Citrus Sinensis ID: 041526
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 252 | ||||||
| 255584625 | 676 | Magnesium and cobalt efflux protein corC | 0.972 | 0.362 | 0.877 | 1e-126 | |
| 356553522 | 665 | PREDICTED: DUF21 domain-containing prote | 0.952 | 0.360 | 0.860 | 1e-120 | |
| 356501616 | 666 | PREDICTED: DUF21 domain-containing prote | 0.948 | 0.358 | 0.847 | 1e-118 | |
| 42562776 | 653 | CBS and transporter associated domain-co | 0.968 | 0.373 | 0.828 | 1e-115 | |
| 29824374 | 653 | unknown protein [Arabidopsis thaliana] g | 0.968 | 0.373 | 0.828 | 1e-115 | |
| 8778312 | 930 | F14J16.20 [Arabidopsis thaliana] | 0.968 | 0.262 | 0.828 | 1e-115 | |
| 225460751 | 669 | PREDICTED: DUF21 domain-containing prote | 0.948 | 0.357 | 0.842 | 1e-114 | |
| 297737546 | 537 | unnamed protein product [Vitis vinifera] | 0.948 | 0.445 | 0.842 | 1e-114 | |
| 147863903 | 723 | hypothetical protein VITISV_018001 [Viti | 0.948 | 0.330 | 0.842 | 1e-114 | |
| 343172968 | 545 | CBS domain and transporter associated do | 0.972 | 0.449 | 0.820 | 1e-113 |
| >gi|255584625|ref|XP_002533036.1| Magnesium and cobalt efflux protein corC, putative [Ricinus communis] gi|223527174|gb|EEF29344.1| Magnesium and cobalt efflux protein corC, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 457 bits (1176), Expect = e-126, Method: Compositional matrix adjust.
Identities = 215/245 (87%), Positives = 234/245 (95%)
Query: 1 VPVFEQRIDNIVGIAYAMDLLDYVQKGELLESTKVADMAHKPAYFVPDSMSVWNLLREFR 60
VPVFEQR+DNI+GIAYAMDLLDY QKGELLEST V DMAHKPAYFVPDSMSVWNLLREFR
Sbjct: 394 VPVFEQRVDNIMGIAYAMDLLDYAQKGELLESTTVGDMAHKPAYFVPDSMSVWNLLREFR 453
Query: 61 IRKVHMAVVLNEYGGTVGVVTLEDVVEEIVGEIFDESDSKEEIQKKTGYIVMRAEGIYDV 120
IRKVHMAVVLNEYGGT+G+VTLEDVVEEIVGEIFDE+DSKEEIQKKTGY+VMRAEGIYDV
Sbjct: 454 IRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSKEEIQKKTGYVVMRAEGIYDV 513
Query: 121 DANTSIDQLSEDLNIKMPEGHQYETVSGFVCEAFGYIPRTGESIKVVVEKENQEENDEDT 180
DANTSIDQLSEDLNIKMPEGHQYETVSGF+CEAFGYIPRTGE+IKV++EKENQEE+DE T
Sbjct: 514 DANTSIDQLSEDLNIKMPEGHQYETVSGFICEAFGYIPRTGETIKVILEKENQEEDDEQT 573
Query: 181 ENGSDRQDSKEKHQIYKLEILAGNARKVSAVRFERINNDEAKLDAKEVTRMVPKIMKRKW 240
E SDRQD +KHQIYKLEILAGNARKVSAVRFE+INN + ++AKEVTR+VPKIMKR+W
Sbjct: 574 EGKSDRQDQNDKHQIYKLEILAGNARKVSAVRFEQINNGDEMMEAKEVTRLVPKIMKRRW 633
Query: 241 SSDDE 245
SSD+E
Sbjct: 634 SSDEE 638
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356553522|ref|XP_003545104.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356501616|ref|XP_003519620.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|42562776|ref|NP_175989.2| CBS and transporter associated domain-containing protein [Arabidopsis thaliana] gi|342179478|sp|Q84R21.2|Y1559_ARATH RecName: Full=DUF21 domain-containing protein At1g55930, chloroplastic; AltName: Full=CBS domain-containing protein CBSDUFCH2; Flags: Precursor gi|332195201|gb|AEE33322.1| CBS and transporter associated domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|29824374|gb|AAP04147.1| unknown protein [Arabidopsis thaliana] gi|110739091|dbj|BAF01462.1| hypothetical protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|8778312|gb|AAF79321.1|AC002304_14 F14J16.20 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|225460751|ref|XP_002273722.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297737546|emb|CBI26747.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147863903|emb|CAN83218.1| hypothetical protein VITISV_018001 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|343172968|gb|AEL99187.1| CBS domain and transporter associated domain-containing protein, partial [Silene latifolia] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 252 | ||||||
| TAIR|locus:2012045 | 653 | AT1G55930 "AT1G55930" [Arabido | 0.968 | 0.373 | 0.779 | 2.8e-98 | |
| TAIR|locus:2090024 | 661 | AT3G13070 "AT3G13070" [Arabido | 0.968 | 0.369 | 0.771 | 5.2e-97 | |
| UNIPROTKB|Q74AS0 | 284 | GSU2282 "CBS and CorC_HlyC dom | 0.611 | 0.542 | 0.371 | 1.2e-24 | |
| TIGR_CMR|GSU_2282 | 284 | GSU_2282 "CBS domain protein" | 0.611 | 0.542 | 0.371 | 1.2e-24 | |
| UNIPROTKB|Q83DX7 | 283 | corC "Magnesium and cobalt eff | 0.615 | 0.547 | 0.374 | 4.2e-24 | |
| TIGR_CMR|CBU_0565 | 283 | CBU_0565 "CBS domain protein" | 0.615 | 0.547 | 0.374 | 4.2e-24 | |
| TIGR_CMR|SO_1178 | 291 | SO_1178 "magnesium and cobalt | 0.611 | 0.529 | 0.415 | 4.2e-24 | |
| UNIPROTKB|Q3Z6L6 | 424 | DET1425 "Putative uncharacteri | 0.611 | 0.363 | 0.341 | 8.2e-24 | |
| TIGR_CMR|DET_1425 | 424 | DET_1425 "conserved hypothetic | 0.611 | 0.363 | 0.341 | 8.2e-24 | |
| TIGR_CMR|CPS_3575 | 292 | CPS_3575 "magnesium and cobalt | 0.607 | 0.523 | 0.366 | 1.6e-22 |
| TAIR|locus:2012045 AT1G55930 "AT1G55930" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 976 (348.6 bits), Expect = 2.8e-98, P = 2.8e-98
Identities = 191/245 (77%), Positives = 212/245 (86%)
Query: 1 VPVFEQRIDNIVGIAYAMDLLDYVQKGELLESTKVADMAHKPAYFVPDSMSVWNLLREFR 60
VPVFEQRIDNIVGIAYAMDLLDYV KG+LLEST V DMAHKPA+FVPDSMSVWNLLREFR
Sbjct: 384 VPVFEQRIDNIVGIAYAMDLLDYVPKGKLLESTTVVDMAHKPAFFVPDSMSVWNLLREFR 443
Query: 61 IRKVHMAVVLNEYGGTVGVVTLEDVVEEIVGEIFDESDSKEEIQKKTGYIVMRAEGIYDV 120
IRKVHMAVVLNEYGGT+G+VTLEDVVEEIVGEIFDE+DSKEEIQKKTGYIVMRAEGIYDV
Sbjct: 444 IRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSKEEIQKKTGYIVMRAEGIYDV 503
Query: 121 DANTSIDQLSEDLNIKMPEGHQYETVSGFVCEAFGYIPRTGESIXXXXXXXXXXXXXXXX 180
DANTSIDQLSE+LNIKM EGHQYETVSGFVCEAFGYIP+TGES+
Sbjct: 504 DANTSIDQLSEELNIKMAEGHQYETVSGFVCEAFGYIPKTGESVTVVLEKENWEENDEQD 563
Query: 181 XXGSDRQDSKEKHQIYKLEILAGNARKVSAVRFERINNDEAKLDAKEVTRMVPKIMKRKW 240
+RQD KEKHQIY+LEILAGNARKVSAVRFER+++ + +A++V MVPK + RKW
Sbjct: 564 EGKHERQDQKEKHQIYRLEILAGNARKVSAVRFERVSDMDQVSEARDVKNMVPKFV-RKW 622
Query: 241 SSDDE 245
SS+++
Sbjct: 623 SSEED 627
|
|
| TAIR|locus:2090024 AT3G13070 "AT3G13070" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q74AS0 GSU2282 "CBS and CorC_HlyC domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_2282 GSU_2282 "CBS domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q83DX7 corC "Magnesium and cobalt efflux protein" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_0565 CBU_0565 "CBS domain protein" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_1178 SO_1178 "magnesium and cobalt efflux protein CorC" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3Z6L6 DET1425 "Putative uncharacterized protein" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_1425 DET_1425 "conserved hypothetical protein" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_3575 CPS_3575 "magnesium and cobalt efflux protein CorC" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| AT1G55930 | CBS domain-containing protein / transporter associated domain-containing protein; CBS domain-containing protein / transporter associated domain-containing protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biological_process unknown; LOCATED IN- chloroplast; EXPRESSED IN- 23 plant structures; EXPRESSED DURING- 13 growth stages; CONTAINS InterPro DOMAIN/s- Protein of unknown function DUF21 (InterPro-IPR002550), Transporter-associated region (InterPro-IPR005170), Cystathionine beta-synthase, core (InterPro-IPR000644); BEST Arabidopsis thaliana protein match is- CBS domain-co [...] (653 aa) | ||||||||||
(Arabidopsis thaliana) | |||||||||||
| AT5G66470 | • | • | 0.647 | ||||||||
| AT4G19610 | • | 0.526 | |||||||||
| AT1G26660 | • | 0.502 | |||||||||
| AT1G44910 | • | 0.484 | |||||||||
| AT3G52140 | • | 0.469 | |||||||||
| OXA1 | • | 0.458 | |||||||||
| AT1G76120 | • | 0.458 | |||||||||
| DCL4 | • | 0.457 | |||||||||
| AT1G53350 | • | 0.436 | |||||||||
| PRMT4A | • | 0.432 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 252 | |||
| COG1253 | 429 | COG1253, TlyC, Hemolysins and related proteins con | 9e-49 | |
| COG4535 | 293 | COG4535, CorC, Putative Mg2+ and Co2+ transporter | 1e-33 | |
| COG4536 | 423 | COG4536, CorB, Putative Mg2+ and Co2+ transporter | 1e-31 | |
| TIGR03520 | 408 | TIGR03520, GldE, gliding motility-associated prote | 8e-31 | |
| cd04590 | 111 | cd04590, CBS_pair_CorC_HlyC_assoc, This cd contain | 3e-30 | |
| PRK15094 | 292 | PRK15094, PRK15094, magnesium/cobalt efflux protei | 3e-24 | |
| pfam03471 | 80 | pfam03471, CorC_HlyC, Transporter associated domai | 6e-11 | |
