Citrus Sinensis ID: 041556
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 143 | ||||||
| 297822693 | 145 | hypothetical protein ARALYDRAFT_481886 [ | 1.0 | 0.986 | 0.791 | 2e-62 | |
| 224106281 | 143 | predicted protein [Populus trichocarpa] | 0.986 | 0.986 | 0.788 | 2e-62 | |
| 255569315 | 144 | plekhh protein, putative [Ricinus commun | 0.986 | 0.979 | 0.788 | 2e-61 | |
| 18402122 | 145 | Pleckstrin homology domain-containing pr | 1.0 | 0.986 | 0.777 | 3e-61 | |
| 224059304 | 144 | predicted protein [Populus trichocarpa] | 0.986 | 0.979 | 0.774 | 3e-61 | |
| 225434632 | 143 | PREDICTED: pleckstrin homology domain-co | 0.993 | 0.993 | 0.783 | 4e-61 | |
| 5926716 | 145 | AtPH1 [Arabidopsis thaliana] | 1.0 | 0.986 | 0.770 | 5e-61 | |
| 351723457 | 146 | uncharacterized protein LOC100527890 [Gl | 0.986 | 0.965 | 0.746 | 5e-59 | |
| 449450806 | 149 | PREDICTED: pleckstrin homology domain-co | 0.993 | 0.953 | 0.743 | 6e-59 | |
| 356501146 | 148 | PREDICTED: pleckstrin homology domain-co | 0.986 | 0.952 | 0.739 | 3e-58 |
| >gi|297822693|ref|XP_002879229.1| hypothetical protein ARALYDRAFT_481886 [Arabidopsis lyrata subsp. lyrata] gi|297325068|gb|EFH55488.1| hypothetical protein ARALYDRAFT_481886 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Score = 243 bits (620), Expect = 2e-62, Method: Compositional matrix adjust.
Identities = 114/144 (79%), Positives = 129/144 (89%), Gaps = 1/144 (0%)
Query: 1 MENIWRALSGQDPNPEDYTGIEFWSNPERSGWLTKQGDYIKTWRRRWFILKQGKLFWFKD 60
ME+IWR +GQDPN EDY GIEFWSNPERSGWLTKQGDYIKTWRRRWF+LK+GKL WFKD
Sbjct: 1 MESIWRIATGQDPNREDYEGIEFWSNPERSGWLTKQGDYIKTWRRRWFVLKRGKLLWFKD 60
Query: 61 SHNI-TPGSTPRGVIPVGTCLTVRGAEDLLNKPFAFELSTGEYTMYFVADTEKEKEEWIN 119
T GSTPRGVI VG CLTV+GAED++NKPFAFELS+G YTM+F+AD EKEKEEWIN
Sbjct: 61 QAAAGTRGSTPRGVISVGDCLTVKGAEDVVNKPFAFELSSGSYTMFFIADNEKEKEEWIN 120
Query: 120 SIGRAIVQHSRSVTESEVVDYDNK 143
SIGR+IVQHSRSVT+SEV+DYD++
Sbjct: 121 SIGRSIVQHSRSVTDSEVLDYDHR 144
|
Source: Arabidopsis lyrata subsp. lyrata Species: Arabidopsis lyrata Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224106281|ref|XP_002314112.1| predicted protein [Populus trichocarpa] gi|222850520|gb|EEE88067.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255569315|ref|XP_002525625.1| plekhh protein, putative [Ricinus communis] gi|223535061|gb|EEF36743.1| plekhh protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|18402122|ref|NP_565687.1| Pleckstrin homology domain-containing protein 1 [Arabidopsis thaliana] gi|54036216|sp|Q9ST43.2|PH1_ARATH RecName: Full=Pleckstrin homology domain-containing protein 1; Short=AtPH1 gi|3582339|gb|AAC35236.1| expressed protein [Arabidopsis thaliana] gi|15215632|gb|AAK91361.1| At2g29700/T27A16.20 [Arabidopsis thaliana] gi|20334886|gb|AAM16199.1| At2g29700/T27A16.20 [Arabidopsis thaliana] gi|21537127|gb|AAM61468.1| AtPH1 [Arabidopsis thaliana] gi|330253201|gb|AEC08295.1| Pleckstrin homology domain-containing protein 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224059304|ref|XP_002299816.1| predicted protein [Populus trichocarpa] gi|118483582|gb|ABK93688.1| unknown [Populus trichocarpa] gi|222847074|gb|EEE84621.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225434632|ref|XP_002279631.1| PREDICTED: pleckstrin homology domain-containing protein 1 [Vitis vinifera] gi|147863745|emb|CAN83611.1| hypothetical protein VITISV_035612 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|5926716|dbj|BAA84651.1| AtPH1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|351723457|ref|NP_001235232.1| uncharacterized protein LOC100527890 [Glycine max] gi|255633474|gb|ACU17095.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449450806|ref|XP_004143153.1| PREDICTED: pleckstrin homology domain-containing protein 1-like isoform 1 [Cucumis sativus] gi|449530337|ref|XP_004172152.1| PREDICTED: pleckstrin homology domain-containing protein 1-like isoform 1 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356501146|ref|XP_003519389.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 143 | ||||||
| TAIR|locus:2060625 | 145 | PH1 "pleckstrin homologue 1" [ | 1.0 | 0.986 | 0.777 | 4.3e-61 | |
| TAIR|locus:2166349 | 144 | AT5G05710 [Arabidopsis thalian | 0.993 | 0.986 | 0.736 | 4.6e-57 | |
| UNIPROTKB|F1MCV3 | 401 | CYTH1 "Uncharacterized protein | 0.636 | 0.226 | 0.362 | 3.5e-14 | |
| UNIPROTKB|Q9UIA0 | 394 | CYTH4 "Cytohesin-4" [Homo sapi | 0.461 | 0.167 | 0.458 | 7.4e-14 | |
| DICTYBASE|DDB_G0274775 | 458 | phdI "pleckstrin homology (PH) | 0.734 | 0.229 | 0.381 | 8.8e-14 | |
| UNIPROTKB|F1PGA8 | 394 | CYTH4 "Uncharacterized protein | 0.461 | 0.167 | 0.458 | 3.1e-13 | |
| ZFIN|ZDB-GENE-030131-4311 | 399 | cyth1b "cytohesin 1b" [Danio r | 0.825 | 0.295 | 0.357 | 6.2e-13 | |
| UNIPROTKB|F1P496 | 386 | CYTH3 "Uncharacterized protein | 0.825 | 0.305 | 0.344 | 2e-12 | |
| UNIPROTKB|Q6DF41 | 397 | cyth2 "MGC89034 protein" [Xeno | 0.461 | 0.166 | 0.452 | 2.1e-12 | |
| ZFIN|ZDB-GENE-030131-657 | 399 | cyth1a "cytohesin 1a" [Danio r | 0.818 | 0.293 | 0.355 | 2.8e-12 |
| TAIR|locus:2060625 PH1 "pleckstrin homologue 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 625 (225.1 bits), Expect = 4.3e-61, P = 4.3e-61
Identities = 112/144 (77%), Positives = 128/144 (88%)
Query: 1 MENIWRALSGQDPNPEDYTGIEFWSNPERSGWLTKQGDYIKTWRRRWFILKQGKLFWFKD 60
ME+IWR +GQDP+ EDY GIEFWSNPERSGWLTKQGDYIKTWRRRWF+LK+GKL WFKD
Sbjct: 1 MESIWRIATGQDPSREDYEGIEFWSNPERSGWLTKQGDYIKTWRRRWFVLKRGKLLWFKD 60
Query: 61 SHNI-TPGSTPRGVIPVGTCLTVRGAEDLLNKPFAFELSTGEYTMYFVADTEKEKEEWIN 119
GSTPRGVI VG CLTV+GAED++NKPFAFELS+G YTM+F+AD EKEKEEWIN
Sbjct: 61 QAAAGIRGSTPRGVISVGDCLTVKGAEDVVNKPFAFELSSGSYTMFFIADNEKEKEEWIN 120
Query: 120 SIGRAIVQHSRSVTESEVVDYDNK 143
SIGR+IVQHSRSVT+SEV+DYD++
Sbjct: 121 SIGRSIVQHSRSVTDSEVLDYDHR 144
|
|
| TAIR|locus:2166349 AT5G05710 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MCV3 CYTH1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UIA0 CYTH4 "Cytohesin-4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0274775 phdI "pleckstrin homology (PH) domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PGA8 CYTH4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-4311 cyth1b "cytohesin 1b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P496 CYTH3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6DF41 cyth2 "MGC89034 protein" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-657 cyth1a "cytohesin 1a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| grail3.0001107301 | hypothetical protein (143 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 143 | |||
| cd13276 | 117 | cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin | 3e-59 | |
| cd01252 | 118 | cd01252, PH_GRP1-like, General Receptor for Phosph | 2e-22 | |
| cd13282 | 96 | cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology | 4e-21 | |
| cd13248 | 104 | cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate | 2e-20 | |
| smart00233 | 102 | smart00233, PH, Pleckstrin homology domain | 3e-20 | |
| pfam00169 | 101 | pfam00169, PH, PH domain | 9e-20 | |
| cd13271 | 114 | cd13271, PH2_TAPP1_2, Tandem PH-domain-containing | 1e-18 | |
| cd00821 | 92 | cd00821, PH, Pleckstrin homology (PH) domain | 2e-17 | |
| cd13308 | 113 | cd13308, PH_3BP2, SH3 domain-binding protein 2 Ple | 5e-17 | |
| cd10573 | 96 | cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosin | 9e-17 | |
| cd13301 | 108 | cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin | 1e-16 | |
| cd13250 | 98 | cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin | 4e-14 | |
| cd13281 | 139 | cd13281, PH_PLEKHD1, Pleckstrin homology (PH) doma | 1e-13 | |
| cd13215 | 130 | cd13215, PH-GRAM1_AGT26, Autophagy-related protein | 1e-13 | |
| cd13296 | 111 | cd13296, PH2_MyoX, Myosin X Pleckstrin homology (P | 1e-13 | |
