++I  ++   MV AG 
Sbjct: 526  AEFDKGHTMLNKLESACLLEDAKLYSGRRCVRAVKMHDLIRDMAIQILQENSQGMVKAGA 585

Query: 140  RLLKFPGEQEWEENLERVSLMENDFEEIPSNMSPHCEILSTLLLQHNKYLQRIPECFFVH 199
            +L + PG +EW ENL RVSLM+N  +EIP + SP C  LSTLLL  N  LQ I + FF  
Sbjct: 586  QLRELPGAEEWTENLTRVSLMQNQIKEIPFSHSPRCPSLSTLLLCRNPKLQFIADSFFEQ 645

Query: 200  MHGLKVLNLCHTSIEVLPNSVSDLTNLRSLLLRWCGILKRVPSLAKLLALQYLDLEGTW- 258
            +HGLKVL+L +T I  LP+SVS+L +L +LLL  C +L+ VPSL KL AL+ LDL GTW 
Sbjct: 646  LHGLKVLDLSYTGITKLPDSVSELVSLTALLLIDCKMLRHVPSLEKLRALKRLDLSGTWA 705

Query: 259  IEEVPEGME---------------------MLENLSHLSLFMAAEEAARLSD-------- 289
            +E++P+GME                     +L  LSHL +F+  E   R +         
Sbjct: 706  LEKIPQGMECLCNLRYLIMNGCGEKEFPSGLLPKLSHLQVFVLEEWIPRPTGDYRERQDA 765

Query: 290  -------------RLDTFVGYFSTLNDFNIYVKSTDGRGS-KNYCLLLSASGK------- 328
                         +L++   +F   +D+  Y+KS D   S   Y +L+    K       
Sbjct: 766  PITVKGKEVGCLRKLESLACHFEGCSDYMEYLKSQDETKSLTTYQILVGPLDKYDYCYCY 825

Query: 329  -----------RGFLEVDKSVRLFACKICETEETIVLPEDVQYLEMFGVDDVASLNDVL- 376
                       RG L +D+               ++ P+D+Q L +   DD  SL D L 
Sbjct: 826  GYDGCRRKAIVRGNLSIDRDGGF----------QVMFPKDIQQLSIHNNDDATSLCDFLS 875

Query: 377  -----------------------------------PREQGL----------------NLF 385
                                               P   G+                 LF
Sbjct: 876  LIKSVTELEAITIFSCNSMESLVSSSWFRSAPLPSPSYNGIFSSLKKFFCSGCSSMKKLF 935

Query: 386  SLRLLPALQNLEVLAVGYCFLIEEIVA---VEDEETEKELATNTIINTVTLPRLKKLHLE 442
             L LLP L  LE + V  C  +EEI+     ++E    E ++++ I  + L +L  L L 
Sbjct: 936  PLVLLPNLVKLEEITVTKCEKMEEIIGGTRSDEEGVMGEESSSSSITDLKLTKLSSLTLI 995

Query: 443  DLREFKSICSDNGVLVCNSLQEIEVYNCPKLKRLSLSLPLLDNGQPSPPPALEVIEI-KK 501
            +L E +SICS    L+C+SL+EI VYNC KLKR+ + LPLL+NGQPSPPP+L  IE+  +
Sbjct: 996  ELPELESICS--AKLICDSLKEIAVYNCKKLKRMPICLPLLENGQPSPPPSLRKIEVYPE 1053