| PRK11573 | 413 | PRK11573, PRK11573, hypothetical protein; Provisio | 1e-09 | |
| smart01091 | 78 | smart01091, CorC_HlyC, Transporter associated doma | 1e-09 | |
| pfam00571 | 57 | pfam00571, CBS, CBS domain | 4e-08 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 6e-07 | |
| cd04611 | 111 | cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd co | 4e-05 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 4e-04 | |
| cd04588 | 110 | cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This c | 6e-04 | |
| cd04589 | 111 | cd04589, CBS_pair_CAP-ED_DUF294_assoc_bac, This cd | 0.004 |
| >gnl|CDD|224173 COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
Score = 165 bits (421), Expect = 9e-49
Identities = 72/221 (32%), Positives = 115/221 (52%), Gaps = 35/221 (15%)
Query: 1 VPVFEQRIDNIVGIAYAMDLLDYVQKGELLESTKVADMAHKPAYFVPDSMSVWNLLREFR 60
+PV++ +DNI+GI + DLL + G+ S + +P FVP+++S+ +LL EFR
Sbjct: 242 IPVYDGDLDNIIGIVHVKDLLRALLDGQ---SDLDLRVLVRPPLFVPETLSLSDLLEEFR 298
Query: 61 IRKVHMAVVLNEYGGTVGVVTLEDVVEEIVGEIFDESDSKEEIQKKTGYIVMRAEGIYDV 120
+ HMA+V++EYGG G+VTLED++EEIVGEI DE D EE I+ R + + V
Sbjct: 299 EERTHMAIVVDEYGGVEGLVTLEDIIEEIVGEIPDEHDEDEEED-----IIQRDDDGWLV 353
Query: 121 DANTSIDQLSEDLNIKMPEGHQYETVSGFVCEAFGYIPRTGESIKVVVEKENQEENDEDT 180
D +++L E L I + E Y+T++G V G IP+ GES+ +
Sbjct: 354 DGRVPLEELEELLGIDLDEEEDYDTIAGLVLSLLGRIPKVGESVVI-------------- 399
Query: 181 ENGSDRQDSKEKHQIYKLEILAGNARKVSAVRFERINNDEA 221
+ E+L + R++ V R+ + +
Sbjct: 400 -------------GGLRFEVLDMDGRRIDKVLIVRLKDKPS 427
|
Length = 429 |
| >gnl|CDD|226910 COG4535, CorC, Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226911 COG4536, CorB, Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|132559 TIGR03520, GldE, gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >gnl|CDD|239963 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >gnl|CDD|185050 PRK15094, PRK15094, magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217581 pfam03471, CorC_HlyC, Transporter associated domain | Back alignment and domain information |
|---|
| >gnl|CDD|236933 PRK11573, PRK11573, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215020 smart01091, CorC_HlyC, Transporter associated domain | Back alignment and domain information |
|---|
| >gnl|CDD|201313 pfam00571, CBS, CBS domain | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239984 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239961 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >gnl|CDD|239962 cd04589, CBS_pair_CAP-ED_DUF294_assoc_bac, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 252 | |||
| PRK11573 | 413 | hypothetical protein; Provisional | 100.0 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 100.0 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 100.0 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 100.0 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 100.0 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 100.0 | |
| PF03471 | 81 | CorC_HlyC: Transporter associated domain; InterPro | 99.78 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 99.25 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 99.19 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 99.14 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 99.14 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 99.14 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 99.13 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 99.13 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 99.11 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 99.1 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 99.09 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 99.08 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 99.08 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 99.07 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 99.07 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 99.06 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 99.05 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 99.04 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 99.03 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 99.03 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 99.02 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 99.02 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 99.02 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 99.02 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 99.02 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 99.01 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 99.01 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 99.01 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 99.0 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 99.0 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 98.99 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 98.99 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 98.98 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 98.98 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 98.98 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 98.98 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 98.97 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 98.97 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 98.96 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 98.96 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 98.96 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 98.95 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 98.94 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 98.94 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 98.94 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 98.93 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 98.93 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 98.93 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 98.91 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 98.9 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 98.9 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 98.89 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 98.89 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 98.88 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 98.87 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 98.86 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 98.85 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 98.84 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 98.84 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 98.83 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 98.82 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 98.81 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 98.81 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 98.78 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 98.78 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 98.75 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 98.73 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 98.71 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 98.7 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 98.64 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 98.63 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 98.62 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 98.57 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 98.54 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 98.54 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 98.46 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 98.45 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 98.45 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 98.43 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 98.4 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 98.35 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 98.31 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 98.28 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 98.16 | |
| KOG2118 | 498 | consensus Predicted membrane protein, contains two | 98.13 | |