| cd13288 | 120 | cd13288, PH_Ses, Sesquipedalian family Pleckstrin | 3e-13 | |
| cd13255 | 110 | cd13255, PH_TAAP2-like, Tandem PH-domain-containin | 3e-13 | |
| cd13263 | 114 | cd13263, PH_RhoGap25-like, Rho GTPase activating p | 6e-12 | |
| cd13379 | 114 | cd13379, PH_RhoGap24, Rho GTPase activating protei | 2e-11 | |
| cd13298 | 106 | cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin | 2e-11 | |
| cd01251 | 105 | cd01251, PH2_ADAP, ArfGAP with dual PH domains Ple | 7e-11 | |
| cd01241 | 121 | cd01241, PH_PKB, Protein Kinase B-like pleckstrin | 4e-10 | |
| cd13292 | 103 | cd13292, PH_Osh1p_Osh2p_yeast, Yeast oxysterol bin | 8e-10 | |
| cd01257 | 106 | cd01257, PH_IRS, Insulin receptor substrate (IRS) | 9e-10 | |
| cd01238 | 140 | cd01238, PH_Btk, Bruton's tyrosine kinase pleckstr | 3e-09 | |
| cd13284 | 99 | cd13284, PH_OSBP_ORP4, Human Oxysterol binding pro | 8e-09 | |
| cd13273 | 110 | cd13273, PH_SWAP-70, Switch-associated protein-70 | 9e-09 | |
| cd01235 | 106 | cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (als | 3e-08 | |
| cd13275 | 103 | cd13275, PH_M-RIP, Myosin phosphatase-RhoA Interac | 4e-08 | |
| cd13253 | 93 | cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, anky | 5e-08 | |
| cd13293 | 88 | cd13293, PH_CpORP2-like, Cryptosporidium-like Oxys | 5e-08 | |
| cd01265 | 101 | cd01265, PH_TBC1D2A, TBC1 domain family member 2A | 5e-08 | |
| cd01266 | 123 | cd01266, PH_Gab1_Gab2, Grb2-associated binding pro | 6e-08 | |
| cd13384 | 115 | cd13384, PH_Gab2_2, Grb2-associated binding protei | 6e-08 | |
| cd13378 | 116 | cd13378, PH_RhoGAP2, Rho GTPase activating protein | 6e-08 | |
| cd13316 | 95 | cd13316, PH_Boi, Boi family Pleckstrin homology do | 7e-08 | |
| cd13385 | 125 | cd13385, PH_Gab3, Grb2-associated binding protein | 7e-08 | |
| cd13234 | 105 | cd13234, PHsplit_PLC_gamma, Phospholipase C-gamma | 7e-08 | |
| cd13272 | 116 | cd13272, PH_INPP4A_INPP4B, Type I inositol 3,4-bis | 8e-08 | |
| cd01260 | 114 | cd01260, PH_CNK_mammalian-like, Connector enhancer | 9e-08 | |
| cd13260 | 103 | cd13260, PH_RASA1, RAS p21 protein activator (GTPa | 1e-07 | |
| cd13324 | 103 | cd13324, PH_Gab-like, Grb2-associated binding prot | 1e-07 | |
| cd13283 | 100 | cd13283, PH_GPBP, Goodpasture antigen binding prot | 4e-07 | |
| cd01233 | 111 | cd01233, PH_KIFIA_KIFIB, KIFIA and KIFIB protein p | 7e-07 | |
| cd13326 | 90 | cd13326, PH_CNK_insect-like, Connector enhancer of | 1e-06 | |
| cd13267 | 125 | cd13267, PH_DOCK-D, Dedicator of cytokinesis-D sub | 2e-06 | |
| cd13302 | 109 | cd13302, PH2_Pleckstrin_2, Pleckstrin 2 Pleckstrin | 3e-06 | |
| cd13309 | 103 | cd13309, PH_SKIP, SifA and kinesin-interacting pro | 1e-05 | |
| cd01236 | 136 | cd01236, PH_RIP, Rho-Interacting Protein Pleckstri | 1e-05 | |
| cd13251 | 108 | cd13251, PH_ASAP, ArfGAP with SH3 domain, ankyrin | 2e-05 | |
| cd01254 | 134 | cd01254, PH_PLD, Phospholipase D pleckstrin homolo | 2e-05 | |
| cd01247 | 100 | cd01247, PH_FAPP1_FAPP2, Four phosphate adaptor pr | 3e-05 | |
| cd01263 | 119 | cd01263, PH_anillin, Anillin Pleckstrin homology ( | 4e-05 | |
| cd13270 | 118 | cd13270, PH1_TAPP1_2, Tandem PH-domain-containing | 4e-05 | |
| cd13238 | 96 | cd13238, PH2_FGD4_insect-like, FYVE, RhoGEF and PH | 1e-04 | |
| cd13265 | 108 | cd13265, PH_evt, Evectin Pleckstrin homology (PH) | 2e-04 | |
| cd13258 | 144 | cd13258, PH_PLEKHJ1, Pleckstrin homology domain co | 2e-04 | |
| cd13297 | 123 | cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin h | 3e-04 | |
| cd13317 | 101 | cd13317, PH_PLEKHO1_PLEKHO2, Pleckstrin homology d | 3e-04 | |
| cd13278 | 139 | cd13278, PH_Bud4, Bud4 Pleckstrin homology (PH) do | 4e-04 | |
| cd13249 | 111 | cd13249, PH_anillin_2, Anillin Pleckstrin homology | 4e-04 | |
| cd13291 | 107 | cd13291, PH_ORP10_ORP11, Human Oxysterol binding p | 5e-04 | |
| cd13274 | 97 | cd13274, PH_DGK_type2, Type 2 Diacylglycerol kinas | 6e-04 | |
| cd01253 | 113 | cd01253, PH_ARHGAP21-like, ARHGAP21 and related pr | 0.001 | |
| cd13237 | 90 | cd13237, PH2_FGD5_FGD6, FYVE, RhoGEF and PH domain | 0.001 | |
| cd13290 | 102 | cd13290, PH_ORP9, Human Oxysterol binding protein | 0.001 | |
| cd13370 | 133 | cd13370, PH_GAP1m_mammal-like, GTPase activating p | 0.002 | |
| cd13261 | 136 | cd13261, PH_RasGRF1_2, Ras-specific guanine nucleo | 0.002 | |
| cd01244 | 107 | cd01244, PH_GAP1-like, RAS p21 protein activator ( | 0.003 | |
| cd13262 | 124 | cd13262, PH_RasSynGAP-like, Synaptic Ras-GTPase ac | 0.003 | |
| cd13269 | 106 | cd13269, PH_alsin, Alsin Pleckstrin homology (PH) | 0.003 | |
| cd13236 | 105 | cd13236, PH2_FGD1-4, FYVE, RhoGEF and PH domain co | 0.004 | |
| cd13280 | 105 | cd13280, PH_SIP3, Snf1p-interacting protein 3 Plec | 0.004 |
| >gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain | Back alignment and domain information |
|---|
Score = 178 bits (454), Expect = 3e-59
Identities = 79/120 (65%), Positives = 95/120 (79%), Gaps = 4/120 (3%)
Query: 21 IEFWSNPERSGWLTKQGDYIKTWRRRWFILKQGKLFWFKDSHNITPGSTPRGVIPVGTCL 80
+EFWS+PE++GWLTKQG IKTWRRRWF+LKQGKLF+FKD P S PRGVI + CL
Sbjct: 1 VEFWSDPEKAGWLTKQGGSIKTWRRRWFVLKQGKLFYFKDE---DPDSEPRGVIDLSDCL 57
Query: 81 TVRGAEDLLNKPFAFELSTGEYTMYFVADTEKEKEEWINSIGRAIVQHSRS-VTESEVVD 139
TV+ AE+ NK FAFE+ST E T Y +AD+EKEKEEWI++IGRAIV+ SRS T EV+D
Sbjct: 58 TVKSAEEATNKEFAFEVSTPERTFYLIADSEKEKEEWISAIGRAIVKLSRSKGTIDEVLD 117
|
AtPH1 is expressed in all plant tissue and is proposed to be the plant homolog of human pleckstrin. Pleckstrin consists of two PH domains separated by a linker region, while AtPH has a single PH domain with a short N-terminal extension. AtPH1 binds PtdIns3P specifically and is thought to be an adaptor molecule since it has no obvious catalytic functions. PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes. Length = 117 |
| >gnl|CDD|241283 cd01252, PH_GRP1-like, General Receptor for Phosphoinositides-1-like Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain containing, family H (with MyTH4 domain) members 1 and 2 (PLEKHH1) PH domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|215766 pfam00169, PH, PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|241425 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2 Pleckstrin homology (PH) domain, C-terminal repeat | Back alignment and domain information |
|---|
| >gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241462 cd13308, PH_3BP2, SH3 domain-binding protein 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241309 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosine and 3-Phosphoinositides Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH domains Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241435 cd13281, PH_PLEKHD1, Pleckstrin homology (PH) domain containing, family D (with coiled-coil domains) member 1 PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|241369 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and related proteins Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241530 cd13379, PH_RhoGap24, Rho GTPase activating protein 24 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|241282 cd01251, PH2_ADAP, ArfGAP with dual PH domains Pleckstrin homology (PH) domain, repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|241274 cd01241, PH_PKB, Protein Kinase B-like pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241446 cd13292, PH_Osh1p_Osh2p_yeast, Yeast oxysterol binding protein homologs 1 and 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241288 cd01257, PH_IRS, Insulin receptor substrate (IRS) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241271 cd01238, PH_Btk, Bruton's tyrosine kinase pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241438 cd13284, PH_OSBP_ORP4, Human