Query: 502  ELWES-LEWDQPNAKDVLNP 520
            E WES +EW+ PNAKDVL P
Sbjct: 1054 EWWESVVEWEHPNAKDVLRP 1073




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224108229|ref|XP_002333416.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222836514|gb|EEE74921.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224112395|ref|XP_002332783.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222833192|gb|EEE71669.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224115986|ref|XP_002332020.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222875245|gb|EEF12376.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224110812|ref|XP_002333023.1| predicted protein [Populus trichocarpa] gi|222834655|gb|EEE73118.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|105922577|gb|ABF81424.1| NBS-LRR type disease resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224113569|ref|XP_002332538.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222832682|gb|EEE71159.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224144595|ref|XP_002325344.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222862219|gb|EEE99725.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224105081|ref|XP_002333864.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222838740|gb|EEE77105.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224106119|ref|XP_002333721.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222838363|gb|EEE76728.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query521
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.351 0.199 0.361 1.1e-36
TAIR|locus:2136447 985 AT4G27190 [Arabidopsis thalian 0.426 0.225 0.333 1.8e-33
TAIR|locus:2036214851 AT1G15890 [Arabidopsis thalian 0.349 0.213 0.377 6.8e-24
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.282 0.166 0.407 1.1e-23
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.261 0.149 0.342 4.7e-23
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.282 0.164 0.407 8.5e-23
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.257 0.149 0.368 1.3e-22
TAIR|locus:2031366898 AT1G63350 "AT1G63350" [Arabido 0.280 0.162 0.345 2e-21
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.351 0.207 0.357 3.5e-21
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.261 0.153 0.383 6.4e-21
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 282 (104.3 bits), Expect = 1.1e-36, Sum P(3) = 1.1e-36
 Identities = 68/188 (36%), Positives = 108/188 (57%)

Query:    91 GHTILNRLVNCCLLESAKDGSCVKMHDLIRDMALR-ITSKSPLF--MVTAGLRLLKFPGE 147
             G T++ RL + CLLE       VKMHD++RD A+  ++S+   F  +V AG  L++FP +
Sbjct:   407 GVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEFP-Q 465

Query:   148 QEWEENLERVSLMENDFEEIPSNMSPHCEILSTLLLQHNKYLQRIPECFFVHMHGLKVLN 207
              ++  +++RVSLM N  E +P+N+    E L  LLLQ N +++ +P  F      L++L+
Sbjct:   466 DKFVSSVQRVSLMANKLERLPNNVIEGVETL-VLLLQGNSHVKEVPNGFLQAFPNLRILD 524

Query:   208 LCHTSIEVLPNSVSDLTNLRSLLLRWCGILKRVPSXXXXXXXXXXXXEGTWIEEVPEGME 267
             L    I  LP+S S+L +LRSL+LR C  L+ +PS              + I E+P G+E
Sbjct:   525 LSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKLQFLDLHESAIRELPRGLE 584

Query:   268 MLENLSHL 275
              L +L ++
Sbjct:   585 ALSSLRYI 592


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.04330003
BED finger-nbs-lrr resistance protein (1077 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query521
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 2e-12
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 9e-06
PLN032101153 PLN03210, PLN03210, Resistant to P 8e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
 Score = 67.4 bits (165), Expect = 2e-12
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 2/79 (2%)

Query: 12  EIINEVVEECGCLPLAIVTVAASMSGEEEIYEWQNALNELRGRLRSLNDVDTKVFGRLEF 71
           E+  E+VE+C  LPLA+  +   ++ +  + EW++ L +L   L    D   +V   L  
Sbjct: 182 EVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNELAG-RDGLNEVLSILSL 240

Query: 72  SYHRLKDEKLQQCFLYCAL 90
           SY  L    L++CFLY AL
Sbjct: 241 SYDNLPMH-LKRCFLYLAL 258


Length = 285

>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 521
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.82
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.8
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.79
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.77
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.74
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.7
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.67
KOG0617264 consensus Ras suppressor protein (contains leucine 99.56
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.55
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.53
KOG0617264 consensus Ras suppressor protein (contains leucine 99.5
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.46
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.43
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.41
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.38
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.24
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.19
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.18
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.15
KOG4237498 consensus Extracellular matrix protein slit, conta 99.13
KOG4237498 consensus Extracellular matrix protein slit, conta 98.94
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.83
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.75
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.7
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.65
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.62
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.57
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.49
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.44
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.39
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.37
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.34
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.34
PLN03150623 hypothetical protein; Provisional 98.25
PLN03150623 hypothetical protein; Provisional 98.22
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.18
PRK15386426 type III secretion protein GogB; Provisional 97.95
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.93
KOG4341483 consensus F-box protein containing LRR [General fu 97.91
PRK15386426 type III secretion protein GogB; Provisional 97.8
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 97.79
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.74
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.61
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.61
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.58
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.53
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.49
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.31
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.26
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.24
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.23
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.17
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.05
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.94
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 96.77
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.75
KOG4341483 consensus F-box protein containing LRR [General fu 96.36
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.32
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.89
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.73
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.34
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.22
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.19
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.18
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.74
KOG2982418 consensus Uncharacterized conserved protein [Funct 94.58
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.46
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 94.17
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.69
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.18
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.07
smart0037026 LRR Leucine-rich repeats, outliers. 87.64
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.64
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 87.53
smart0037026 LRR Leucine-rich repeats, outliers. 86.83
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.83
PRK04841 903 transcriptional regulator MalT; Provisional 86.66
KOG0473326 consensus Leucine-rich repeat protein [Function un 85.68
KOG0473326 consensus Leucine-rich repeat protein [Function un 85.5
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 82.02
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=1.5e-47  Score=412.90  Aligned_cols=484  Identities=29%  Similarity=0.371  Sum_probs=339.0