| COG3263 | 574 | NhaP-type Na+/H+ and K+/H+ antiporters with a uniq | 98.1 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 97.9 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 97.88 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 97.85 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 97.83 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 97.78 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 97.74 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 97.71 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 97.71 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 97.69 | |
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 97.66 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 97.65 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 97.57 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 97.54 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 97.53 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 97.51 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 97.5 | |
| PRK05326 | 562 | potassium/proton antiporter; Reviewed | 97.49 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 97.48 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 97.46 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 97.45 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 97.45 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 97.43 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 97.42 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 97.4 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 97.4 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 97.38 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 97.37 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 97.36 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 97.35 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 97.33 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 97.33 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 97.3 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 97.3 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 97.29 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 97.27 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 97.26 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 97.26 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 97.25 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 97.24 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 97.24 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 97.19 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 97.17 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 97.17 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 97.13 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 97.1 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 97.1 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 97.1 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 97.09 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 97.09 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 97.09 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 97.09 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 97.04 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 97.03 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 97.02 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 97.01 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 97.01 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 96.99 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 96.97 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 96.96 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 96.93 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 96.93 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 96.92 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 96.91 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 96.9 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 96.89 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 96.85 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 96.85 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 96.83 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 96.82 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 96.81 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 96.8 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 96.79 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 96.77 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 96.75 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 96.75 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 96.68 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 96.66 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 96.65 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 96.63 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 96.55 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 96.43 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 96.41 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 96.39 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 96.29 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 96.26 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 96.17 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 96.13 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 95.96 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 95.93 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 95.87 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 95.86 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 95.81 | |
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 95.66 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 95.6 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 95.37 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 95.31 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 95.24 | |
| KOG0474 | 762 | consensus Cl- channel CLC-7 and related proteins ( | 94.55 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 94.5 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 93.83 | |
| KOG0475 | 696 | consensus Cl- channel CLC-3 and related proteins ( | 93.78 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 91.85 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 91.79 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 84.94 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 80.95 |
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.4e-43 Score=335.22 Aligned_cols=183 Identities=22% Similarity=0.452 Sum_probs=162.1
Q ss_pred CeEEecCCCCEEEEEEHHHHhHHHHcCCcccccchhhhhcCCceecCCCCcHHHHHHHHHHcCCceEEEecCCCCEEEEE
Q 041526 1 VPVFEQRIDNIVGIAYAMDLLDYVQKGELLESTKVADMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGVV 80 (252)
Q Consensus 1 lPV~~~~~d~IvGiv~~kDll~~~~~~~~~~~~~l~~~~~r~~~~Vpe~~~l~~lL~~mr~~~~~~AiVVDE~G~~vGIV 80 (252)
||||+++.|+|+|+||.||++..+..+......++.+++ ||++|||+++++.++|++||+++.|||+|+||||+++|||
T Consensus 223 ~PVy~~~~D~IiGiv~~kDll~~~~~~~~~~~~~l~~~~-r~~~~Vpe~~~l~~lL~~~~~~~~~~AiVvDEyG~~~GiV 301 (413)
T PRK11573 223 IVLYRDSLDDAISMLRVREAYRLMTEKKEFTKENMLRAA-DEIYFVPEGTPLSTQLVKFQRNKKKVGLVVDEYGDIQGLV 301 (413)
T ss_pred EEEEcCCCCceEEEEEHHHHHHHhhccCcCCHHHHHhhc-cCCeEeCCCCcHHHHHHHHHhcCCeEEEEEecCCCeEEEe
Confidence 699999999999999999999765433211123455666 8999999999999999999999999999999999999999
Q ss_pred cchhHHHHHHhhhccCCCcHHHHhhhcccEEEecCceEEEeCCcChHHhHhhcCCCCCCCCccCCHHHHHHHHhCCCCCC
Q 041526 81 TLEDVVEEIVGEIFDESDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEDLNIKMPEGHQYETVSGFVCEAFGYIPRT 160 (252)
Q Consensus 81 TleDIleeIvGei~DE~d~~~~~~~~~~~i~~~~dg~~~v~G~~~L~dl~~~lgi~l~~~~~~~TLaGlil~~lg~iP~~ 160 (252)
|++||+|+|+|+|.||+|..+. ..+.+.++|+|+++|.++++|+++.||++||++ +|+|+|||++++||++|++
T Consensus 302 TleDilEeivGei~de~d~~~~-----~~i~~~~~~~~~v~G~~~l~d~~~~l~~~l~~~-~~~Tl~G~i~~~lg~iP~~ 375 (413)
T PRK11573 302 TVEDILEEIVGDFTTSMSPTLA-----EEVTPQNDGSVIIDGTANVREINKAFNWHLPED-DARTVNGVILEALEEIPVA 375 (413)
T ss_pred eHHHHHHHHhCCCCcccCcccc-----cceEEecCCEEEEEeeeEHHHHHHHhCCCCCCC-CCeeHHHHHHHHhCcCCCC
Confidence 9999999999999999874221 236778899999999999999999999999875 7999999999999999999
Q ss_pred CcEEEEeeecccccccccccCCCCCccccccccceEEEEEEEecCCeeeEEEEEEcC
Q 041526 161 GESIKVVVEKENQEENDEDTENGSDRQDSKEKHQIYKLEILAGNARKVSAVRFERIN 217 (252)
Q Consensus 161 Gd~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~~~~~~ri~~V~i~~~~ 217 (252)
||++.+ ++|+|+|++|+++||.+|++++..