Oxysterol binding protein and OSBP-related protein 4 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241427 cd13273, PH_SWAP-70, Switch-associated protein-70 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human MTMR5) Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241429 cd13275, PH_M-RIP, Myosin phosphatase-RhoA Interacting Protein Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241407 cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, ankyrin repeat and PH domain Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|241447 cd13293, PH_CpORP2-like, Cryptosporidium-like Oxysterol binding protein related protein 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241296 cd01265, PH_TBC1D2A, TBC1 domain family member 2A pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241297 cd01266, PH_Gab1_Gab2, Grb2-associated binding proteins 1 and 2 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241535 cd13384, PH_Gab2_2, Grb2-associated binding protein family pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241529 cd13378, PH_RhoGAP2, Rho GTPase activating protein 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241470 cd13316, PH_Boi, Boi family Pleckstrin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|241536 cd13385, PH_Gab3, Grb2-associated binding protein 3 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241388 cd13234, PHsplit_PLC_gamma, Phospholipase C-gamma Split pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241426 cd13272, PH_INPP4A_INPP4B, Type I inositol 3,4-bisphosphate 4-phosphatase and Type II inositol 3,4-bisphosphate 4-phosphatase Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241291 cd01260, PH_CNK_mammalian-like, Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241414 cd13260, PH_RASA1, RAS p21 protein activator (GTPase activating protein) 1 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241478 cd13324, PH_Gab-like, Grb2-associated binding protein family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241437 cd13283, PH_GPBP, Goodpasture antigen binding protein Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241266 cd01233, PH_KIFIA_KIFIB, KIFIA and KIFIB protein pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241480 cd13326, PH_CNK_insect-like, Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241421 cd13267, PH_DOCK-D, Dedicator of cytokinesis-D subfamily Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241456 cd13302, PH2_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH) domain, repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|241463 cd13309, PH_SKIP, SifA and kinesin-interacting protein Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241269 cd01236, PH_RIP, Rho-Interacting Protein Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241405 cd13251, PH_ASAP, ArfGAP with SH3 domain, ankyrin repeat and PH domain Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241285 cd01254, PH_PLD, Phospholipase D pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241278 cd01247, PH_FAPP1_FAPP2, Four phosphate adaptor protein 1 and 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241294 cd01263, PH_anillin, Anillin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241424 cd13270, PH1_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2 Pleckstrin homology (PH) domain, N-terminal repeat | Back alignment and domain information |
|---|
| >gnl|CDD|241392 cd13238, PH2_FGD4_insect-like, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia protein 4 pleckstrin homology (PH) domain, C-terminus, in insect and related arthropods | Back alignment and domain information |
|---|
| >gnl|CDD|241419 cd13265, PH_evt, Evectin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241412 cd13258, PH_PLEKHJ1, Pleckstrin homology domain containing, family J member 1 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241451 cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin homology (PH) domain, repeat 3 | Back alignment and domain information |
|---|
| >gnl|CDD|241471 cd13317, PH_PLEKHO1_PLEKHO2, Pleckstrin homology domain-containing family O Pleckstrin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|241432 cd13278, PH_Bud4, Bud4 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241403 cd13249, PH_anillin_2, Anillin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241445 cd13291, PH_ORP10_ORP11, Human Oxysterol binding protein (OSBP) related proteins 10 and 11 (ORP10 and ORP11) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241428 cd13274, PH_DGK_type2, Type 2 Diacylglycerol kinase Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241284 cd01253, PH_ARHGAP21-like, ARHGAP21 and related proteins pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241391 cd13237, PH2_FGD5_FGD6, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia proteins 5 and 6 pleckstrin homology (PH) domain, C-terminus | Back alignment and domain information |
|---|
| >gnl|CDD|241444 cd13290, PH_ORP9, Human Oxysterol binding protein related protein 9 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241521 cd13370, PH_GAP1m_mammal-like, GTPase activating protein 1 m pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241415 cd13261, PH_RasGRF1_2, Ras-specific guanine nucleotide-releasing factors 1 and 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241277 cd01244, PH_GAP1-like, RAS p21 protein activator (GTPase activating protein) family pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241416 cd13262, PH_RasSynGAP-like, Synaptic Ras-GTPase activating protein family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241423 cd13269, PH_alsin, Alsin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241390 cd13236, PH2_FGD1-4, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia proteins pleckstrin homology (PH) domain, C-terminus | Back alignment and domain information |
|---|
| >gnl|CDD|241434 cd13280, PH_SIP3, Snf1p-interacting protein 3 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 143 | |||
| cd01251 | 103 | PH_centaurin_alpha Centaurin alpha Pleckstrin homo | 99.92 | |
| cd01233 | 100 | Unc104 Unc-104 pleckstrin homology (PH) domain. Un | 99.91 | |
| cd01264 | 101 | PH_melted Melted pleckstrin homology (PH) domain. | 99.91 | |
| cd01260 | 96 | PH_CNK Connector enhancer of KSR (Kinase suppresso | 99.91 | |
| cd01238 | 106 | PH_Tec Tec pleckstrin homology (PH) domain. Tec pl | 99.9 | |
| cd01265 | 95 | PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | 99.9 | |
| cd01247 | 91 | PH_GPBP Goodpasture antigen binding protein (GPBP) | 99.89 | |
| cd01235 | 101 | PH_SETbf Set binding factor Pleckstrin Homology (P | 99.89 | |
| cd01252 | 125 | PH_cytohesin Cytohesin Pleckstrin homology (PH) do | 99.89 | |
| cd01257 | 101 | PH_IRS Insulin receptor substrate (IRS) pleckstrin | 99.89 | |
| cd01236 | 104 | PH_outspread Outspread Pleckstrin homology (PH) do | 99.88 | |
| cd01266 | 108 | PH_Gab Gab (Grb2-associated binder) pleckstrin hom | 99.87 | |
| cd01246 | 91 | PH_oxysterol_bp Oxysterol binding protein (OSBP) P | 99.85 | |
| cd01250 | 94 | PH_centaurin Centaurin Pleckstrin homology (PH) do | 99.85 | |
| cd01245 | 98 | PH_RasGAP_CG5898 RAS GTPase-activating protein (GA | 99.84 | |
| cd01244 | 98 | PH_RasGAP_CG9209 RAS_GTPase activating protein (GA | 99.83 | |
| PF00169 | 104 | PH: PH domain; InterPro: IPR001849 The pleckstrin | 99.81 | |
| cd01241 | 102 | PH_Akt Akt pleckstrin homology (PH) domain. Akt pl | 99.8 | |
| KOG0930 | 395 | consensus Guanine nucleotide exchange factor Cytoh | 99.79 | |
| cd01219 | 101 | PH_FGD FGD (faciogenital dysplasia protein) plecks | 99.76 | |
| cd01263 | 122 | PH_anillin Anillin Pleckstrin homology (PH) domain | 99.75 | |