Q ss_pred             CChhHHHHHHHHHHHcCCchhHHHHHHHhcCCCCChHHHHHHHHHHhccccCC-CchhhHHHHHHHHhHhcCCchhHHHH
Q 041519            6 VPALNKEIINEVVEECGCLPLAIVTVAASMSGEEEIYEWQNALNELRGRLRSL-NDVDTKVFGRLEFSYHRLKDEKLQQC   84 (521)
Q Consensus         6 ~p~~l~~i~~~i~~kc~GlPLAi~~lg~~L~~k~~~~~W~~~l~~l~~~~~~~-~~~~~~i~~~L~lSY~~L~~~~lk~c   84 (521)
                      ..+.++++|++||+||+|+|||++++|++|+.|.++.+|+++.+.+..+...+ +++++.|+++|++|||.|| +++|.|
T Consensus       337 ~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~-~~lK~C  415 (889)
T KOG4658|consen  337 SHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLP-EELKSC  415 (889)
T ss_pred             ccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhh-HHHHHH
Confidence            33448999999999999999999999999999999999999999886663332 4667899999999999999 999999


Q ss_pred             HHHHHH----------------------------------HhHHHHHHHHccccccccCC---CccccchHHHHHHHHHh
Q 041519           85 FLYCAL----------------------------------GHTILNRLVNCCLLESAKDG---SCVKMHDLIRDMALRIT  127 (521)
Q Consensus        85 fl~~s~----------------------------------g~~~~~~L~~~~l~~~~~~~---~~~~mhdli~dl~~~i~  127 (521)
                      |+|||+                                  |+.|+++|++++|++..+..   .+|+|||+|||||..+|
T Consensus       416 FLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ia  495 (889)
T KOG4658|consen  416 FLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIA  495 (889)
T ss_pred             HHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHh
Confidence            999998                                  88999999999999988742   79999999999999999


Q ss_pred             c-----cCCcEEEecCcccccCCCcccccCCccEEEeecCCCCCCCCCcCCCCCCccEEEcccCcC-CCCCchhHhhCCC
Q 041519          128 S-----KSPLFMVTAGLRLLKFPGEQEWEENLERVSLMENDFEEIPSNMSPHCEILSTLLLQHNKY-LQRIPECFFVHMH  201 (521)
Q Consensus       128 ~-----~~~~~~~~~~~~~~~~p~~~~~~~~l~~L~l~~~~~~~l~~~~~~~l~~L~~L~l~~~~~-~~~~~~~~~~~l~  201 (521)
                      +     ++. .++..+.....+|....+ ...|++++.++.+..++...  .+++|++|.+.+|.. +..++..+|..++
T Consensus       496 s~~~~~~e~-~iv~~~~~~~~~~~~~~~-~~~rr~s~~~~~~~~~~~~~--~~~~L~tLll~~n~~~l~~is~~ff~~m~  571 (889)
T KOG4658|consen  496 SDFGKQEEN-QIVSDGVGLSEIPQVKSW-NSVRRMSLMNNKIEHIAGSS--ENPKLRTLLLQRNSDWLLEISGEFFRSLP  571 (889)
T ss_pred             ccccccccc-eEEECCcCccccccccch-hheeEEEEeccchhhccCCC--CCCccceEEEeecchhhhhcCHHHHhhCc
Confidence            9     565 555555566667766555 68999999999999888774  677999999999974 7888888899999