T Consensus 376 Ge~~~~---------------------------~~~~f~V~~~~~~rI~~v~v~~~~ 405 (413)
T PRK11573 376 GTRVRI---------------------------GEYDIDILDVQDNMIKQVKVTPVK 405 (413)
T ss_pred CCEEEE---------------------------CCEEEEEEEecCCeEEEEEEEECC
Confidence 999999 599999999999999999998654
|
|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF03471 CorC_HlyC: Transporter associated domain; InterPro: IPR005170 This small domain is found in a family of proteins with the CBS IPR002550 from INTERPRO domain and two CBS domains with this domain found at the C terminus of the proteins, the domain is also found at the C terminus of some Na+/H+ antiporters | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2118 consensus Predicted membrane protein, contains two CBS domains [Function unknown] | Back alignment and domain information |
|---|
| >COG3263 NhaP-type Na+/H+ and K+/H+ antiporters with a unique C-terminal domain [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >PRK05326 potassium/proton antiporter; Reviewed | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 252 | ||||
| 3lfr_A | 136 | The Crystal Structure Of A Cbs Domain From A Putati | 1e-15 | ||
| 3jtf_A | 129 | The Cbs Domain Pair Structure Of A Magnesium And Co | 7e-15 | ||
| 4hg0_A | 292 | Crystal Structure Of Magnesium And Cobalt Efflux Pr | 1e-14 | ||
| 3oi8_A | 156 | The Crystal Structure Of Functionally Unknown Conse | 5e-13 | ||
| 3nqr_A | 127 | A Putative Cbs Domain-Containing Protein From Salmo | 3e-11 | ||
| 3lhh_A | 172 | The Crystal Structure Of Cbs Domain Protein From Sh | 9e-10 | ||
| 3lv9_A | 148 | Crystal Structure Of Cbs Domain Of A Putative Trans | 1e-09 | ||
| 3oco_A | 153 | The Crystal Structure Of A Hemolysin-Like Protein C | 1e-07 | ||
| 3i8n_A | 130 | A Domain Of A Conserved Functionally Known Protein | 4e-07 | ||
| 3hf7_A | 130 | The Crystal Structure Of A Cbs-Domain Pair With Bou | 6e-05 | ||
| 3ocm_A | 173 | The Crystal Structure Of A Domain From A Possible M | 5e-04 |
| >pdb|3LFR|A Chain A, The Crystal Structure Of A Cbs Domain From A Putative Metal Ion Transporter Bound To Amp From Pseudomonas Syringae To 1.55a Length = 136 | Back alignment and structure |
|
| >pdb|3JTF|A Chain A, The Cbs Domain Pair Structure Of A Magnesium And Cobalt Efflux Protein From Bordetella Parapertussis In Complex With Amp Length = 129 | Back alignment and structure |
| >pdb|4HG0|A Chain A, Crystal Structure Of Magnesium And Cobalt Efflux Protein Corc, Northeast Structural Genomics Consortium (nesg) Target Er40 Length = 292 | Back alignment and structure |
| >pdb|3OI8|A Chain A, The Crystal Structure Of Functionally Unknown Conserved Protein Domain From Neisseria Meningitidis Mc58 Length = 156 | Back alignment and structure |
| >pdb|3NQR|A Chain A, A Putative Cbs Domain-Containing Protein From Salmonella Typhimurium Lt2 Length = 127 | Back alignment and structure |
| >pdb|3LHH|A Chain A, The Crystal Structure Of Cbs Domain Protein From Shewanella Oneidensis Mr-1 Length = 172 | Back alignment and structure |
| >pdb|3LV9|A Chain A, Crystal Structure Of Cbs Domain Of A Putative Transporter From Clostridium Difficile 630 Length = 148 | Back alignment and structure |
| >pdb|3OCO|A Chain A, The Crystal Structure Of A Hemolysin-Like Protein Containing Cbs Domain Of Oenococcus Oeni Psu Length = 153 | Back alignment and structure |
| >pdb|3I8N|A Chain A, A Domain Of A Conserved Functionally Known Protein From Vibrio Parahaemolyticus Rimd 2210633. Length = 130 | Back alignment and structure |
| >pdb|3HF7|A Chain A, The Crystal Structure Of A Cbs-Domain Pair With Bound Amp From Klebsiella Pneumoniae To 2.75a Length = 130 | Back alignment and structure |
| >pdb|3OCM|A Chain A, The Crystal Structure Of A Domain From A Possible Membrane Protein Of Bordetella Parapertussis Length = 173 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 252 | |||
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 7e-40 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 4e-39 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 1e-36 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 2e-36 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 3e-36 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 4e-36 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 8e-36 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 9e-36 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 4e-35 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 4e-29 | |
| 2p3h_A | 101 | Uncharacterized CBS domain-containing protein; str | 1e-15 | |
| 3ded_A | 113 | Probable hemolysin; structural genomics, P protein | 1e-13 | |
| 2oai_A | 94 | Hemolysin; PFAM03471, xylella fastidiosa temecula1 | 4e-12 | |
| 3llb_A | 83 | Uncharacterized protein; protein PA3983, unknown f | 2e-11 | |
| 2p13_A | 90 | CBS domain; alpha-beta structure, structural genom | 3e-11 | |
| 2pli_A | 91 | Uncharacterized protein; CORC-associated region, M | 2e-10 | |
| 2pls_A | 86 | CBS domain protein; APC86064.2, CORC/HLYC transpor | 4e-10 | |
| 2o3g_A | 92 | Putative protein; APC85631.1, neisseria meningitid | 4e-10 | |
| 2p4p_A | 86 | Hypothetical protein HD1797; CORC_HLYC, PFAM: PF03 | 5e-10 | |
| 3lae_A | 81 | UPF0053 protein HI0107; APC85784.2, conserved prot | 1e-09 | |
| 2rk5_A | 87 | Putative hemolysin; structural genomics, PSI-2, MC | 3e-09 | |
| 2r2z_A | 93 | Hemolysin; APC85144, enterococcus faecalis V583, S | 4e-09 | |
| 2nqw_A | 93 | CBS domain protein; PFAM03471, hemolysins, CBS dom | 7e-09 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 2e-04 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 2e-04 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 3e-04 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 4e-04 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 6e-04 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 8e-04 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 7e-04 |
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Length = 136 | Back alignment and structure |
|---|
Score = 133 bits (338), Expect = 7e-40
Identities = 45/98 (45%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
Query: 1 VPVFEQRIDNIVGIAYAMDLLDYVQKGELLESTKVADMAHKPAYFVPDSMSVWNLLREFR 60
PV + D+++G+ A DLL + K + +S V + PA FVP+S + LLREFR
Sbjct: 39 YPVIGESHDDVLGVLLAKDLLPLILKADG-DSDDVKKLLR-PATFVPESKRLNVLLREFR 96
Query: 61 IRKVHMAVVLNEYGGTVGVVTLEDVVEEIVGEIFDESD 98
HMA+V++EYGG G+VT+EDV+E+IVG+I DE D
Sbjct: 97 ANHNHMAIVIDEYGGVAGLVTIEDVLEQIVGDIEDEHD 134
|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Length = 172 | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Length = 129 | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Length = 153 | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Length = 127 | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Length = 173 | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Length = 130 | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Length = 130 | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Length = 148 | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Length = 156 | Back alignment and structure |
|---|
| >2p3h_A Uncharacterized CBS domain-containing protein; structural genomics, CORC_HLYC, PFAM03471, putative transpor protein; 1.80A {Corynebacterium glutamicum} SCOP: d.145.1.4 Length = 101 | Back alignment and structure |