| cd01230 | 117 | PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 | 99.75 | |
| cd01253 | 104 | PH_beta_spectrin Beta-spectrin pleckstrin homology | 99.72 | |
| cd01256 | 110 | PH_dynamin Dynamin pleckstrin homology (PH) domain | 99.72 | |
| cd01254 | 121 | PH_PLD Phospholipase D (PLD) pleckstrin homology ( | 99.71 | |
| cd01237 | 106 | Unc112 Unc-112 pleckstrin homology (PH) domain. Un | 99.69 | |
| PF15409 | 89 | PH_8: Pleckstrin homology domain | 99.68 | |
| PF15413 | 112 | PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE | 99.67 | |
| cd01220 | 99 | PH_CDEP Chondrocyte-derived ezrin-like domain cont | 99.65 | |
| smart00233 | 102 | PH Pleckstrin homology domain. Domain commonly fou | 99.65 | |
| PF15410 | 119 | PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN | 99.63 | |
| cd01234 | 117 | PH_CADPS CADPS (Ca2+-dependent activator protein) | 99.58 | |
| cd00821 | 96 | PH Pleckstrin homology (PH) domain. Pleckstrin hom | 99.56 | |
| cd00900 | 99 | PH-like Pleckstrin homology-like domain. Pleckstri | 99.54 | |
| cd01218 | 104 | PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | 99.37 | |
| cd01239 | 117 | PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom | 99.35 | |
| cd01242 | 112 | PH_ROK Rok (Rho- associated kinase) pleckstrin hom | 99.3 | |
| KOG1090 | 1732 | consensus Predicted dual-specificity phosphatase [ | 99.24 | |
| cd01259 | 114 | PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr | 99.23 | |
| KOG2059 | 800 | consensus Ras GTPase-activating protein [Signal tr | 99.22 | |
| cd01243 | 122 | PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin | 99.22 | |
| cd01261 | 112 | PH_SOS Son of Sevenless (SOS) Pleckstrin homology | 99.2 | |
| cd01249 | 104 | PH_oligophrenin Oligophrenin Pleckstrin homology ( | 99.18 | |
| KOG0690 | 516 | consensus Serine/threonine protein kinase [Signal | 99.16 | |
| PF14593 | 104 | PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. | 99.15 | |
| KOG3640 | 1116 | consensus Actin binding protein Anillin [Cell cycl | 99.11 | |
| cd01240 | 116 | PH_beta-ARK Beta adrenergic receptor kinase 1(beta | 98.89 | |
| PLN00188 | 719 | enhanced disease resistance protein (EDR2); Provis | 98.83 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 98.77 | |
| KOG3751 | 622 | consensus Growth factor receptor-bound proteins (G | 98.76 | |
| cd01224 | 109 | PH_Collybistin Collybistin pleckstrin homology (PH | 98.76 | |
| cd01222 | 97 | PH_clg Clg (common-site lymphoma/leukemia guanine | 98.76 | |
| KOG4424 | 623 | consensus Predicted Rho/Rac guanine nucleotide exc | 98.69 | |
| cd01258 | 108 | PH_syntrophin Syntrophin pleckstrin homology (PH) | 98.67 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 98.64 | |
| cd01262 | 89 | PH_PDK1 3-Phosphoinositide dependent protein kinas | 98.59 | |
| KOG3543 | 1218 | consensus Ca2+-dependent activator protein [Signal | 98.59 | |
| KOG0932 | 774 | consensus Guanine nucleotide exchange factor EFA6 | 98.57 | |
| PLN02866 | 1068 | phospholipase D | 98.47 | |
| cd01225 | 111 | PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- | 98.43 | |
| PF12814 | 123 | Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin | 98.42 | |
| KOG3723 | 851 | consensus PH domain protein Melted [Signal transdu | 98.37 | |
| cd01226 | 100 | PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin | 98.31 | |
| KOG1739 | 611 | consensus Serine/threonine protein kinase GPBP [Si | 98.28 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 98.12 | |
| cd01223 | 116 | PH_Vav Vav pleckstrin homology (PH) domain. Vav pl | 98.06 | |
| cd01221 | 125 | PH_ephexin Ephexin Pleckstrin homology (PH) domain | 98.05 | |
| KOG0248 | 936 | consensus Cytoplasmic protein Max-1, contains PH, | 98.04 | |
| cd01232 | 114 | PH_TRIO Trio pleckstrin homology (PH) domain. Trio | 97.93 | |
| KOG3531 | 1036 | consensus Rho guanine nucleotide exchange factor C | 97.93 | |
| KOG1451 | 812 | consensus Oligophrenin-1 and related Rho GTPase-ac | 97.92 | |
| KOG1117 | 1186 | consensus Rho- and Arf-GTPase activating protein A | 97.9 | |
| PF15408 | 104 | PH_7: Pleckstrin homology domain | 97.84 | |
| PF15406 | 112 | PH_6: Pleckstrin homology domain | 97.75 | |
| cd01231 | 107 | PH_Lnk LNK-family Pleckstrin homology (PH) domain. | 97.68 | |
| KOG4236 | 888 | consensus Serine/threonine protein kinase PKC mu/P | 97.56 | |
| KOG1117 | 1186 | consensus Rho- and Arf-GTPase activating protein A | 97.49 | |
| cd01228 | 96 | PH_BCR-related BCR (breakpoint cluster region)-rel | 97.42 | |
| cd01227 | 133 | PH_Dbs Dbs (DBL's big sister) pleckstrin homology | 96.96 | |
| PF15404 | 185 | PH_4: Pleckstrin homology domain | 96.71 | |
| PF15411 | 116 | PH_10: Pleckstrin homology domain | 96.7 | |
| cd01248 | 115 | PH_PLC Phospholipase C (PLC) pleckstrin homology ( | 96.55 | |
| KOG3549 | 505 | consensus Syntrophins (type gamma) [Extracellular | 96.18 | |
| KOG1738 | 638 | consensus Membrane-associated guanylate kinase-int | 95.98 | |
| KOG1737 | 799 | consensus Oxysterol-binding protein [Lipid transpo | 95.8 | |
| PF15405 | 135 | PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. | 95.77 | |
| KOG4407 | 1973 | consensus Predicted Rho GTPase-activating protein | 95.63 | |
| KOG4424 | 623 | consensus Predicted Rho/Rac guanine nucleotide exc | 95.6 | |
| KOG3523 | 695 | consensus Putative guanine nucleotide exchange fac | 95.42 | |
| KOG4807 | 593 | consensus F-actin binding protein, regulates actin | 95.22 | |
| KOG3727 | 664 | consensus Mitogen inducible gene product (contains | 95.05 | |
| KOG0248 | 936 | consensus Cytoplasmic protein Max-1, contains PH, | 94.26 | |
| KOG3531 | 1036 | consensus Rho guanine nucleotide exchange factor C | 93.97 | |
| cd01255 | 160 | PH_TIAM TIAM Pleckstrin homology (PH) domain. TIAM | 93.66 | |
| PF08458 | 110 | PH_2: Plant pleckstrin homology-like region; Inter | 93.42 | |
| KOG1264 | 1267 | consensus Phospholipase C [Lipid transport and met | 93.13 | |
| KOG0517 | 2473 | consensus Beta-spectrin [Cytoskeleton] | 92.11 | |
| KOG4047 | 429 | consensus Docking protein 1 (p62dok) [Signal trans | 91.49 | |
| KOG3551 | 506 | consensus Syntrophins (type beta) [Extracellular s | 91.12 | |
| KOG2070 | 661 | consensus Guanine nucleotide exchange factor [Nucl | 90.77 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 89.98 | |
| KOG2996 | 865 | consensus Rho guanine nucleotide exchange factor V | 89.64 | |
| KOG1170 | 1099 | consensus Diacylglycerol kinase [Lipid transport a | 85.32 | |
| PF15277 | 91 | Sec3-PIP2_bind: Exocyst complex component SEC3 N-t | 84.51 | |
| KOG3551 | 506 | consensus Syntrophins (type beta) [Extracellular s | 81.69 |
| >cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
Probab=99.92 E-value=8.3e-24 Score=131.97 Aligned_cols=95 Identities=25% Similarity=0.553 Sum_probs=78.3
Q ss_pred eEEEEEeeCCC-CCCeeeEEEEEECCeEEEEccCCCCCCCCCccEEEeCCCeE----EeecCc-c-cCCCCceEEEEeCC
Q 041556 29 RSGWLTKQGDY-IKTWRRRWFILKQGKLFWFKDSHNITPGSTPRGVIPVGTCL----TVRGAE-D-LLNKPFAFELSTGE 101 (143)
Q Consensus 29 ~~G~L~k~~~~-~~~w~~r~~vL~~~~l~~y~~~~~~~~~~~~~~~i~L~~~~----~~~~~~-~-~~~~~~~f~i~~~~ 101 (143)
++|||.|+|+. .+.|++|||||+++.|+||+++. +..+.|.|+|..+. +....+ . .....++|.|.+++
T Consensus 1 KeG~L~K~g~~~~k~wkkRwFvL~~~~L~Yyk~~~----d~~~~G~I~L~~~~~~~~v~~~~~~~~~~~~~~~F~i~t~~ 76 (103)
T cd01251 1 KEGFMEKTGPKHTEGFKKRWFTLDDRRLMYFKDPL----DAFAKGEVFLGSQEDGYEVREGLPPGTQGNHWYGVTLVTPE 76 (103)
T ss_pred CceeEEecCCCCCCCceeEEEEEeCCEEEEECCCC----CcCcCcEEEeeccccceeEeccCCccccccccceEEEEeCC
Confidence 58999999986 68999999999999999999988 67899999997542 222111 1 11234599999999
Q ss_pred eEEEEEcCCHHHHHHHHHHHHHHHHh
Q 041556 102 YTMYFVADTEKEKEEWINSIGRAIVQ 127 (143)
Q Consensus 102 ~~~~~~a~s~~e~~~Wi~al~~~~~~ 127 (143)
++|+|+|+|++|+.+||.||+.++..