Q ss_pred             CCcEEEccCCC-CCccCccccCCcccceeecccCCCCCccC-CccCCCCCCEEEeeCC-cCcccCccccCCCCCcccccc
Q 041519          202 GLKVLNLCHTS-IEVLPNSVSDLTNLRSLLLRWCGILKRVP-SLAKLLALQYLDLEGT-WIEEVPEGMEMLENLSHLSLF  278 (521)
Q Consensus       202 ~L~~L~L~~~~-l~~lp~~i~~L~~L~~L~l~~~~~l~~lp-~~~~l~~L~~L~l~~~-~l~~lp~~i~~l~~L~~L~~~  278 (521)
                      .|++|||++|. +.++|.+|+.|.|||||+++++ .+..+| ++++|.+|.+|++..+ .+..+|..+..|.+|++|.+.
T Consensus       572 ~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t-~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~  650 (889)
T KOG4658|consen  572 LLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDT-GISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLP  650 (889)
T ss_pred             ceEEEECCCCCccCcCChHHhhhhhhhcccccCC-CccccchHHHHHHhhheeccccccccccccchhhhcccccEEEee
Confidence            99999999874 7899999999999999999995 599999 9999999999999999 566666666679999999887


Q ss_pred             cc--------hHHHHhhHhcccceEEEeccccchhhhhhccCCCCCCcceeeeec----CCCCCCccccceeeeeeeeee
Q 041519          279 MA--------AEEAARLSDRLDTFVGYFSTLNDFNIYVKSTDGRGSKNYCLLLSA----SGKRGFLEVDKSVRLFACKIC  346 (521)
Q Consensus       279 ~~--------~~~i~~L~~~L~~L~~~~~~~~~~~~~~~~~~~l~~L~~l~~~~~----~~~~~~~~~~~~~~L~~L~i~  346 (521)
                      ..        ..++.+|+ .|+.+.+...+. .....+   ..+..|..+.....    ...........+.+|++|.|.
T Consensus       651 ~s~~~~~~~~l~el~~Le-~L~~ls~~~~s~-~~~e~l---~~~~~L~~~~~~l~~~~~~~~~~~~~~~~l~~L~~L~i~  725 (889)
T KOG4658|consen  651 RSALSNDKLLLKELENLE-HLENLSITISSV-LLLEDL---LGMTRLRSLLQSLSIEGCSKRTLISSLGSLGNLEELSIL  725 (889)
T ss_pred             ccccccchhhHHhhhccc-chhhheeecchh-HhHhhh---hhhHHHHHHhHhhhhcccccceeecccccccCcceEEEE
Confidence            54        23344444 555554433332 111111   11222221111100    000011112223355555555


Q ss_pred             cCcccccCccccceEEEecccCcccccc-cccCCCcccccccchhhccCCCcEEEEecccchhhhhccCcchhhhhhhcc
Q 041519          347 ETEETIVLPEDVQYLEMFGVDDVASLND-VLPREQGLNLFSLRLLPALQNLEVLAVGYCFLIEEIVAVEDEETEKELATN  425 (521)
Q Consensus       347 ~~~~~~~~p~~L~~L~l~~~~~l~~l~~-~~~~~~~l~~~p~~~l~~L~~L~~L~L~~c~~l~~l~~~~~~~~~~~~~~~  425 (521)
                      .+........+.+......  .+.++.. .+.++.+. ..+.|. .-.++|+.|.+..|..++++++........     
T Consensus       726 ~~~~~e~~~~~~~~~~~~~--~f~~l~~~~~~~~~~~-r~l~~~-~f~~~L~~l~l~~~~~~e~~i~~~k~~~~l-----  796 (889)
T KOG4658|consen  726 DCGISEIVIEWEESLIVLL--CFPNLSKVSILNCHML-RDLTWL-LFAPHLTSLSLVSCRLLEDIIPKLKALLEL-----  796 (889)
T ss_pred             cCCCchhhcccccccchhh--hHHHHHHHHhhccccc-cccchh-hccCcccEEEEecccccccCCCHHHHhhhc-----
Confidence            4422111111111111000  0000000 01112221 223333 456899999999999988877654222111     