|---|
| >3ded_A Probable hemolysin; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG, membrane; HET: MSE; 2.14A {Chromobacterium violaceum} SCOP: d.145.1.4 Length = 113 | Back alignment and structure |
|---|
| >2oai_A Hemolysin; PFAM03471, xylella fastidiosa temecula1, structur genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; HET: MLY; 1.80A {Xylella fastidiosa} SCOP: d.145.1.4 PDB: 2r8d_A* Length = 94 | Back alignment and structure |
|---|
| >3llb_A Uncharacterized protein; protein PA3983, unknown function, structural genomics, PSI2, MCSG, protein structure initiative; 1.80A {Pseudomonas aeruginosa} Length = 83 | Back alignment and structure |
|---|
| >2p13_A CBS domain; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; 1.65A {Nitrosomonas europaea} SCOP: d.145.1.4 Length = 90 | Back alignment and structure |
|---|
| >2pli_A Uncharacterized protein; CORC-associated region, MCSG, PSI2, structural genomics, Pro structure initiative; 1.70A {Neisseria meningitidis} SCOP: d.145.1.4 Length = 91 | Back alignment and structure |
|---|
| >2pls_A CBS domain protein; APC86064.2, CORC/HLYC transporter associated domain, CBS DOM protein, structural genomics, PSI-2 structure initiative; 2.15A {Chlorobium tepidum tls} SCOP: d.145.1.4 Length = 86 | Back alignment and structure |
|---|
| >2o3g_A Putative protein; APC85631.1, neisseria meningitid structural genomics, PSI-2, protein structure initiative; 2.55A {Neisseria meningitidis} SCOP: d.145.1.4 Length = 92 | Back alignment and structure |
|---|
| >2p4p_A Hypothetical protein HD1797; CORC_HLYC, PFAM: PF03471, structural GE PSI-2, protein structure initiative, midwest center for STR genomics; HET: MLY MSE; 1.80A {Haemophilus ducreyi} SCOP: d.145.1.4 Length = 86 | Back alignment and structure |
|---|
| >3lae_A UPF0053 protein HI0107; APC85784.2, conserved protein, haemophilus influenzae RD KW20, structural genomics, PSI-2; HET: MSE; 1.45A {Haemophilus influenzae} PDB: 2o1r_A* Length = 81 | Back alignment and structure |
|---|
| >2rk5_A Putative hemolysin; structural genomics, PSI-2, MCSG, protein structure initiative, midwest center for structural genomics, membrane; 1.50A {Streptococcus mutans UA159} SCOP: d.145.1.4 Length = 87 | Back alignment and structure |
|---|
| >2r2z_A Hemolysin; APC85144, enterococcus faecalis V583, STRU initiative, midwest center for structural genomics, MCSG; 1.20A {Enterococcus faecalis} SCOP: d.145.1.4 Length = 93 | Back alignment and structure |
|---|
| >2nqw_A CBS domain protein; PFAM03471, hemolysins, CBS domains, transporter associated D CORC_HLYC, structural genomics, PSI-2; 1.30A {Porphyromonas gingivalis} SCOP: d.145.1.4 Length = 93 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 252 | |||
| 3ded_A | 113 | Probable hemolysin; structural genomics, P protein | 99.86 | |
| 3llb_A | 83 | Uncharacterized protein; protein PA3983, unknown f | 99.84 | |
| 2pli_A | 91 | Uncharacterized protein; CORC-associated region, M | 99.84 | |
| 2r2z_A | 93 | Hemolysin; APC85144, enterococcus faecalis V583, S | 99.84 | |
| 3lae_A | 81 | UPF0053 protein HI0107; APC85784.2, conserved prot | 99.84 | |
| 2pls_A | 86 | CBS domain protein; APC86064.2, CORC/HLYC transpor | 99.83 | |
| 2p4p_A | 86 | Hypothetical protein HD1797; CORC_HLYC, PFAM: PF03 | 99.83 | |
| 2oai_A | 94 | Hemolysin; PFAM03471, xylella fastidiosa temecula1 | 99.83 | |
| 2p13_A | 90 | CBS domain; alpha-beta structure, structural genom | 99.82 | |
| 2o3g_A | 92 | Putative protein; APC85631.1, neisseria meningitid | 99.82 | |
| 2rk5_A | 87 | Putative hemolysin; structural genomics, PSI-2, MC | 99.81 | |
| 2nqw_A | 93 | CBS domain protein; PFAM03471, hemolysins, CBS dom | 99.79 | |
| 2p3h_A | 101 | Uncharacterized CBS domain-containing protein; str | 99.74 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 99.69 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 99.67 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 99.67 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 99.66 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 99.64 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 99.63 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 99.62 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 99.61 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 99.6 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 99.52 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 99.47 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 99.39 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 99.36 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 99.36 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 99.35 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 99.35 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 99.35 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 99.34 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 99.34 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 99.33 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 99.33 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 99.32 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 99.32 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 99.32 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 99.31 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 99.31 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 99.31 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 99.3 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 99.29 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 99.28 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 99.28 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 99.28 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 99.27 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 99.26 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 99.26 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 99.25 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 99.23 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 99.23 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 99.22 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 99.22 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.21 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 99.21 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 99.2 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.2 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.19 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 99.19 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.13 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.11 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 99.08 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 99.07 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 99.05 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 99.04 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 99.04 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.0 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.0 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 98.99 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 98.96 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 98.95 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 98.92 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 98.91 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 98.9 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 98.85 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 98.85 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 98.72 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 98.7 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 98.47 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 98.41 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 98.36 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 98.34 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 98.31 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 98.31 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 98.29 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 98.28 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 98.27 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 98.25 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 98.2 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 98.19 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 98.17 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 98.15 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 98.15 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 98.15 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 98.14 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 98.13 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 98.11 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 98.09 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 98.06 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 98.05 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 98.05 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 98.05 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 98.02 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 98.02 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 98.0 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 98.0 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 97.99 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 97.99 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 97.96 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 97.96 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 97.95 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 97.89 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 97.89 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 97.88 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 97.86 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 97.86 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 97.84 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 97.83 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 97.82 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 97.8 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 97.8 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 97.77 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 97.76 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 97.74 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 97.68 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 97.54 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 97.48 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 97.33 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 96.83 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 96.81 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 96.68 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 96.58 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 96.51 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 96.23 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 96.02 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 95.92 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 95.76 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 95.13 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 94.51 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 93.41 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 92.71 |
| >3ded_A Probable hemolysin; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG, membrane; HET: MSE; 2.14A {Chromobacterium violaceum} SCOP: d.145.1.4 | Back alignment and structure |
|---|
Probab=99.86 E-value=1.8e-21 Score=153.67 Aligned_cols=92 Identities=23% Similarity=0.440 Sum_probs=75.4
Q ss_pred hhhccCCCcHHHHhhhcccEEEecCceEEEeCCcChHHhHhhcCCC--CCC--CCccCCHHHHHHHHhCCCCCCCcEEEE
Q 041526 91 GEIFDESDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEDLNIK--MPE--GHQYETVSGFVCEAFGYIPRTGESIKV 166 (252)
Q Consensus 91 Gei~DE~d~~~~~~~~~~~i~~~~dg~~~v~G~~~L~dl~~~lgi~--l~~--~~~~~TLaGlil~~lg~iP~~Gd~i~~ 166 (252)
.+|.||+|... +.+.++.+|+|+|+|.++|++|++.||++ ||+ .++|+||||||+++||++|++|++|.+
T Consensus 16 ~~I~DE~D~ee------~~i~~~~dg~~~v~G~~~l~dl~e~lg~~~~l~~~~~~~~dTlgGlil~~lg~iP~~Gd~v~~ 89 (113)
T 3ded_A 16 NLYFQGHDGEE------DEIVQREDGSWLVDGMVSLDRFREFFELEAPLPGEAGGNIHTLAGVMLYQLGRVPSVTDRFEW 89 (113)
T ss_dssp -----------------CCEEECTTSCEEEETTCBHHHHHHHTTCCSCCTTGGGTCCCBHHHHHHHHHCSSCCTTCEEEE
T ss_pred CcCcCCCCCCC------CceEEecCCEEEEecccCHHHHHHHhCCCccCCcccCCCCccHHHHHHHHhCCCCCCCCEEEE
Confidence 47899998542 45788999999999999999999999999 986 347999999999999999999999999
Q ss_pred eeecccccccccccCCCCCccccccccceEEEEEEEecCCeeeEEEEEE
Q 041526 167 VVEKENQEENDEDTENGSDRQDSKEKHQIYKLEILAGNARKVSAVRFER 215 (252)
Q Consensus 167 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~~~~~~ri~~V~i~~ 215 (252)
++|+|+|++|+++||.+|+|++
T Consensus 90 ---------------------------~g~~f~V~~~d~~RI~~V~v~~ 111 (113)
T 3ded_A 90 ---------------------------NGFSFEVVDMDRTRVDKILVQR 111 (113)
T ss_dssp ---------------------------TTEEEEEEEEETTEEEEEEEEE
T ss_pred ---------------------------CCEEEEEEEEeCCeEEEEEEEE
Confidence 5899999999999999999985
|
| >3llb_A Uncharacterized protein; protein PA3983, unknown function, structural genomics, PSI2, MCSG, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: d.145.1.0 | Back alignment and structure |
|---|
| >2pli_A Uncharacterized protein; CORC-associated region, MCSG, PSI2, structural genomics, Pro structure initiative; 1.70A {Neisseria meningitidis} SCOP: d.145.1.4 | Back alignment and structure |
|---|
| >2r2z_A Hemolysin; APC85144, enterococcus faecalis V583, STRU initiative, midwest center for structural genomics, MCSG; 1.20A {Enterococcus faecalis} SCOP: d.145.1.4 | Back alignment and structure |
|---|
| >3lae_A UPF0053 protein HI0107; APC85784.2, conserved protein, haemophilus influenzae RD KW20, structural genomics, PSI-2; HET: MSE; 1.45A {Haemophilus influenzae} SCOP: d.145.1.4 PDB: 2o1r_A* | Back alignment and structure |
|---|
| >2pls_A CBS domain protein; APC86064.2, CORC/HLYC transporter associated domain, CBS DOM protein, structural genomics, PSI-2 structure initiative; 2.15A {Chlorobium tepidum tls} SCOP: d.145.1.4 | Back alignment and structure |
|---|
| >2p4p_A Hypothetical protein HD1797; CORC_HLYC, PFAM: PF03471, structural GE PSI-2, protein structure initiative, midwest center for STR genomics; HET: MLY MSE; 1.80A {Haemophilus ducreyi} SCOP: d.145.1.4 | Back alignment and structure |
|---|
| >2oai_A Hemolysin; PFAM03471, xylella fastidiosa temecula1, structur genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; HET: MLY; 1.80A {Xylella fastidiosa} SCOP: d.145.1.4 PDB: 2r8d_A* | Back alignment and structure |
|---|
| >2p13_A CBS domain; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; 1.65A {Nitrosomonas europaea} SCOP: d.145.1.4 | Back alignment and structure |
|---|
| >2o3g_A Putative protein; APC85631.1, neisseria meningitid structural genomics, PSI-2, protein structure initiative; 2.55A {Neisseria meningitidis} SCOP: d.145.1.4 | Back alignment and structure |
|---|
| >2rk5_A Putative hemolysin; structural genomics, PSI-2, MCSG, protein structure initiative, midwest center for structural genomics, membrane; 1.50A {Streptococcus mutans UA159} SCOP: d.145.1.4 | Back alignment and structure |
|---|
| >2nqw_A CBS domain protein; PFAM03471, hemolysins, CBS domains, transporter associated D CORC_HLYC, structural genomics, PSI-2; 1.30A {Porphyromonas gingivalis} SCOP: d.145.1.4 | Back alignment and structure |
|---|
| >2p3h_A Uncharacterized CBS domain-containing protein; structural genomics, CORC_HLYC, PFAM03471, putative transpor protein; 1.80A {Corynebacterium glutamicum} SCOP: d.145.1.4 | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 252 | ||||
| d2p3ha1 | 98 | d.145.1.4 (A:5-102) Uncharacterized protein Cgl119 | 1e-11 | |
| d2oaia1 | 87 | d.145.1.4 (A:5-91) Hemolysin TlyC {Xylella fastidi | 1e-10 | |
| d2ooxe2 | 153 | d.37.1.1 (E:182-334) Uncharacterized protein C1556 | 5e-09 | |
| d2plsa1 | 84 | d.145.1.4 (A:345-428) Hypothetical protein CT0541 | 7e-09 | |
| d2o1ra1 | 78 | d.145.1.4 (A:1-78) Hypothetical protein HI0107 {Ha | 9e-09 | |
| d3deda1 | 87 | d.145.1.4 (A:341-427) Probable hemolysin CV0231 {C | 9e-09 | |
| d2ooxe1 | 179 | d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 | 9e-09 | |
| d2nyca1 | 140 | d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's | 1e-08 | |
| d2p4pa1 | 82 | d.145.1.4 (A:1-82) Hypothetical protein HD1797 {Ha | 2e-08 | |
| d2r2za1 | 84 | d.145.1.4 (A:5-88) Putative hemolysin EF0700 {Ente | 3e-08 | |
| d2v8qe1 | 145 | d.37.1.1 (E:182-326) 5'-AMP-activated protein kina | 3e-08 | |
| d2v8qe2 | 159 | d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas | 5e-08 | |
| d2p13a1 | 85 | d.145.1.4 (A:431-515) Uncharacterized protein NE22 | 6e-08 | |
| d2d4za3 | 160 | d.37.1.1 (A:527-606,A:691-770) Chloride channel pr | 7e-08 | |
| d2rk5a1 | 84 | d.145.1.4 (A:5-88) Putative hemolysin SMU1693 {Str | 1e-07 | |
| d2plia1 | 84 | d.145.1.4 (A:5-88) Uncharacterized protein NMB0537 | 3e-07 | |
| d2o3ga1 | 76 | d.145.1.4 (A:180-255) Putative protein NMB1485 {Ne | 3e-07 | |
| d2j9la1 | 169 | d.37.1.1 (A:578-746) Chloride channel protein 5, C | 5e-07 | |
| d2yzqa2 | 122 | d.37.1.1 (A:1-122) Uncharacterized protein PH1780 | 6e-07 | |
| d3ddja1 | 141 | d.37.1.1 (A:136-276) Uncharacterized protein SSO32 | 8e-07 | |
| d1o50a3 | 145 | d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Th | 2e-06 | |
| d2nqwa1 | 87 | d.145.1.4 (A:4-90) Hypothetical protein PG0272 {Po | 2e-06 | |
| d1vr9a3 | 121 | d.37.1.1 (A:1-121) Hypothetical protein TM0892, CB | 5e-06 | |
| d2yzqa1 | 156 | d.37.1.1 (A:123-278) Uncharacterized protein PH178 | 1e-05 | |
| d2riha1 | 131 | d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 | 1e-05 | |
| d2ef7a1 | 127 | d.37.1.1 (A:1-127) Uncharacterized protein ST2348 | 2e-05 | |
| d1pvma4 | 142 | d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar | 3e-05 | |
| d1y5ha3 | 123 | d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M | 4e-05 | |
| d3ddja2 | 135 | d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 | 5e-05 | |
| d1jr1a4 | 120 | d.37.1.1 (A:113-232) Type II inosine monophosphate | 5e-05 | |
| d2rc3a1 | 127 | d.37.1.1 (A:23-149) Uncharacterized protein NE2398 | 9e-05 | |
| d2yzia1 | 132 | d.37.1.1 (A:4-135) Uncharacterized protein PH0107 | 1e-04 | |
| d1zfja4 | 126 | d.37.1.1 (A:95-220) Type II inosine monophosphate | 4e-04 | |
| d2ouxa2 | 127 | d.37.1.1 (A:136-262) Magnesium transporter MgtE {E | 0.001 |
| >d2p3ha1 d.145.1.4 (A:5-102) Uncharacterized protein Cgl1194/Cg1349 {Corynebacterium glutamicum [TaxId: 1718]} Length = 98 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FAD-binding/transporter-associated domain-like superfamily: FAD-binding/transporter-associated domain-like family: CorC/HlyC domain-like domain: Uncharacterized protein Cgl1194/Cg1349 species: Corynebacterium glutamicum [TaxId: 1718]
Score = 57.5 bits (139), Expect = 1e-11
Identities = 18/107 (16%), Positives = 48/107 (44%), Gaps = 11/107 (10%)
Query: 110 IVMRAEGIYDVDANTSIDQLSEDLNIKMPEGHQYETVSGFVCEAFGYIPRTGESIKVVVE 169
I + + +D +T +D++ + ++PEG YET+SG + + + +TG+ I++ ++
Sbjct: 3 ITETSPDKWLIDGDTPLDEVERAIGYELPEGD-YETISGLLFDHANALLKTGDVIEIPLD 61
Query: 170 KENQEENDEDTENGSDRQDSKEKHQIYKLEILAGNARKVSAVRFERI 216
E ++ + + +I ++ +L + +
Sbjct: 62 FEPEDYLNNTSPT----------QRILRITVLEVERNVPVKLALALL 98
|
| >d2oaia1 d.145.1.4 (A:5-91) Hemolysin TlyC {Xylella fastidiosa [TaxId: 2371]} Length = 87 | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 153 | Back information, alignment and structure |
|---|
| >d2plsa1 d.145.1.4 (A:345-428) Hypothetical protein CT0541 {Chlorobium tepidum [TaxId: 1097]} Length = 84 | Back information, alignment and structure |
|---|
| >d2o1ra1 d.145.1.4 (A:1-78) Hypothetical protein HI0107 {Haemophilus influenzae [TaxId: 727]} Length = 78 | Back information, alignment and structure |
|---|
| >d3deda1 d.145.1.4 (A:341-427) Probable hemolysin CV0231 {Chromobacterium violaceum [TaxId: 536]} Length = 87 | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d2p4pa1 d.145.1.4 (A:1-82) Hypothetical protein HD1797 {Haemophilus ducreyi [TaxId: 730]} Length = 82 | Back information, alignment and structure |
|---|
| >d2r2za1 d.145.1.4 (A:5-88) Putative hemolysin EF0700 {Enterococcus faecalis [TaxId: 1351]} Length = 84 | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
| >d2p13a1 d.145.1.4 (A:431-515) Uncharacterized protein NE2227 {Nitrosomonas europaea [TaxId: 915]} Length = 85 | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 | Back information, alignment and structure |
|---|
| >d2rk5a1 d.145.1.4 (A:5-88) Putative hemolysin SMU1693 {Streptococcus mutans [TaxId: 1309]} Length = 84 | Back information, alignment and structure |
|---|
| >d2plia1 d.145.1.4 (A:5-88) Uncharacterized protein NMB0537 {Neisseria meningitidis [TaxId: 487]} Length = 84 | Back information, alignment and structure |
|---|
| >d2o3ga1 d.145.1.4 (A:180-255) Putative protein NMB1485 {Neisseria meningitidis [TaxId: 487]} Length = 76 | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 122 | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 141 | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Length = 145 | Back information, alignment and structure |
|---|
| >d2nqwa1 d.145.1.4 (A:4-90) Hypothetical protein PG0272 {Porphyromonas gingivalis [TaxId: 837]} Length = 87 | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Length = 121 | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Length = 131 | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Length = 127 | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 135 | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Length = 126 | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Length = 127 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 252 | |||
| d2o1ra1 | 78 | Hypothetical protein HI0107 {Haemophilus influenza | 99.85 | |
| d3deda1 | 87 | Probable hemolysin CV0231 {Chromobacterium violace | 99.85 | |
| d2oaia1 | 87 | Hemolysin TlyC {Xylella fastidiosa [TaxId: 2371]} | 99.84 | |
| d2plsa1 | 84 | Hypothetical protein CT0541 {Chlorobium tepidum [T | 99.84 | |
| d2p13a1 | 85 | Uncharacterized protein NE2227 {Nitrosomonas europ | 99.84 | |
| d2plia1 | 84 | Uncharacterized protein NMB0537 {Neisseria meningi | 99.83 | |
| d2p4pa1 | 82 | Hypothetical protein HD1797 {Haemophilus ducreyi [ | 99.83 | |
| d2o3ga1 | 76 | Putative protein NMB1485 {Neisseria meningitidis [ | 99.82 | |
| d2r2za1 | 84 | Putative hemolysin EF0700 {Enterococcus faecalis [ | 99.81 | |
| d2nqwa1 | 87 | Hypothetical protein PG0272 {Porphyromonas gingiva | 99.81 | |
| d2rk5a1 | 84 | Putative hemolysin SMU1693 {Streptococcus mutans [ | 99.79 | |
| d2p3ha1 | 98 | Uncharacterized protein Cgl1194/Cg1349 {Corynebact | 99.76 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 99.42 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 99.35 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 99.34 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.34 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 99.33 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 99.32 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 99.29 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.28 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 99.27 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.27 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.26 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 99.26 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 99.24 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 99.24 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 99.24 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.24 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 99.23 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 99.22 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 99.21 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.2 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.19 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 99.15 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 99.13 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 99.11 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 99.1 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.09 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 98.56 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 98.46 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 98.38 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 98.34 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 98.3 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 98.27 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 98.24 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 98.23 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 98.16 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 98.11 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 98.1 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 98.07 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 98.06 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 98.06 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 97.96 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 97.94 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 97.91 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 97.9 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 97.89 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 97.7 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 97.61 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 97.5 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 97.45 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 97.21 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 96.96 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 96.79 |
| >d2o1ra1 d.145.1.4 (A:1-78) Hypothetical protein HI0107 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FAD-binding/transporter-associated domain-like superfamily: FAD-binding/transporter-associated domain-like family: CorC/HlyC domain-like domain: Hypothetical protein HI0107 species: Haemophilus influenzae [TaxId: 727]
Probab=99.85 E-value=2.3e-21 Score=141.69 Aligned_cols=77 Identities=16% Similarity=0.314 Sum_probs=72.5
Q ss_pred EecCceEEEeCCcChHHhHhhcCCCCCCCCccCCHHHHHHHHhCCCCCCCcEEEEeeecccccccccccCCCCCcccccc
Q 041526 112 MRAEGIYDVDANTSIDQLSEDLNIKMPEGHQYETVSGFVCEAFGYIPRTGESIKVVVEKENQEENDEDTENGSDRQDSKE 191 (252)
Q Consensus 112 ~~~dg~~~v~G~~~L~dl~~~lgi~l~~~~~~~TLaGlil~~lg~iP~~Gd~i~~~~~~~~~~~~~~~~~~~~~~~~~~~ 191 (252)
+..||+|+++|+++|+||++.||++||++ +|+|||||++++||++|++|+++.+
T Consensus 2 ~~~Dg~~~v~G~~~l~dl~~~l~~~l~~~-~~~Ti~G~v~~~lg~iP~~Ge~v~~------------------------- 55 (78)
T d2o1ra1 2 QQSDGSMIIDGSANLRDLNKMFNWELDTE-DARTFNGLILEHLEEIPDEGTICEI------------------------- 55 (78)
T ss_dssp ECTTSCEEEETTCBHHHHHHHHCCCCCCS-SCSBHHHHHHHHCSSCCCTTCEEEE-------------------------
T ss_pred EecCCEEEEEeeCCHHHHHHHHCCCCCCc-cchHHHHHHHHHhCcCCCCCCEEEE-------------------------
Confidence 35789999999999999999999999975 7999999999999999999999999
Q ss_pred ccceEEEEEEEecCCeeeEEEEEEc
Q 041526 192 KHQIYKLEILAGNARKVSAVRFERI 216 (252)
Q Consensus 192 ~~~~~~~~V~~~~~~ri~~V~i~~~ 216 (252)
++|+|+|++|+++||.+|+|+++
T Consensus 56 --~~~~f~V~~~~~~rI~~V~i~kl 78 (78)
T d2o1ra1 56 --DGLLITILEVGDNMIKQAKVVKL 78 (78)
T ss_dssp --TTEEEEEEEEETTEEEEEEEEEC
T ss_pred --CCEEEEEEEccCCeEEEEEEEEC
Confidence 58999999999999999999874
|
| >d3deda1 d.145.1.4 (A:341-427) Probable hemolysin CV0231 {Chromobacterium violaceum [TaxId: 536]} | Back information, alignment and structure |
|---|
| >d2oaia1 d.145.1.4 (A:5-91) Hemolysin TlyC {Xylella fastidiosa [TaxId: 2371]} | Back information, alignment and structure |
|---|
| >d2plsa1 d.145.1.4 (A:345-428) Hypothetical protein CT0541 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2p13a1 d.145.1.4 (A:431-515) Uncharacterized protein NE2227 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2plia1 d.145.1.4 (A:5-88) Uncharacterized protein NMB0537 {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2p4pa1 d.145.1.4 (A:1-82) Hypothetical protein HD1797 {Haemophilus ducreyi [TaxId: 730]} | Back information, alignment and structure |
|---|
| >d2o3ga1 d.145.1.4 (A:180-255) Putative protein NMB1485 {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2r2za1 d.145.1.4 (A:5-88) Putative hemolysin EF0700 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2nqwa1 d.145.1.4 (A:4-90) Hypothetical protein PG0272 {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d2rk5a1 d.145.1.4 (A:5-88) Putative hemolysin SMU1693 {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d2p3ha1 d.145.1.4 (A:5-102) Uncharacterized protein Cgl1194/Cg1349 {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|