T Consensus 77 Rty~l~a~s~~e~~~Wi~ai~~v~~~ 102 (103)
T cd01251 77 RKFLFACETEQDRREWIAAFQNVLSR 102 (103)
T ss_pred eEEEEECCCHHHHHHHHHHHHHHhcC
Confidence 99999999999999999999998764
|
Centaurin alpha Pleckstrin homology (PH) domain. Centaurin alpha is a phophatidlyinositide binding protein consisting of an N-terminal ArfGAP domain and two PH domains. In response to growth factor activation, PI3K phosphorylates phosphatidylinositol 4,5-bisphosphate to phosphatidylinositol 3,4,5-trisphosphate. Centaurin alpha 1 is recruited to the plasma membrane following growth factor stimulation by specific binding of its PH domain to phosphatidylinositol 3,4,5-trisphosphate. Centaurin alpha 2 is constitutively bound to the plasma membrane since it binds phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate with equal affinity. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specifici |
| >cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01264 PH_melted Melted pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01238 PH_Tec Tec pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] | Back alignment and domain information |
|---|
| >cd01241 PH_Akt Akt pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0930 consensus Guanine nucleotide exchange factor Cytohesin, contains PH and Sec7 domains [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15409 PH_8: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C | Back alignment and domain information |
|---|
| >cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >smart00233 PH Pleckstrin homology domain | Back alignment and domain information |
|---|
| >PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A | Back alignment and domain information |
|---|
| >cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd00821 PH Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd00900 PH-like Pleckstrin homology-like domain | Back alignment and domain information |
|---|
| >cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1090 consensus Predicted dual-specificity phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A | Back alignment and domain information |
|---|
| >KOG3640 consensus Actin binding protein Anillin [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PLN00188 enhanced disease resistance protein (EDR2); Provisional | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3751 consensus Growth factor receptor-bound proteins (GRB7, GRB10, GRB14) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG4424 consensus Predicted Rho/Rac guanine nucleotide exchange factor/faciogenital dysplasia protein 3 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3543 consensus Ca2+-dependent activator protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0932 consensus Guanine nucleotide exchange factor EFA6 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN02866 phospholipase D | Back alignment and domain information |
|---|
| >cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis | Back alignment and domain information |
|---|
| >KOG3723 consensus PH domain protein Melted [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1739 consensus Serine/threonine protein kinase GPBP [Signal transduction mechanisms; Defense mechanisms] | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd01223 PH_Vav Vav pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0248 consensus Cytoplasmic protein Max-1, contains PH, MyTH4 and FERM domains [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01232 PH_TRIO Trio pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3531 consensus Rho guanine nucleotide exchange factor CDEP [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1451 consensus Oligophrenin-1 and related Rho GTPase-activating proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15408 PH_7: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >PF15406 PH_6: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15404 PH_4: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >PF15411 PH_10: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3549 consensus Syntrophins (type gamma) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG1738 consensus Membrane-associated guanylate kinase-interacting protein/connector enhancer of KSR-like [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1737 consensus Oxysterol-binding protein [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A | Back alignment and domain information |
|---|
| >KOG4407 consensus Predicted Rho GTPase-activating protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4424 consensus Predicted Rho/Rac guanine nucleotide exchange factor/faciogenital dysplasia protein 3 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3523 consensus Putative guanine nucleotide exchange factor TIM [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3727 consensus Mitogen inducible gene product (contains ERM and PH domains) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0248 consensus Cytoplasmic protein Max-1, contains PH, MyTH4 and FERM domains [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3531 consensus Rho guanine nucleotide exchange factor CDEP [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01255 PH_TIAM TIAM Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF08458 PH_2: Plant pleckstrin homology-like region; InterPro: IPR013666 This domain describes a pleckstrin homology (PH)-like region found in several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1264 consensus Phospholipase C [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0517 consensus Beta-spectrin [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4047 consensus Docking protein 1 (p62dok) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3551 consensus Syntrophins (type beta) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG2070 consensus Guanine nucleotide exchange factor [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2996 consensus Rho guanine nucleotide exchange factor VAV3 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1170 consensus Diacylglycerol kinase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF15277 Sec3-PIP2_bind: Exocyst complex component SEC3 N-terminal PIP2 binding PH; PDB: 3HIE_D 3A58_E | Back alignment and domain information |
|---|
| >KOG3551 consensus Syntrophins (type beta) [Extracellular structures] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 143 | ||||
| 2r0d_A | 347 | Crystal Structure Of Autoinhibited Form Of Grp1 Arf | 1e-12 | ||
| 1fhw_A | 129 | Structure Of The Pleckstrin Homology Domain From Gr | 2e-12 | ||
| 2r09_A | 347 | Crystal Structure Of Autoinhibited Form Of Grp1 Arf | 3e-12 | ||
| 1fhx_A | 129 | Structure Of The Pleckstrin Homology Domain From Gr | 4e-12 | ||
| 1fgy_A | 127 | Grp1 Ph Domain With Ins(1,3,4,5)p4 Length = 127 | 3e-11 | ||
| 1u2b_A | 138 | Triglycine Variant Of The Grp1 Pleckstrin Homology | 7e-11 | ||
| 1u27_A | 129 | Triglycine Variant Of The Arno Pleckstrin Homology | 1e-10 | ||
| 1eaz_A | 125 | Crystal Structure Of The Phosphoinositol (3,4)-Bisp | 1e-08 | ||
| 2dkp_A | 128 | Solution Structure Of The Ph Domain Of Pleckstrin H | 7e-08 | ||
| 1v89_A | 118 | Solution Structure Of The Pleckstrin Homology Domai | 2e-07 | ||
| 1fao_A | 126 | Structure Of The Pleckstrin Homology Domain From Da | 3e-07 | ||
| 2yry_A | 122 | Solution Structure Of The Ph Domain Of Pleckstrin H | 7e-07 | ||
| 2d9y_A | 117 | Solution Structure Of The Ph Domain Of Pepp-3 From | 7e-07 | ||
| 1pls_A | 113 | Solution Structure Of A Pleckstrin Homology Domain | 8e-07 | ||
| 2x18_A | 119 | The Crystal Structure Of The Ph Domain Of Human Akt | 3e-06 | ||
| 1p6s_A | 111 | Solution Structure Of The Pleckstrin Homology Domai | 3e-06 | ||
| 1unp_A | 121 | Crystal Structure Of The Pleckstrin Homology Domain | 4e-06 | ||
| 2uvm_A | 123 | Structure Of Pkbalpha Ph Domain In Complex With A N | 4e-06 | ||
| 1unr_A | 125 | Crystal Structure Of The Ph Domain Of Pkb Alpha In | 4e-06 | ||
| 3o96_A | 446 | Crystal Structure Of Human Akt1 With An Allosteric | 5e-06 | ||
| 4ejn_A | 446 | Crystal Structure Of Autoinhibited Form Of Akt1 In | 5e-06 | ||
| 1h10_A | 125 | High Resolution Structure Of The Pleckstrin Homolog | 7e-06 | ||
| 2uzs_A | 125 | A Transforming Mutation In The Pleckstrin Homology | 7e-06 | ||
| 2uzr_A | 124 | A Transforming Mutation In The Pleckstrin Homology | 7e-06 | ||
| 1upq_A | 123 | Crystal Structure Of The Pleckstrin Homology (Ph) D | 8e-05 | ||
| 3tfm_A | 228 | Myosin X Ph1n-Ph2-Ph1c Tandem Length = 228 | 1e-04 | ||
| 2rsg_A | 94 | Solution Structure Of The Cert Ph Domain Length = 9 | 2e-04 | ||
| 1xx0_A | 127 | Structure Of The C-Terminal Ph Domain Of Human Plec | 3e-04 | ||
| 2kcj_A | 108 | Solution Structure Of Fapp1 Ph Domain Length = 108 | 3e-04 | ||
| 2i5c_A | 109 | Crystal Structure Of The C-Terminal Ph Domain Of Pl | 4e-04 | ||
| 1zm0_A | 114 | Crystal Structure Of The Carboxyl Terminal Ph Domai | 4e-04 | ||
| 1x05_A | 129 | Solution Structure Of The C-Terminal Ph Domain Of H | 5e-04 | ||
| 3rcp_A | 103 | Crystal Structure Of The Fapp1 Pleckstrin Homology | 7e-04 | ||
| 1wg7_A | 150 | Solution Structure Of Pleckstrin Homology Domain Fr | 7e-04 |
| >pdb|2R0D|A Chain A, Crystal Structure Of Autoinhibited Form Of Grp1 Arf Gtpase Exchange Factor Length = 347 | Back alignment and structure |
|
| >pdb|1FHW|A Chain A, Structure Of The Pleckstrin Homology Domain From Grp1 In Complex With Inositol(1,3,4,5,6)pentakisphosphate Length = 129 | Back alignment and structure |
| >pdb|2R09|A Chain A, Crystal Structure Of Autoinhibited Form Of Grp1 Arf Gtpase Exchange Factor Length = 347 | Back alignment and structure |
| >pdb|1FHX|A Chain A, Structure Of The Pleckstrin Homology Domain From Grp1 In Complex With Inositol 1,3,4,5-Tetrakisphosphate Length = 129 | Back alignment and structure |
| >pdb|1FGY|A Chain A, Grp1 Ph Domain With Ins(1,3,4,5)p4 Length = 127 | Back alignment and structure |
| >pdb|1U2B|A Chain A, Triglycine Variant Of The Grp1 Pleckstrin Homology Domain Unliganded Length = 138 | Back alignment and structure |
| >pdb|1U27|A Chain A, Triglycine Variant Of The Arno Pleckstrin Homology Domain In Complex With Ins(1,3,4,5)p4 Length = 129 | Back alignment and structure |
| >pdb|1EAZ|A Chain A, Crystal Structure Of The Phosphoinositol (3,4)-Bisphosphate Binding Ph Domain Of Tapp1 From Human Length = 125 | Back alignment and structure |
| >pdb|2DKP|A Chain A, Solution Structure Of The Ph Domain Of Pleckstrin Homology Domain-Containing Protein Family A Member 5 From Human Length = 128 | Back alignment and structure |
| >pdb|1V89|A Chain A, Solution Structure Of The Pleckstrin Homology Domain Of Human Kiaa0053 Protein Length = 118 | Back alignment and structure |
| >pdb|1FAO|A Chain A, Structure Of The Pleckstrin Homology Domain From Dapp1PHISH IN COMPLEX WITH INOSITOL 1,3,4,5- Tetrakisphosphate Length = 126 | Back alignment and structure |
| >pdb|2YRY|A Chain A, Solution Structure Of The Ph Domain Of Pleckstrin Homology Domain-Containing Family A Member 6 From Human Length = 122 | Back alignment and structure |
| >pdb|2D9Y|A Chain A, Solution Structure Of The Ph Domain Of Pepp-3 From Human Length = 117 | Back alignment and structure |
| >pdb|1PLS|A Chain A, Solution Structure Of A Pleckstrin Homology Domain Length = 113 | Back alignment and structure |
| >pdb|2X18|A Chain A, The Crystal Structure Of The Ph Domain Of Human Akt3 Protein Kinase Length = 119 | Back alignment and structure |
| >pdb|1P6S|A Chain A, Solution Structure Of The Pleckstrin Homology Domain Of Human Protein Kinase B Beta (PkbAKT) Length = 111 | Back alignment and structure |
| >pdb|1UNP|A Chain A, Crystal Structure Of The Pleckstrin Homology Domain Of Pkb Alpha Length = 121 | Back alignment and structure |
| >pdb|2UVM|A Chain A, Structure Of Pkbalpha Ph Domain In Complex With A Novel Inositol Headgroup Surrogate, Benzene 1,2,3,4- Tetrakisphosphate Length = 123 | Back alignment and structure |
| >pdb|1UNR|A Chain A, Crystal Structure Of The Ph Domain Of Pkb Alpha In Complex With A Sulfate Molecule Length = 125 | Back alignment and structure |
| >pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 | Back alignment and structure |
| >pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 | Back alignment and structure |
| >pdb|1H10|A Chain A, High Resolution Structure Of The Pleckstrin Homology Domain Of Protein Kinase BAKT BOUND TO Ins(1,3,4,5)-Tetrakisphophate Length = 125 | Back alignment and structure |
| >pdb|2UZS|A Chain A, A Transforming Mutation In The Pleckstrin Homology Domain Of Akt1 In Cancer (Akt1-Ph_e17k) Length = 125 | Back alignment and structure |
| >pdb|2UZR|A Chain A, A Transforming Mutation In The Pleckstrin Homology Domain Of Akt1 In Cancer (Akt1-Ph_e17k) Length = 124 | Back alignment and structure |
| >pdb|1UPQ|A Chain A, Crystal Structure Of The Pleckstrin Homology (Ph) Domain Of Pepp1 Length = 123 | Back alignment and structure |
| >pdb|3TFM|A Chain A, Myosin X Ph1n-Ph2-Ph1c Tandem Length = 228 | Back alignment and structure |
| >pdb|2RSG|A Chain A, Solution Structure Of The Cert Ph Domain Length = 94 | Back alignment and structure |
| >pdb|1XX0|A Chain A, Structure Of The C-Terminal Ph Domain Of Human Pleckstrin Length = 127 | Back alignment and structure |
| >pdb|2KCJ|A Chain A, Solution Structure Of Fapp1 Ph Domain Length = 108 | Back alignment and structure |
| >pdb|2I5C|A Chain A, Crystal Structure Of The C-Terminal Ph Domain Of Pleckstrin In Complex With D-Myo-Ins(1,2,3,4,5)p5 Length = 109 | Back alignment and structure |
| >pdb|1ZM0|A Chain A, Crystal Structure Of The Carboxyl Terminal Ph Domain Of Pleckstrin To 2.1 Angstroms Length = 114 | Back alignment and structure |
| >pdb|1X05|A Chain A, Solution Structure Of The C-Terminal Ph Domain Of Human Pleckstrin Length = 129 | Back alignment and structure |
| >pdb|3RCP|A Chain A, Crystal Structure Of The Fapp1 Pleckstrin Homology Domain Length = 103 | Back alignment and structure |
| >pdb|1WG7|A Chain A, Solution Structure Of Pleckstrin Homology Domain From Human Kiaa1058 Protein Length = 150 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 143 | |||
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 2e-37 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 4e-35 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 2e-34 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 3e-34 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 1e-32 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 1e-31 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 1e-31 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 1e-31 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 7e-31 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 8e-31 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 9e-31 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 1e-30 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 5e-04 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 2e-30 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 5e-30 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 1e-29 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 2e-28 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 2e-28 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 3e-28 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 4e-28 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 7e-28 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 9e-28 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 1e-27 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 3e-27 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 3e-27 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 4e-27 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 7e-27 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 2e-26 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 8e-26 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 1e-25 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 7e-25 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 2e-24 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 2e-23 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 2e-23 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 3e-22 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 4e-22 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 1e-21 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 1e-21 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 1e-21 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 7e-20 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 2e-19 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 1e-18 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 2e-18 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 2e-17 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 5e-17 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 6e-17 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 2e-16 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 2e-16 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 4e-16 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 4e-16 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 7e-16 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 2e-15 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 2e-15 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 2e-15 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 4e-13 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 9e-13 | |
| 4f7h_A | 173 | Fermitin family homolog 2; beta-barrel, membrane b | 2e-12 | |
| 2r09_A | 347 | Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph | 2e-12 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 7e-12 | |
| 2d9w_A | 127 | Docking protein 2; PH domain, structural genomics, | 9e-12 | |
| 3hk0_A | 256 | Growth factor receptor-bound protein 10; GRB10, RA | 1e-10 | |
| 2w2x_D | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 9e-10 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 3e-09 | |
| 2d9z_A | 129 | Protein kinase C, NU type; PH domain, structural g | 1e-08 | |
| 2coa_A | 125 | Protein kinase C, D2 type; protein kinase D2, PH d | 2e-08 | |
| 1v61_A | 132 | RAC/CDC42 guanine nucleotide exchange factor (GEF) | 3e-07 | |
| 3ml4_A | 224 | Protein DOK-7; tyrosine phosphorylation, adapter p | 3e-07 | |
| 1zc3_B | 113 | Exocyst complex protein EXO84; exocytosis, small G | 4e-05 | |
| 2dfk_A | 402 | Collybistin II; DH domain, PH domain, cell cycle; | 8e-05 | |
| 1dbh_A | 354 | Protein (human SOS 1); guanine nucleotide exchange | 1e-04 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 3e-04 | |
| 1txd_A | 385 | RHO guanine nucleotide exchange factor 12; helical | 4e-04 | |
| 3mpx_A | 434 | FYVE, rhogef and PH domain-containing protein 5; s | 4e-04 | |
| 3odw_A | 536 | RHO guanine nucleotide exchange factor 1; regulati | 5e-04 | |
| 2vrw_B | 406 | P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP | 6e-04 | |
| 1w1g_A | 151 | HPDK1, 3-phosphoinositide dependent protein kinase | 7e-04 | |
| 3p6a_A | 377 | RHO guanine nucleotide exchange factor 1; regulati | 7e-04 | |
| 2lg1_A | 185 | A-kinase anchor protein 13; metal binding protein; | 8e-04 | |
| 3ky9_A | 587 | Proto-oncogene VAV; calponin homology domain, DBL | 8e-04 | |
| 1xcg_A | 368 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 9e-04 |
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 | Back alignment and structure |
|---|
Score = 123 bits (310), Expect = 2e-37
Identities = 33/113 (29%), Positives = 51/113 (45%), Gaps = 5/113 (4%)
Query: 24 WSNPERSGWLTKQGDYIKTWRRRWFILKQGKLFWFKDSHNITPGSTPRGVIPVGTCLTVR 83
S + G+LTKQG +KTW+ RWF L + +L +FKD P ++ + C V+
Sbjct: 15 PSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQM----SPEPIRILDLTECSAVQ 70
Query: 84 GAEDLLNKPFAFELSTGEYTMYFVADTEKEKEEWINSIGRAIVQHSRSVTESE 136
+ F L T Y A T E +EWI + + Q + + + E
Sbjct: 71 FDYS-QERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGE 122
|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Length = 264 | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 112 | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Length = 125 | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Length = 169 | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 | Back alignment and structure |
|---|
| >4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Length = 173 | Back alignment and structure |
|---|
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Length = 347 | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Length = 106 | Back alignment and structure |
|---|
| >2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Length = 256 | Back alignment and structure |
|---|
| >2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Length = 124 | Back alignment and structure |
|---|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Length = 117 | Back alignment and structure |
|---|
| >2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 129 | Back alignment and structure |
|---|
| >2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 125 | Back alignment and structure |
|---|
| >1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 132 | Back alignment and structure |
|---|
| >3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} Length = 224 | Back alignment and structure |
|---|
| >1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Length = 113 | Back alignment and structure |
|---|
| >2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Length = 402 | Back alignment and structure |
|---|
| >1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Length = 354 | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 | Back alignment and structure |
|---|
| >1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Length = 385 | Back alignment and structure |
|---|
| >3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Length = 434 | Back alignment and structure |
|---|
| >3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Length = 536 | Back alignment and structure |
|---|
| >2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Length = 406 | Back alignment and structure |
|---|
| >1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Length = 151 | Back alignment and structure |
|---|
| >3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Length = 377 | Back alignment and structure |
|---|
| >2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 | Back alignment and structure |
|---|
| >1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Length = 368 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 143 | |||
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 99.94 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 99.94 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 99.94 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 99.93 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 99.93 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 99.93 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 99.92 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 99.92 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 99.92 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 99.92 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 99.92 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 99.92 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 99.92 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 99.92 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 99.91 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 99.91 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 99.91 | |
| 2w2x_D | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.91 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 99.91 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 99.91 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 99.9 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 99.9 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 99.9 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 99.9 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 99.9 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 99.9 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 99.9 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 99.9 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 99.9 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 99.9 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 99.9 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 99.9 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 99.9 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 99.9 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 99.9 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 99.9 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 99.9 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 99.89 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 99.89 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 99.89 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 99.89 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 99.89 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 99.89 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 99.87 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 99.87 | |
| 2r09_A | 347 | Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph | 99.86 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 99.86 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 99.85 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 99.85 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 99.85 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 99.85 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 99.85 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 99.84 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 99.84 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 99.82 | |
| 4h8s_A | 407 | DCC-interacting protein 13-beta; BAR domain, pleck | 99.81 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 99.8 | |
| 2fjl_A | 150 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.8 | |
| 3tca_A | 291 | Amyloid beta A4 precursor protein-binding family 1 | 99.78 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 99.77 | |
| 2d9w_A | 127 | Docking protein 2; PH domain, structural genomics, | 99.77 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 99.76 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 99.71 | |
| 4f7h_A | 173 | Fermitin family homolog 2; beta-barrel, membrane b | 99.67 | |
| 3hk0_A | 256 | Growth factor receptor-bound protein 10; GRB10, RA | 99.65 | |
| 4bbk_A | 165 | Kindlin-1, fermitin family homolog 1; PH domain, c | 99.63 | |
| 4gmv_A | 281 | RAS-associated and pleckstrin homology domains-CO | 99.6 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 99.57 | |
| 1w1g_A | 151 | HPDK1, 3-phosphoinositide dependent protein kinase | 99.55 | |
| 2d9z_A | 129 | Protein kinase C, NU type; PH domain, structural g | 99.55 | |
| 2coa_A | 125 | Protein kinase C, D2 type; protein kinase D2, PH d | 99.54 | |
| 1v61_A | 132 | RAC/CDC42 guanine nucleotide exchange factor (GEF) | 99.09 | |
| 1v5m_A | 136 | SH2 and PH domain-containing adapter protein APS; | 98.95 | |
| 3ml4_A | 224 | Protein DOK-7; tyrosine phosphorylation, adapter p | 98.95 | |
| 1zc3_B | 113 | Exocyst complex protein EXO84; exocytosis, small G | 98.94 | |
| 3qwm_A | 140 | Iqsec1, IQ motif and SEC7 domain-containing protei | 98.64 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 98.58 | |
| 3mpx_A | 434 | FYVE, rhogef and PH domain-containing protein 5; s | 98.52 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 98.46 | |
| 2dfk_A | 402 | Collybistin II; DH domain, PH domain, cell cycle; | 98.38 | |
| 1dbh_A | 354 | Protein (human SOS 1); guanine nucleotide exchange | 98.34 | |
| 2vrw_B | 406 | P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP | 98.33 | |
| 2lg1_A | 185 | A-kinase anchor protein 13; metal binding protein; | 98.31 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 98.3 | |
| 3ky9_A | 587 | Proto-oncogene VAV; calponin homology domain, DBL | 98.26 | |
| 1kz7_A | 353 | Guanine nucleotide exchange factor DBS; guanine nu | 98.19 | |
| 1mai_A | 131 | Phospholipase C delta-1; pleckstrin, inositol tris | 98.16 | |
| 3t06_A | 418 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 98.14 | |
| 1xcg_A | 368 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 98.13 | |
| 1nty_A | 311 | Triple functional domain protein; DBL, pleckstrin, | 98.13 | |
| 3p6a_A | 377 | RHO guanine nucleotide exchange factor 1; regulati | 98.04 | |
| 1txd_A | 385 | RHO guanine nucleotide exchange factor 12; helical | 97.97 | |
| 3odw_A | 536 | RHO guanine nucleotide exchange factor 1; regulati | 97.95 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 97.95 | |
| 2z0q_A | 346 | XPLN, RHO guanine nucleotide exchange factor 3; DH | 97.94 | |
| 2rgn_B | 354 | RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p | 97.87 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 97.84 | |
| 1foe_A | 377 | T-lymphoma invasion and metastasis inducing protei | 97.63 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 97.58 | |
| 1fho_A | 119 | UNC-89; pleckstrin homology domain, electrostatics | 96.87 | |
| 1z87_A | 263 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 96.7 | |
| 2adz_A | 178 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 96.36 | |
| 3hie_A | 171 | Protein PSL1, exocyst complex component SEC3; PH d | 93.81 | |
| 3a58_A | 320 | Exocyst complex component SEC3; protein complex, P | 90.38 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 89.09 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 88.29 | |
| 3a98_B | 203 | Engulfment and cell motility protein 1; protein-pr | 87.4 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 86.23 |
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
Probab=99.94 E-value=1.4e-26 Score=146.83 Aligned_cols=106 Identities=23% Similarity=0.375 Sum_probs=90.0
Q ss_pred cccceEEEEEeeCC-CCCCeeeEEEEEECCeEEEEc----cCCCCCCCCCccEEEeCCCeEEee--cCcccCCCCceEEE
Q 041556 25 SNPERSGWLTKQGD-YIKTWRRRWFILKQGKLFWFK----DSHNITPGSTPRGVIPVGTCLTVR--GAEDLLNKPFAFEL 97 (143)
Q Consensus 25 ~~~~~~G~L~k~~~-~~~~w~~r~~vL~~~~l~~y~----~~~~~~~~~~~~~~i~L~~~~~~~--~~~~~~~~~~~f~i 97 (143)
.++.++|||+|+|+ .++.|++|||||.+..|+||+ ++. ...|.|+|.|.++++.. +.++...++++|.|
T Consensus 6 ~n~~~~G~L~KqG~~~~K~WKrRwFVL~~~~LyYfk~~~~~~~----~~~p~G~I~L~g~tV~~~~~~~~~~~~k~~F~~ 81 (126)
T 1wi1_A 6 SGMKHSGYLWAIGKNVWKRWKKRFFVLVQVSQYTFAMCSYREK----KAEPQELLQLDGYTVDYTDPQPGLEGGRAFFNA 81 (126)
T ss_dssp CCEEEEEEEEEECSSSCCSCEEEEEEEEEEETTEEEEEECCSS----SSCCSEEEECSSCEEEECCCCSSCCSCSSEEEE
T ss_pred CCCceeEEEEEeCCCcccccceEEEEEeCCEEEEEEccccccc----CCCCceEEECCCcEEEEecCCcccccCceEEEE
Confidence 45789999999987 678999999999999999999 766 68899999999985432 33333468899999
Q ss_pred EeCCeEEEEEcCCHHHHHHHHHHHHHHHHhhcCCCCc
Q 041556 98 STGEYTMYFVADTEKEKEEWINSIGRAIVQHSRSVTE 134 (143)
Q Consensus 98 ~~~~~~~~~~a~s~~e~~~Wi~al~~~~~~~~~~~~~ 134 (143)
.+++++|+|+|+|++||..||.||.+|+.+..+..+.
T Consensus 82 v~~~~ty~~~Adseee~~~WikAi~~A~~~~~~~~~~ 118 (126)
T 1wi1_A 82 VKEGDTVIFASDDEQDRILWVQAMYRATGQSHKPVPP 118 (126)
T ss_dssp ECSSCEEEEECSSHHHHHHHHHHHHHHHTCSSCCCCC
T ss_pred ecCCceEEEEcCCHHHHHHHHHHHHHHhccccCCCCC
Confidence 9998899999999999999999999999876666543
|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A | Back alignment and structure |
|---|
| >2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A | Back alignment and structure |
|---|
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A | Back alignment and structure |
|---|
| >4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} | Back alignment and structure |
|---|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* | Back alignment and structure |
|---|
| >3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A | Back alignment and structure |
|---|
| >2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} | Back alignment and structure |
|---|
| >1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* | Back alignment and structure |
|---|
| >3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A | Back alignment and structure |
|---|
| >2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A | Back alignment and structure |
|---|
| >2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A | Back alignment and structure |
|---|
| >1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A | Back alignment and structure |
|---|
| >1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} | Back alignment and structure |
|---|
| >1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* | Back alignment and structure |
|---|
| >1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A | Back alignment and structure |
|---|
| >3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A | Back alignment and structure |
|---|
| >1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A | Back alignment and structure |
|---|
| >3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A | Back alignment and structure |
|---|
| >2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A | Back alignment and structure |
|---|
| >1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2adz_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3hie_A Protein PSL1, exocyst complex component SEC3; PH domain, dimer, domain swapping, phosphate-binding, coiled coil, exocytosis; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >3a98_B Engulfment and cell motility protein 1; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} PDB: 2vsz_A | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 143 | ||||
| d1faoa_ | 100 | b.55.1.1 (A:) Dual adaptor of phosphotyrosine and | 2e-23 | |
| d1eaza_ | 103 | b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: | 1e-22 | |
| d1fgya_ | 127 | b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 | 2e-22 | |
| d1plsa_ | 113 | b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta | 8e-21 | |
| d1v89a_ | 118 | b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI | 3e-19 | |
| d1wi1a_ | 126 | b.55.1.1 (A:) Calcium-dependent activator protein | 2e-17 | |
| d1u5ea1 | 209 | b.55.1.1 (A:14-222) Src-associated adaptor protein | 4e-17 | |
| d1btka_ | 169 | b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom | 5e-17 | |
| d1x1ga1 | 116 | b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie | 9e-17 | |
| d2i5fa1 | 104 | b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie | 5e-16 | |
| d1v88a_ | 130 | b.55.1.1 (A:) Oxysterol binding protein-related pr | 5e-16 | |
| d2coca1 | 99 | b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain cont | 1e-15 | |
| d2j59m1 | 133 | b.55.1.1 (M:931-1063) Rho GTPase-activating protei | 2e-15 | |
| d2coda1 | 102 | b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo | 2e-15 | |
| d1unqa_ | 118 | b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H | 4e-15 | |
| d1upqa_ | 107 | b.55.1.1 (A:) Phosphoinositol 3-phosphate binding | 4e-15 | |
| d1v5ua_ | 117 | b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M | 4e-15 | |
| d1wgqa_ | 109 | b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin | 2e-14 | |
| d1w1ha_ | 147 | b.55.1.1 (A:) 3-phosphoinositide dependent protein | 4e-14 | |
| d1u5da1 | 106 | b.55.1.1 (A:108-213) Src kinase-associated phospho | 6e-14 | |
| d1droa_ | 122 | b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila | 1e-13 | |
| d2dyna_ | 111 | b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId | 4e-13 | |
| d1u5fa1 | 111 | b.55.1.1 (A:109-219) Src-associated adaptor protei | 9e-13 | |
| d1qqga1 | 103 | b.55.1.2 (A:12-114) Insulin receptor substrate 1, | 1e-12 | |
| d2elba2 | 101 | b.55.1.1 (A:274-374) DCC-interacting protein 13-al | 2e-12 | |
| d1v5pa_ | 126 | b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: | 6e-12 | |
| d1omwa2 | 119 | b.55.1.1 (A:550-668) G-protein coupled receptor ki | 1e-11 | |
| d2fjla1 | 101 | b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phosph | 2e-11 | |
| d2cofa1 | 95 | b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) | 4e-11 | |
| d1x1fa1 | 136 | b.55.1.1 (A:8-143) Signal-transducing adaptor prot | 8e-11 | |
| d1v5ma_ | 136 | b.55.1.1 (A:) SH2 and PH domain-containing adapter | 1e-10 | |
| d1btna_ | 106 | b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), | 1e-10 | |
| d2coaa1 | 112 | b.55.1.1 (A:8-119) Protein kinase c, d2 type {Huma | 3e-10 | |
| d1wg7a_ | 150 | b.55.1.1 (A:) Dedicator of cytokinesis protein 9, | 5e-10 | |
| d1wjma_ | 123 | b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), | 5e-10 | |
| d1v61a_ | 132 | b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (M | 1e-08 | |
| d1maia_ | 119 | b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus | 1e-06 | |
| d2dfka2 | 162 | b.55.1.1 (A:240-401) Rho guanine nucleotide exchan | 3e-06 | |
| d1zc3b1 | 109 | b.55.1.1 (B:171-279) Exocyst complex protein EXO84 | 3e-06 | |
| d1fhoa_ | 119 | b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis ele | 1e-05 | |
| d1ki1b2 | 142 | b.55.1.1 (B:1439-1580) GEF of intersectin {Human ( | 5e-04 | |
| d1xcga2 | 140 | b.55.1.1 (A:942-1081) Rho guanine nucleotide excha | 0.002 | |
| d1dbha2 | 133 | b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {H | 0.003 |
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
class: All beta proteins fold: PH domain-like barrel superfamily: PH domain-like family: Pleckstrin-homology domain (PH domain) domain: Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH species: Human (Homo sapiens) [TaxId: 9606]
Score = 85.6 bits (211), Expect = 2e-23
Identities = 32/103 (31%), Positives = 48/103 (46%), Gaps = 5/103 (4%)
Query: 25 SNPERSGWLTKQGDYIKTWRRRWFILKQGKLFWFKDSHNITPGSTPRGVIPVGTCLTVRG 84
S + G+LTKQG +KTW+ RWF L + +L +FKD + P ++ + C V+
Sbjct: 2 SLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSP----EPIRILDLTECSAVQF 57
Query: 85 AEDLLNKPFAFELSTGEYTMYFVADTEKEKEEWINSIGRAIVQ 127
+ F L T Y A T E +EWI + + Q
Sbjct: 58 DYS-QERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQ 99
|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Length = 119 | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123 | Back information, alignment and structure |
|---|
| >d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Length = 132 | Back information, alignment and structure |
|---|
| >d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 119 | Back information, alignment and structure |
|---|
| >d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 162 | Back information, alignment and structure |
|---|
| >d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 109 | Back information, alignment and structure |
|---|
| >d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 119 | Back information, alignment and structure |
|---|
| >d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Length = 142 | Back information, alignment and structure |
|---|
| >d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
| >d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 143 | |||
| d1faoa_ | 100 | Dual adaptor of phosphotyrosine and 3-phosphoinosi | 99.94 | |
| d2coaa1 | 112 | Protein kinase c, d2 type {Human (Homo sapiens) [T | 99.91 | |
| d2fjla1 | 101 | Phosphoinositide phospholipase C, PLC-gamma-1 {Rat | 99.91 | |
| d1plsa_ | 113 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.91 | |
| d1wgqa_ | 109 | FYVE, RhoGEF and PH domain containing protein 6, F | 99.91 | |
| d1eaza_ | 103 | Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | 99.9 | |
| d1v89a_ | 118 | Rho-GTPase-activating protein 25 (KIAA0053) {Human | 99.9 | |
| d1x1fa1 | 136 | Signal-transducing adaptor protein 1, STAP-1 {Huma | 99.9 | |
| d2coda1 | 102 | Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 | 99.9 | |
| d1v88a_ | 130 | Oxysterol binding protein-related protein 8 (ORP-8 | 99.9 | |
| d2dyna_ | 111 | Dynamin {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1fgya_ | 127 | Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.89 | |
| d1v5ua_ | 117 | SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ | 99.89 | |
| d1btka_ | 169 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 99.88 | |
| d2j59m1 | 133 | Rho GTPase-activating protein 21 {Human (Homo sapi | 99.88 | |
| d1u5fa1 | 111 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.88 | |
| d2coca1 | 99 | FYVE, RhoGEF and PH domain containing protein 3, F | 99.87 | |
| d1upqa_ | 107 | Phosphoinositol 3-phosphate binding protein-1, PEP | 99.87 | |
| d1u5da1 | 106 | Src kinase-associated phosphoprotein SKAP55 (SCAP1 | 99.87 | |
| d1wi1a_ | 126 | Calcium-dependent activator protein for secretion, | 99.87 | |
| d1wg7a_ | 150 | Dedicator of cytokinesis protein 9, DOCK9 {Human ( | 99.86 | |
| d1u5ea1 | 209 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.85 | |
| d1w1ha_ | 147 | 3-phosphoinositide dependent protein kinase-1 {Hum | 99.85 | |
| d1qqga1 | 103 | Insulin receptor substrate 1, IRS-1 {Human (Homo s | 99.85 | |
| d1omwa2 | 119 | G-protein coupled receptor kinase 2 (beta-adrenerg | 99.84 | |
| d2i5fa1 | 104 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.84 | |
| d1v5ma_ | 136 | SH2 and PH domain-containing adapter protein APS { | 99.84 | |
| d2elba2 | 101 | DCC-interacting protein 13-alpha, APPL1 {Human (Ho | 99.84 | |
| d2cofa1 | 95 | KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | 99.83 | |
| d1x1ga1 | 116 | Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.83 | |
| d1v5pa_ | 126 | Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | 99.83 | |
| d1unqa_ | 118 | Rac-alpha serine/threonine kinase {Human (Homo sap | 99.82 | |
| d1wjma_ | 123 | beta-spectrin {Human (Homo sapiens), brain 2 isofo | 99.81 | |
| d1btna_ | 106 | beta-spectrin {Mouse (Mus musculus), brain [TaxId: | 99.8 | |
| d1droa_ | 122 | beta-spectrin {Fruit fly (Drosophila melanogaster) | 99.75 | |
| d1v61a_ | 132 | Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ | 99.52 | |
| d2dfka2 | 162 | Rho guanine nucleotide exchange factor 9, Collybis | 99.31 | |
| d1zc3b1 | 109 | Exocyst complex protein EXO84 {Rat (Rattus norvegi | 99.3 | |
| d1dbha2 | 133 | Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ | 99.06 | |
| d1maia_ | 119 | Phospholipase C delta-1 {Rat (Rattus norvegicus) [ | 98.96 | |
| d1ntya2 | 121 | Triple functional domain protein TRIO {Human (Homo | 98.81 | |
| d1ki1b2 | 142 | GEF of intersectin {Human (Homo sapiens) [TaxId: 9 | 98.76 | |
| d1xcga2 | 140 | Rho guanine nucleotide exchange factor 11, PDZ-Rho | 98.66 | |
| d1txda2 | 114 | Rho guanine nucleotide exchange factor 12 {Human ( | 98.61 | |
| d1kz7a2 | 147 | Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId | 98.52 | |
| d1fhoa_ | 119 | UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: | 98.21 | |
| d2adza1 | 105 | Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 | 98.07 | |
| d2zkmx3 | 131 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 94.6 | |
| d1foea2 | 162 | GEF of TIAM1 (T-Lymphoma invasion and metastasis i | 92.94 |
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: PH domain-like barrel superfamily: PH domain-like family: Pleckstrin-homology domain (PH domain) domain: Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.94 E-value=1.3e-25 Score=137.21 Aligned_cols=96 Identities=32% Similarity=0.587 Sum_probs=85.9
Q ss_pred cceEEEEEeeCCCCCCeeeEEEEEECCeEEEEccCCCCCCCCCccEEEeCCCeEEeecCcccCCCCceEEEEeCCeEEEE
Q 041556 27 PERSGWLTKQGDYIKTWRRRWFILKQGKLFWFKDSHNITPGSTPRGVIPVGTCLTVRGAEDLLNKPFAFELSTGEYTMYF 106 (143)
Q Consensus 27 ~~~~G~L~k~~~~~~~w~~r~~vL~~~~l~~y~~~~~~~~~~~~~~~i~L~~~~~~~~~~~~~~~~~~f~i~~~~~~~~~ 106 (143)
+.++|||.|+++..+.|++|||||.++.|+||+++. +..+.+.|+|.+|..+..... ..++++|+|.+++++|+|
T Consensus 4 ~~KeG~L~K~~~~~k~Wk~R~fvL~~~~L~yy~~~~----~~~~~g~i~L~~~~~v~~~~~-~~~~~~F~i~~~~r~~~l 78 (100)
T d1faoa_ 4 GTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQM----SPEPIRILDLTECSAVQFDYS-QERVNCFCLVFPFRTFYL 78 (100)
T ss_dssp TCEEEEEEEECSSSCCEEEEEEEEETTEEEEESSTT----CSSCSEEEEGGGCCEEEEECS-SSSSSEEEEEETTEEEEE
T ss_pred ccEEEEEEEeCCCCCCceEEEEEEECCEEEEEeccC----CccCceEEechheEEEEeccc-cccccccccccCCeEEEE
Confidence 578999999998888999999999999999999988 778999999999866654433 367899999999999999
Q ss_pred EcCCHHHHHHHHHHHHHHHHh
Q 041556 107 VADTEKEKEEWINSIGRAIVQ 127 (143)
Q Consensus 107 ~a~s~~e~~~Wi~al~~~~~~ 127 (143)
+|+|++++++|+.||+.++.+
T Consensus 79 ~a~s~~~~~~Wi~ai~~~i~~ 99 (100)
T d1faoa_ 79 CAKTGVEADEWIKILRWKLSQ 99 (100)
T ss_dssp ECSSHHHHHHHHHHHHHHHHT
T ss_pred EeCCHHHHHHHHHHHHHHHhh
Confidence 999999999999999998864
|
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2zkmx3 b.55.1.1 (X:11-141) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1foea2 b.55.1.1 (A:1240-1401) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|