Q ss_pred             cccccccCCcccee-ecCCcccccccccCCCcccCCCccEEEEecCCCcccccCcCc-ccCCCCCCCCCCceEEEee-hh
Q 041519          426 TIINTVTLPRLKKL-HLEDLREFKSICSDNGVLVCNSLQEIEVYNCPKLKRLSLSLP-LLDNGQPSPPPALEVIEIK-KE  502 (521)
Q Consensus       426 ~~~~~~~f~~L~~L-~l~~~~~L~~~~~~~~~~~~p~L~~L~i~~C~~L~~lP~~~~-~l~~~~~~~~~~L~~l~~~-~~  502 (521)
                       ......|++++.+ .+.+.+.++++..  ....+++|+.+.+..||+++.+|.... .+.+     +. =+.+... .+
T Consensus       797 -~~~i~~f~~~~~l~~~~~l~~l~~i~~--~~l~~~~l~~~~ve~~p~l~~~P~~~~~~i~~-----~~-~~~~~~~~~~  867 (889)
T KOG4658|consen  797 -KELILPFNKLEGLRMLCSLGGLPQLYW--LPLSFLKLEELIVEECPKLGKLPLLSTLTIVG-----CE-EKLKEYPDGE  867 (889)
T ss_pred             -ccEEecccccccceeeecCCCCceeEe--cccCccchhheehhcCcccccCccccccceec-----cc-cceeecCCcc
Confidence             0012467888888 5888888888877  566788999999999999999998532 2222     10 1122222 67


Q ss_pred             hccccccCCcchhhhc
Q 041519          503 LWESLEWDQPNAKDVL  518 (521)
Q Consensus       503 ~~~~l~~~~~~~~~~~  518 (521)
                      |.+.++|++.+.+..|
T Consensus       868 ~~~~v~~~~~~~~~~~  883 (889)
T KOG4658|consen  868 WLEGVYWEDELTKLRF  883 (889)
T ss_pred             ceeeEEehhhhhhhhc
Confidence            8899999998877655



>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query521
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 2e-04
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure

Iteration: 1

Score = 43.9 bits (102), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 35/111 (31%), Positives = 57/111 (51%), Gaps = 4/111 (3%) Query: 133 FMVTAGLRLLKFP-GEQEWEENLERVSLMENDFEEIPSNMSPHCEILSTLLLQHNKYLQR 191 +++ G +L P G + NL+ + L+EN + +P + L+ L L HN+ LQ Sbjct: 89 YLILTGNQLQSLPNGVFDKLTNLKELVLVENQLQSLPDGVFDKLTNLTYLNLAHNQ-LQS 147 Query: 192 IPECFFVHMHGLKVLNLCHTSIEVLPNSVSD-LTNLRSLLLRWCGILKRVP 241 +P+ F + L L+L + ++ LP V D LT L+ L L + LK VP Sbjct: 148 LPKGVFDKLTNLTELDLSYNQLQSLPEGVFDKLTQLKDLRL-YQNQLKSVP 197

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query521
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 9e-17
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 3e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-08
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-10
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-07
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-07
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-04
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
 Score = 82.0 bits (202), Expect = 9e-17
 Identities = 19/160 (11%), Positives = 38/160 (23%), Gaps = 40/160 (25%)

Query: 9   LNKEIINEVVEECGCLPLAIVTVAASMSGEEEIYEWQNALNELRGRLRS-----LNDVDT 63
             ++++N+ +E     P  ++    S   +    +     N+L  R              
Sbjct: 314 KEEDVLNKTIELSSGNPATLMMFFKSCEPKTF-EKMAQLNNKLESRGLVGVECITPYSYK 372

Query: 64  KVFGRLEFSYHRLKDEKLQQCFLYCAL-------------------------------GH 92
            +   L+     L DE  +    +  +                                 
Sbjct: 373 SLAMALQRCVEVLSDE-DRSALAFAVVMPPGVDIPVKLWSCVIPVDICSNEEEQLDDEVA 431

Query: 93  TILNRLVNCCLLESAKDGS--CVKMHDLIRDMALRITSKS 130
             L RL     L S K       K+  +I      +    
Sbjct: 432 DRLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQ 471


>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query521
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.88
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.87
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.87
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.87
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.87
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.87
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.86
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.86
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.86
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.86
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.85
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.85
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.85
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.85
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.84
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.84
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.84
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.84
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.83
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.83
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.83
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.83
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.83
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.82
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.82
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.82
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.82
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.81
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.81
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.8
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.8
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.79
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.79
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.79
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.78
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.78
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.78
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.76
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.75
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.75
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.75
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.74
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.74
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.73
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.73
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.73
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.72
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.72
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.71
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.71
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.71
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.68
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.68
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.68
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.68
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.67
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.67
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.66
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.66
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.63
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.62
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.62
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.61
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.6
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.58
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.58
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.57
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.55
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.55
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.54
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.54
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.54
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.54
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.52
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.52
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.52
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.52
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.51
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.49
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.49
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.49
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.48
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.47
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.47
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.46
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.45
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.45
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.44
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.43
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.43
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.43
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.42
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.42
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.41
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.41
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.41
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.41
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.4
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.4
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.36
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.36
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.36
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.36
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.34
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.34
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.33
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.32
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.32
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.32
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.32
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.31
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.31
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.29
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.29
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.28
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.28
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.27
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.27
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.27
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.26
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.26
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.26
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.23
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.23
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.23
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.2
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.2
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.2
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.17
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.15
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.13
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.01
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.99
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.76
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.65
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.57
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.5
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.37
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.2
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.08
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.96
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.88
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.86
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.69
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.65
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.46
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.38
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.35
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.34
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.27
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.21
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.14
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.09
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.34
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.48
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.36
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.41
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
Probab=99.88  E-value=2.4e-21  Score=207.50  Aligned_cols=156  Identities=22%  Similarity=0.280  Sum_probs=132.0

Q ss_pred             cEEEecCcccccCCCcccccCCccEEEeecCCCCCCCCCcCCCCCCccEEEcccCcCCCCCchhHhhCCCCCcEEEccCC
Q 041519          132 LFMVTAGLRLLKFPGEQEWEENLERVSLMENDFEEIPSNMSPHCEILSTLLLQHNKYLQRIPECFFVHMHGLKVLNLCHT  211 (521)
Q Consensus       132 ~~~~~~~~~~~~~p~~~~~~~~l~~L~l~~~~~~~l~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~L~~~  211 (521)
                      ..+...+..+..+|...  .+++++|++++|.+..++...+.++++|++|++++|. +..+++..|+++++|++|++++|
T Consensus        14 ~~~~c~~~~l~~ip~~~--~~~l~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~-l~~i~~~~~~~l~~L~~L~Ls~n   90 (606)
T 3vq2_A           14 ITYQCMDQKLSKVPDDI--PSSTKNIDLSFNPLKILKSYSFSNFSELQWLDLSRCE-IETIEDKAWHGLHHLSNLILTGN   90 (606)
T ss_dssp             TEEECTTSCCSSCCTTS--CTTCCEEECTTSCCCEECTTTTTTCTTCCEEECTTCC-CCEECTTTTTTCTTCCEEECTTC
T ss_pred             CceEccCCCcccCCCCC--CCCcCEEECCCCCcCEeChhhccCCccCcEEeCCCCc-ccccCHHHhhchhhcCEeECCCC
Confidence            34566677788888743  4789999999999999988777799999999999998 77887666799999999999999


Q ss_pred             CCCcc-CccccCCcccceeecccCCCCCccC--CccCCCCCCEEEeeCCcCc--ccCccccCCCCCcccccccc------
Q 041519          212 SIEVL-PNSVSDLTNLRSLLLRWCGILKRVP--SLAKLLALQYLDLEGTWIE--EVPEGMEMLENLSHLSLFMA------  280 (521)
Q Consensus       212 ~l~~l-p~~i~~L~~L~~L~l~~~~~l~~lp--~~~~l~~L~~L~l~~~~l~--~lp~~i~~l~~L~~L~~~~~------  280 (521)
                      .++.+ |.+++++.+|++|++++|. +..+|  .++++.+|++|++++|.+.  .+|..++++++|++|++...      
T Consensus        91 ~l~~~~p~~~~~l~~L~~L~L~~n~-l~~~~~~~~~~l~~L~~L~L~~n~l~~~~lp~~~~~l~~L~~L~Ls~n~l~~~~  169 (606)
T 3vq2_A           91 PIQSFSPGSFSGLTSLENLVAVETK-LASLESFPIGQLITLKKLNVAHNFIHSCKLPAYFSNLTNLVHVDLSYNYIQTIT  169 (606)
T ss_dssp             CCCCCCTTSSTTCTTCCEEECTTSC-CCCSSSSCCTTCTTCCEEECCSSCCCCCCCCGGGGTCTTCCEEECCSSCCCEEC
T ss_pred             cccccChhhcCCcccCCEEEccCCc-cccccccccCCCCCCCEEeCCCCcccceechHhHhhcCCCCEEEccCCcceecC
Confidence            99976 8889999999999999986 66665  7999999999999999887  57999999999999988754      


Q ss_pred             hHHHHhhHhccc
Q 041519          281 AEEAARLSDRLD  292 (521)
Q Consensus       281 ~~~i~~L~~~L~  292 (521)
                      +..++.++ +|+
T Consensus       170 ~~~~~~l~-~L~  180 (606)
T 3vq2_A          170 VNDLQFLR-ENP  180 (606)
T ss_dssp             TTTTHHHH-HCT
T ss_pred             hhhhhhhh-ccc
Confidence            44566666 655



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 521
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-05
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.004
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 48.5 bits (114), Expect = 1e-06
 Identities = 25/120 (20%), Positives = 40/120 (33%), Gaps = 3/120 (2%)

Query: 158 SLMENDFEEIPSNMSPHCEILSTLLLQHNKYLQRIPECFFVHMHGLKVLNLCHTSIEVLP 217
            L E        +       L+ L        Q        ++  L  L L   +I  + 
Sbjct: 264 KLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDIS 323

Query: 218 NSVSDLTNLRSLLLRWCGILKRVPSLAKLLALQYLDLEGTWIEEVPEGMEMLENLSHLSL 277
             VS LT L+ L      +   V SLA L  + +L      I ++   +  L  ++ L L
Sbjct: 324 -PVSSLTKLQRLFFANNKV-SDVSSLANLTNINWLSAGHNQISDLTP-LANLTRITQLGL 380


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query521
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.67
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.64
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.63
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.61
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.6
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.57
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.56
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.51
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.49
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.43
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.39
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.38
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.36
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.35
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.35
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.34
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.33
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.32
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.32
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.31
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.3
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.29
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.28
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.27
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.26
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.22
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.18
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.16
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.1
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.98
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.95
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.94
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.86
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.21
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.53
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.28
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.25
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.18
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.01
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.87
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 93.04
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 91.76
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 91.22
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.67  E-value=1.5e-15  Score=145.61  Aligned_cols=104  Identities=27%  Similarity=0.367  Sum_probs=64.5

Q ss_pred             ccEEEeecCCCCCCCCCcCCCCCCccEEEcccCcCCCCCchhHhhCCCCCcEEEccCCCCCcc-CccccCCcccceeecc
Q 041519          154 LERVSLMENDFEEIPSNMSPHCEILSTLLLQHNKYLQRIPECFFVHMHGLKVLNLCHTSIEVL-PNSVSDLTNLRSLLLR  232 (521)
Q Consensus       154 l~~L~l~~~~~~~l~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~L~~~~l~~l-p~~i~~L~~L~~L~l~  232 (521)
                      .+.++-.+..++++|..+.   +++++|++++|+ ++.+|+..|.++++|++|++++|.+..+ |..+.++.+|++|+++
T Consensus        12 ~~~~~C~~~~L~~lP~~l~---~~l~~L~Ls~N~-i~~l~~~~f~~l~~L~~L~l~~n~~~~i~~~~f~~l~~L~~L~l~   87 (305)
T d1xkua_          12 LRVVQCSDLGLEKVPKDLP---PDTALLDLQNNK-ITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLS   87 (305)
T ss_dssp             TTEEECTTSCCCSCCCSCC---TTCCEEECCSSC-CCCBCTTTTTTCTTCCEEECCSSCCCCBCTTTTTTCTTCCEEECC
T ss_pred             CCEEEecCCCCCccCCCCC---CCCCEEECcCCc-CCCcChhHhhccccccccccccccccccchhhhhCCCccCEeccc
Confidence            3455555556666666554   456677777766 6666665456667777777777766655 4456667777777777


Q ss_pred             cCCCCCccC-CccCCCCCCEEEeeCCcCcccCc
Q 041519          233 WCGILKRVP-SLAKLLALQYLDLEGTWIEEVPE  264 (521)
Q Consensus       233 ~~~~l~~lp-~~~~l~~L~~L~l~~~~l~~lp~  264 (521)
                      +|. ++.+| .+  ...+..|++..+.+..++.
T Consensus        88 ~n~-l~~l~~~~--~~~l~~L~~~~n~l~~l~~  117 (305)
T d1xkua_          88 KNQ-LKELPEKM--PKTLQELRVHENEITKVRK  117 (305)
T ss_dssp             SSC-CSBCCSSC--CTTCCEEECCSSCCCBBCH
T ss_pred             CCc-cCcCccch--hhhhhhhhccccchhhhhh
Confidence            664 66666 32  2456666666665555543



>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure