Citrus Sinensis ID: 041562


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650---
MCCFTQQRKTMPKLKLLHIIIIILSCFSSFCQACNQIDQDSLLSLGFNISSPGLNWSSSTDCCLWEGIKCDANGRVSHLWLPWKGLTGTISLSIGNLTHLSHLNLSHNRLSGEFPSSLSSNYIKIIDLSSNHFQGKIPSTIFRLTQNLITFNVSNNSFTGLISWSAWVDSFCSIRHLDLSNNRFTGPVPLGLGSCSRLKTFRAGFNYLTGSLPDDIYTATSLEQLSLSFNHISGSIKNGIVNLTSLRILELYSNSLTGLIPRDIGKLTNLESLVLHNNSLSGSLPSSLKNCINLTLLNLQSNFFEGDISVFNFSTLLKLRVLDLGSNLFTGSLPITLNSCKSLTAVNLARNQLEGQISPGIVALKSLSFLSLSNNSLTNITGAIRILMGCKNLKVLIIPLNFMDETMPDNDRLTSANGFKNLQVLGLAECKLKGQVPSWIGKLKKLQVLDLSFNQLTGSVPRFLGNMSSLFHIDFSNNLISGEFPKEFCRLPALTPEQDKNKANESYLEFSLFKGSNNFIGEYKKILTFHEQYTWKTTASAAVSLLRLLLHMLDLSHNNFSGNIPDQISQLTNLERMDLSKNHLSGEIPVSLKRLHFLSAFNVAENNLRGSIPSGGQFDTFPSSSFRGNPDLCGAIVQRSCSVQPRPIVLPDS
ccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccccccccccccccEEccccccEEEEEccccccEEEccccccccccccEEEccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccEEEEcccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEcccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccHHHHccccccEEEccccccEEEcccccccccccccEEEccccEEEEEccccccccccccEEEccccccEEEccccccccccccEEEcccccccccccccccccccccccEEEccccccccccccccccccccccccccEEEcccccccccccHHHHcccccccEEccccccccccccccccccccccEEcccccccccccHHHccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccHHHHHHHHHEEEccccccccccHHHHHcccccccccccccccccccHHHHcccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccccccccEEEEEEccccEEEEEEEccccccccccHHHccccccEEEEcccccccccccHHHcccccEEEEEccccccccccHHHHHHccccEEEEEccccccccccccHHHccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccEcccccccHHHcccccccEEEEccccccccccHHHccccccEEEEEccccccccccccHHHccccccEEEEEEcccccccccccccccccccccccEEEEEccccccccccHHHHccccccEEEEccccccccccHHHccccccEEEEcccccccccccHHHHccHHHHHHHHccccccccccccccccccccccccccccEEEcccccccccccHHHHccccccEEEEEEEccEEEccHHHHHcccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcccccEEEcccccccccccccccccccc
mccftqqrktmpklKLLHIIIIILSCFSSFCQACNQIDQdsllslgfnisspglnwssstdcclwegikcdangrvshlwlpwkgltgtislsignlthlSHLNlshnrlsgefpsslssnYIKIIDlssnhfqgkipsTIFRLTQNLitfnvsnnsftgLISWSAWVDSFCsirhldlsnnrftgpvplglgscsrlkTFRAGFNyltgslpddiyTATSLEQLSLSFNHISGSIKNGIVNLTSLRILELYSNsltgliprdigkltnLESLVLHnnslsgslpsslknCINLTLLnlqsnffegdisvfnFSTLLKLRVLDlgsnlftgslpitlnsckSLTAVNLARNqlegqispgiVALKSLSFLSlsnnsltnITGAIRILMGCKNLKVLiiplnfmdetmpdndrltsangfknlqvlglaecklkgqvpswigklKKLQVLDLSFnqltgsvprflgnmsslfhidfsnnlisgefpkefcrlpaltpeqdknkaNESYLEFSLfkgsnnfiGEYKKILTFHEQYTWKTTASAAVSLLRLLLHMLDlshnnfsgnipdqisqltnlermdlsknhlsgeipvSLKRLHFLSAFNVaennlrgsipsggqfdtfpsssfrgnpdlcgAIVQrscsvqprpivlpds
mccftqqrktmpklKLLHIIIIILSCFSSFCQACNQIDQDSLLSLGFNISSPGLNWSSSTDCCLWEGIKCDANGRVSHLWLPWKGLTGTISLSIGNLTHLSHLNLSHNRLSGEFPSSLSSNYIKIIDLSSNHFQGKIPSTIFRLTQNLITFNVSNNSFTGLISWSAWVDSFCSIRHLDLSNNRFTGPVPLGLGSCSRLKTFRAGFNYLTGSLPDDIYTATSLEQLSLSFNHISGSIKNGIVNLTSLRILELYSNSLTGLIPRDIGKLTNLESLVLHNNSLSGSLPSSLKNCINLTLLNLQSNFFEGDISVFNFSTLLKLRVLDLGSNLFTGSLPITLNSCKSLTAVNLARNQLEGQISPGIVALKSLSFLSLSNNSLTNITGAIRILMGCKNLKVLIIPLNFMDETMPDNDRLTSANGFKNLQVLGLAECKLKGQVPSWIGKLKKLQVLDLSFNQLTGSVPRFLGNMSSLFHIDFSNNLISGEFPKEFCRLPALTPEQDKNKANESYLEFSLFKGSNNFIGEYKKILTFHEQYTWKTTASAAVSLLRLLLHMLDLSHNNFSGNIPDQISQLTNLERMDLSKNHLSGEIPVSLKRLHFLSAFNVAENNLRGSIPSGGQFDTFPSSSFRGNPDLCGAIVqrscsvqprpivlpds
MCCFTQQRKTMPklkllhiiiiilSCFSSFCQACNQIDQDSLLSLGFNISSPGLNWSSSTDCCLWEGIKCDANGRVSHLWLPWKGLTGTISLSIGnlthlshlnlshnrlsGEFPSSLSSNYIKIIDLSSNHFQGKIPSTIFRLTQNLITFNVSNNSFTGLISWSAWVDSFCSIRHLDLSNNRFTGPVPLGLGSCSRLKTFRAGFNYLTGSLPDDIYTATSLEQLSLSFNHISGSIKNGIVNLTSLRILELYSNSLTGLIPRDIGKLTNLESLVLHNNslsgslpsslKNCINLTLLNLQSNFFEGDISVFNFSTLLKLRVLDLGSNLFTGSLPITLNSCKSLTAVNLARNQLEGQISPGIVAlkslsflslsnnslTNITGAIRILMGCKNLKVLIIPLNFMDETMPDNDRLTSANGFKNLQVLGLAECKLKGQVPSWIGKLKKLQVLDLSFNQLTGSVPRFLGNMSSLFHIDFSNNLISGEFPKEFCRLPALTPEQDKNKANESYLEFSLFKGSNNFIGEYKKILTFHEQYTWKTTasaavsllrlllhmldlsHNNFSGNIPDQISQLTNLERMDLSKNHLSGEIPVSLKRLHFLSAFNVAENNLRGSIPSGGQFDTFPSSSFRGNPDLCGAIVQRSCSVQPRPIVLPDS
*********TMPKLKLLHIIIIILSCFSSFCQACNQIDQDSLLSLGFNISSPGLNWSSSTDCCLWEGIKCDANGRVSHLWLPWKGLTGTISLSIGNLTHLSHLNLSHNRLSGEFPSSLSSNYIKIIDLSSNHFQGKIPSTIFRLTQNLITFNVSNNSFTGLISWSAWVDSFCSIRHLDLSNNRFTGPVPLGLGSCSRLKTFRAGFNYLTGSLPDDIYTATSLEQLSLSFNHISGSIKNGIVNLTSLRILELYSNSLTGLIPRDIGKLTNLESLVLHNNSLSGSLPSSLKNCINLTLLNLQSNFFEGDISVFNFSTLLKLRVLDLGSNLFTGSLPITLNSCKSLTAVNLARNQLEGQISPGIVALKSLSFLSLSNNSLTNITGAIRILMGCKNLKVLIIPLNFMDETMPDNDRLTSANGFKNLQVLGLAECKLKGQVPSWIGKLKKLQVLDLSFNQLTGSVPRFLGNMSSLFHIDFSNNLISGEFPKEFCRLPAL***********SYLEFSLFKGSNNFIGEYKKILTFHEQYTWKTTASAAVSLLRLLLHMLDLSHNNFSGNIPDQISQLTNLE***L**NHLSGEIPVSLKRLHFLSAFNVAENNLR*********************DLCGAIVQRSC************
************KLKLLHIIIIILSCFSSFCQACNQIDQDSLLSLGFNIS*****WS**TDCCLWEGIKCDANGRVSHLWLPWKGLTGTISLSIGNLTHLSHLNLSHNRLSGEFPSSLSSNYIKIIDLSSNHFQGKIPSTIFRLTQNLITFNVSNNSFTGLISWSAWVDSFCSIRHLDLSNNRFTGPVPLGLGSCSRLKTFRAGFNYLTGSLPDDIYTATSLEQLSLSFNHISGSIKNGIVNLTSLRILELYSNSLTGLIPRDIGKLTNLESLVLHNNSLSGSLPSSLKNCINLTLLNLQSNFFEGDISVFNFSTLLKLRVLDLGSNLFTGSLPITLNSCKSLTAVNLARNQLEGQISPGIVALKSLSFLSLSNNSLTNITGAIRILMGCKNLKVLIIPLNFMDETMPDNDRLTSANGFKNLQVLGLAECKLKGQVPSWIGKLKKLQVLDLSFNQLTGSVPRFLGNMSSLFHIDFSNNLISGEFPKEFCRLPALTPEQDK*KANESYLEFSLFKGSNNFIGEYKKILTF***************LLRLLLHMLDLSHNNFSGNIPDQISQLTNLERMDLSKNHLSGEIPVSLKRLHFLSAFNVAENNLRGSIPSGGQFDTFPSSSFRGNPDLCGAI*****************
********KTMPKLKLLHIIIIILSCFSSFCQACNQIDQDSLLSLGFNISSPGLNWSSSTDCCLWEGIKCDANGRVSHLWLPWKGLTGTISLSIGNLTHLSHLNLSHNRLSGEFPSSLSSNYIKIIDLSSNHFQGKIPSTIFRLTQNLITFNVSNNSFTGLISWSAWVDSFCSIRHLDLSNNRFTGPVPLGLGSCSRLKTFRAGFNYLTGSLPDDIYTATSLEQLSLSFNHISGSIKNGIVNLTSLRILELYSNSLTGLIPRDIGKLTNLESLVLHNNSLSGSLPSSLKNCINLTLLNLQSNFFEGDISVFNFSTLLKLRVLDLGSNLFTGSLPITLNSCKSLTAVNLARNQLEGQISPGIVALKSLSFLSLSNNSLTNITGAIRILMGCKNLKVLIIPLNFMDETMPDNDRLTSANGFKNLQVLGLAECKLKGQVPSWIGKLKKLQVLDLSFNQLTGSVPRFLGNMSSLFHIDFSNNLISGEFPKEFCRLPALTPEQDKNKANESYLEFSLFKGSNNFIGEYKKILTFHEQYTWKTTASAAVSLLRLLLHMLDLSHNNFSGNIPDQISQLTNLERMDLSKNHLSGEIPVSLKRLHFLSAFNVAENNLRGSIPSGGQFDTFPSSSFRGNPDLCGAIVQRSCSVQPRPIVLPDS
*CCFTQQRKTMPKLKLLHIIIIILSCFSSFCQACNQIDQDSLLSLGFNISSPGLNWSSSTDCCLWEGIKCDANGRVSHLWLPWKGLTGTISLSIGNLTHLSHLNLSHNRLSGEFPSSLSSNYIKIIDLSSNHFQGKIPSTIFRLTQNLITFNVSNNSFTGLISWSAWVDSFCSIRHLDLSNNRFTGPVPLGLGSCSRLKTFRAGFNYLTGSLPDDIYTATSLEQLSLSFNHISGSIKNGIVNLTSLRILELYSNSLTGLIPRDIGKLTNLESLVLHNNSLSGSLPSSLKNCINLTLLNLQSNFFEGDISVFNFSTLLKLRVLDLGSNLFTGSLPITLNSCKSLTAVNLARNQLEGQISPGIVALKSLSFLSLSNNSLTNITGAIRILMGCKNLKVLIIPLNFMDETMPDNDRLTSANGFKNLQVLGLAECKLKGQVPSWIGKLKKLQVLDLSFNQLTGSVPRFLGNMSSLFHIDFSNNLISGEFPKEFCRLPALTPEQDKNKANESYLEFSLFKGSNNFIGEYKKILTFHEQYTWKTTASAAVSLLRLLLHMLDLSHNNFSGNIPDQISQLTNLERMDLSKNHLSGEIPVSLKRLHFLSAFNVAENNLRGSIPSGGQFDTFPSSSFRGNPDLCGAIVQR**************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCCFTQQRKTMPKLKLLHIIIIILSCFSSFCQACNQIDQDSLLSLGFNISSPGLNWSSSTDCCLWEGIKCDANGRVSHLWLPWKGLTGTISLSIGNLTHLSHLNLSHNRLSGEFPSSLSSNYIKIIDLSSNHFQGKIPSTIFRLTQNLITFNVSNNSFTGLISWSAWVDSFCSIRHLDLSNNRFTGPVPLGLGSCSRLKTFRAGFNYLTGSLPDDIYTATSLEQLSLSFNHISGSIKNGIVNLTSLRILELYSNSLTGLIPRDIGKLTNLESLVLHNNSLSGSLPSSLKNCINLTLLNLQSNFFEGDISVFNFSTLLKLRVLDLGSNLFTGSLPITLNSCKSLTAVNLARNQLEGQISPGIVALKSLSFLSLSNNSLTNITGAIRILMGCKNLKVLIIPLNFMDETMPDNDRLTSANGFKNLQVLGLAECKLKGQVPSWIGKLKKLQVLDLSFNQLTGSVPRFLGNMSSLFHIDFSNNLISGEFPKEFCRLPALTPEQDKNKANESYLEFSLFKGSNNFIGEYKKILTFHEQYTWKTTASAAVSLLRLLLHMLDLSHNNFSGNIPDQISQLTNLERMDLSKNHLSGEIPVSLKRLHFLSAFNVAENNLRGSIPSGGQFDTFPSSSFRGNPDLCGAIVQRSCSVQPRPIVLPDS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query653 2.2.26 [Sep-21-2011]
Q9C7S5 1095 Tyrosine-sulfated glycope yes no 0.975 0.581 0.443 1e-150
Q9SHI3729 Receptor-like protein 2 O no no 0.946 0.847 0.446 1e-143
Q9FN37 1036 Phytosulfokine receptor 2 no no 0.928 0.584 0.402 1e-105
Q9ZVR7 1008 Phytosulfokine receptor 1 no no 0.920 0.596 0.392 5e-98
Q8LPB4 1021 Phytosulfokine receptor 1 N/A no 0.938 0.600 0.385 2e-97
C0LGQ5 1249 LRR receptor-like serine/ no no 0.848 0.443 0.321 5e-66
Q9FL28 1173 LRR receptor-like serine/ no no 0.736 0.410 0.335 4e-64
Q8VZG8 1045 Probable LRR receptor-lik no no 0.940 0.587 0.305 1e-62
O49318 1124 Probable leucine-rich rep no no 0.820 0.476 0.319 4e-60
Q9LVP0 1102 Probable leucine-rich rep no no 0.830 0.491 0.320 7e-60
>sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1 OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1 Back     alignment and function desciption
 Score =  533 bits (1373), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 304/686 (44%), Positives = 418/686 (60%), Gaps = 49/686 (7%)

Query: 4   FTQQRKTMPKLKLLHIIIIILSC---FSSFCQA-CNQIDQDSLLSLGFNISSP--GLNWS 57
           F +Q K +    +L +++ +LS    F +  +A CN  D+DSLL    N+SSP   L+W+
Sbjct: 14  FVRQVKPLSPHMVLFVLLYVLSISVFFLTVSEAVCNLQDRDSLLWFSGNVSSPVSPLHWN 73

Query: 58  SSTDCCLWEGIKCDA--NGRVSHLWLPWKGLTGTISLSIGNLTHLSHLNLSHNRLSGEFP 115
           SS DCC WEGI CD     RV+ + L  +GL+G +  S+ +L  LS L+LSHNRLSG  P
Sbjct: 74  SSIDCCSWEGISCDKSPENRVTSIILSSRGLSGNLPSSVLDLQRLSRLDLSHNRLSGPLP 133

Query: 116 SSLSS--NYIKIIDLSSNHFQGKIP--------------------------------STI 141
               S  + + ++DLS N F+G++P                                S  
Sbjct: 134 PGFLSALDQLLVLDLSYNSFKGELPLQQSFGNGSNGIFPIQTVDLSSNLLEGEILSSSVF 193

Query: 142 FRLTQNLITFNVSNNSFTGLISWSAWVDSFCSIRHLDLSNNRFTGPVPLGLGSCSRLKTF 201
            +   NL +FNVSNNSFTG I  S    +   +  LD S N F+G +   L  CSRL   
Sbjct: 194 LQGAFNLTSFNVSNNSFTGSIP-SFMCTASPQLTKLDFSYNDFSGDLSQELSRCSRLSVL 252

Query: 202 RAGFNYLTGSLPDDIYTATSLEQLSLSFNHISGSIKNGIVNLTSLRILELYSNSLTGLIP 261
           RAGFN L+G +P +IY    LEQL L  N +SG I NGI  LT L +LELYSN + G IP
Sbjct: 253 RAGFNNLSGEIPKEIYNLPELEQLFLPVNRLSGKIDNGITRLTKLTLLELYSNHIEGEIP 312

Query: 262 RDIGKLTNLESLVLHNNSLSGSLPSSLKNCINLTLLNLQSNFFEGDISVFNFSTLLKLRV 321
           +DIGKL+ L SL LH N+L GS+P SL NC  L  LNL+ N   G +S  +FS    L +
Sbjct: 313 KDIGKLSKLSSLQLHVNNLMGSIPVSLANCTKLVKLNLRVNQLGGTLSAIDFSRFQSLSI 372

Query: 322 LDLGSNLFTGSLPITLNSCKSLTAVNLARNQLEGQISPGIVALKSLSFLSLSNNSLTNIT 381
           LDLG+N FTG  P T+ SCK +TA+  A N+L GQISP ++ L+SLSF + S+N +TN+T
Sbjct: 373 LDLGNNSFTGEFPSTVYSCKMMTAMRFAGNKLTGQISPQVLELESLSFFTFSDNKMTNLT 432

Query: 382 GAIRILMGCKNLKVLIIPLNFMDETMPDNDRLTSANGFKNLQVLGLAECKLKGQVPSWIG 441
           GA+ IL GCK L  LI+  NF DET+P N     ++GF +LQ+ G+  C+L G++P+W+ 
Sbjct: 433 GALSILQGCKKLSTLIMAKNFYDETVPSNKDFLRSDGFPSLQIFGIGACRLTGEIPAWLI 492

Query: 442 KLKKLQVLDLSFNQLTGSVPRFLGNMSSLFHIDFSNNLISGEFPKEFCRLPALTPEQDKN 501
           KL++++V+DLS N+  G++P +LG +  LF++D S+N ++GE PKE  +L AL  ++  +
Sbjct: 493 KLQRVEVMDLSMNRFVGTIPGWLGTLPDLFYLDLSDNFLTGELPKELFQLRALMSQKAYD 552

Query: 502 KANESYLEFSLFKGSNNFI--GEYKKILTFHEQYTWKT---TASAAVSLLRL-LLHMLDL 555
               +YLE  +F   NN     +Y ++ +       K    T +  V + +L +LH+L+L
Sbjct: 553 ATERNYLELPVFVNPNNVTTNQQYNQLSSLPPTIYIKRNNLTGTIPVEVGQLKVLHILEL 612

Query: 556 SHNNFSGNIPDQISQLTNLERMDLSKNHLSGEIPVSLKRLHFLSAFNVAENNLRGSIPSG 615
             NNFSG+IPD++S LTNLER+DLS N+LSG IP SL  LHFLS FNVA N L G IP+G
Sbjct: 613 LGNNFSGSIPDELSNLTNLERLDLSNNNLSGRIPWSLTGLHFLSYFNVANNTLSGPIPTG 672

Query: 616 GQFDTFPSSSFRGNPDLCGAIVQRSC 641
            QFDTFP ++F GNP LCG ++  SC
Sbjct: 673 TQFDTFPKANFEGNPLLCGGVLLTSC 698




Tyrosine-sulfated glycopeptide receptor with a serine/threonine-protein kinase activity. Regulates, in response to tyrosine-sulfated glycopeptide binding, a signaling cascade involved in cellular proliferation and plant growth. Not involved in PSK perception.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9SHI3|RLP2_ARATH Receptor-like protein 2 OS=Arabidopsis thaliana GN=RLP2 PE=2 SV=1 Back     alignment and function description
>sp|Q9FN37|PSKR2_ARATH Phytosulfokine receptor 2 OS=Arabidopsis thaliana GN=PSKR2 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4 Back     alignment and function description
>sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query653
359482434 1280 PREDICTED: tyrosine-sulfated glycopeptid 0.934 0.476 0.559 0.0
255537393 1087 Leucine-rich repeat receptor protein kin 0.917 0.551 0.540 0.0
147832546 1188 hypothetical protein VITISV_009907 [Viti 0.897 0.493 0.529 1e-174
224074123 1050 predicted protein [Populus trichocarpa] 0.943 0.586 0.541 1e-173
356504209 1076 PREDICTED: tyrosine-sulfated glycopeptid 0.967 0.587 0.508 1e-171
219718185 1085 receptor kinase [Gossypium barbadense] 0.935 0.563 0.518 1e-170
224138536 1092 predicted protein [Populus trichocarpa] 0.941 0.563 0.526 1e-168
449436222 1095 PREDICTED: tyrosine-sulfated glycopeptid 0.898 0.536 0.524 1e-166
356520190 1103 PREDICTED: tyrosine-sulfated glycopeptid 0.958 0.567 0.485 1e-166
358248614 1065 tyrosine-sulfated glycopeptide receptor 0.958 0.587 0.485 1e-165
>gi|359482434|ref|XP_002270860.2| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/651 (55%), Positives = 459/651 (70%), Gaps = 41/651 (6%)

Query: 32  QACNQIDQDSLLSLGFNISSPG---LNWSSSTDCCLWEGIKCDANGRVSHLWLPWKGLTG 88
           QAC+ +D+ SLLS   +ISSP    LNWSS  DCCLWEGI C   GRV+HL LP +GL+G
Sbjct: 250 QACHHLDRASLLSFSRDISSPPSAPLNWSS-FDCCLWEGITC-YEGRVTHLRLPLRGLSG 307

Query: 89  TISLSIGNLTHLSHLNLSHN----------------------RLSGEFPSSLSSN----- 121
            +S S+ NLT LSHLNLS N                      RLSGE P SLS +     
Sbjct: 308 GVSPSLANLTLLSHLNLSRNSFSGSVPLELFSSLEILDVSFNRLSGELPLSLSQSPNNSG 367

Query: 122 -YIKIIDLSSNHFQGKIPSTIFRLTQNLITFNVSNNSFTGLISWSAWVDSFCSIRHLDLS 180
             ++ IDLSSNHF G I S+  +L +NL  FNVSNNSFT  I      +S   +R +D S
Sbjct: 368 VSLQTIDLSSNHFYGVIQSSFLQLARNLTNFNVSNNSFTDSIPSDICRNSPL-VRLMDFS 426

Query: 181 NNRFTGPVPLGLGSCSRLKTFRAGFNYLTGSLPDDIYTATSLEQLSLSFNHISGSIKNGI 240
            N+F+G VPLGLG CS+L+  RAGFN L+G +P+DIY+A +L ++SL  N +SG I + I
Sbjct: 427 YNKFSGRVPLGLGDCSKLEVLRAGFNSLSGLIPEDIYSAAALREISLPVNSLSGPISDAI 486

Query: 241 VNLTSLRILELYSNSLTGLIPRDIGKLTNLESLVLHNNSLSGSLPSSLKNCINLTLLNLQ 300
           VNL++L +LELYSN L G +P+D+GKL  L+ L+LH N L+G LP+SL NC  LT LNL+
Sbjct: 487 VNLSNLTVLELYSNQLIGNLPKDMGKLFYLKRLLLHINKLTGPLPASLMNCTKLTTLNLR 546

Query: 301 SNFFEGDISVFNFSTLLKLRVLDLGSNLFTGSLPITLNSCKSLTAVNLARNQLEGQISPG 360
            N FEGDISV  FSTL +L  LDLG N FTG+LP++L SCKSLTAV LA N+LEGQI P 
Sbjct: 547 VNLFEGDISVIKFSTLQELSTLDLGDNNFTGNLPVSLYSCKSLTAVRLANNRLEGQILPD 606

Query: 361 IVALKSLSFLSLSNNSLTNITGAIRILMGCKNLKVLIIPLNFMDETMPDNDRLTSANGFK 420
           I+AL+SLSFLS+S N+LTNITGAIR+LMGC+NL  +I+  NF +E +PD+D +  +NGF+
Sbjct: 607 ILALQSLSFLSISKNNLTNITGAIRMLMGCRNLSTVILTQNFFNERLPDDDSILDSNGFQ 666

Query: 421 NLQVLGLAECKLKGQVPSWIGKLKKLQVLDLSFNQLTGSVPRFLGNMSSLFHIDFSNNLI 480
            LQVLGL  C+  GQVP+W+ KL KL+VLDLS NQ+TGS+P +LG + SLF+ID S+NLI
Sbjct: 667 RLQVLGLGGCRFTGQVPTWLAKLSKLEVLDLSLNQITGSIPGWLGTLPSLFYIDLSSNLI 726

Query: 481 SGEFPKEFCRLPALTPEQDKNKANESYLEFSLFKGSNNFIG-EYKKILTFHEQYTWKTTA 539
           SGEFPKE  RLP LT E+   + ++SYLE  +F   NN    +YK++         +  +
Sbjct: 727 SGEFPKEIIRLPRLTSEEAATEVDQSYLELPVFVMPNNATNLQYKQLSNLPPAIYLRNNS 786

Query: 540 -----SAAVSLLRLLLHMLDLSHNNFSGNIPDQISQLTNLERMDLSKNHLSGEIPVSLKR 594
                   +  L+  +H+LDLS+NNFSG+IPDQIS LTNLE++DLS NHLSGEIP SL+ 
Sbjct: 787 LSGNIPTEIGQLK-FIHILDLSYNNFSGSIPDQISNLTNLEKLDLSGNHLSGEIPGSLRS 845

Query: 595 LHFLSAFNVAENNLRGSIPSGGQFDTFPSSSFRGNPDLCGAIVQRSCSVQP 645
           LHFLS+FNVA N+L G+IPSGGQFDTFP+SSF GNP LCG  +QRSCS QP
Sbjct: 846 LHFLSSFNVANNSLEGAIPSGGQFDTFPNSSFEGNPGLCGPPLQRSCSNQP 896




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255537393|ref|XP_002509763.1| Leucine-rich repeat receptor protein kinase EXS precursor, putative [Ricinus communis] gi|223549662|gb|EEF51150.1| Leucine-rich repeat receptor protein kinase EXS precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147832546|emb|CAN68301.1| hypothetical protein VITISV_009907 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224074123|ref|XP_002304261.1| predicted protein [Populus trichocarpa] gi|222841693|gb|EEE79240.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356504209|ref|XP_003520891.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Glycine max] Back     alignment and taxonomy information
>gi|219718185|gb|ACL35341.1| receptor kinase [Gossypium barbadense] Back     alignment and taxonomy information
>gi|224138536|ref|XP_002326627.1| predicted protein [Populus trichocarpa] gi|222833949|gb|EEE72426.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449436222|ref|XP_004135892.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Cucumis sativus] gi|449491098|ref|XP_004158799.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356520190|ref|XP_003528747.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Glycine max] Back     alignment and taxonomy information
>gi|358248614|ref|NP_001239911.1| tyrosine-sulfated glycopeptide receptor 1-like precursor [Glycine max] gi|223452476|gb|ACM89565.1| leucine-rich repeat receptor-like kinase [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query653
TAIR|locus:2020382756 RLP3 "AT1G17250" [Arabidopsis 0.800 0.691 0.451 5.8e-114
TAIR|locus:2207056 1095 PSY1R "PSY1 receptor" [Arabido 0.793 0.473 0.444 2.2e-112
TAIR|locus:2020402729 RLP2 "AT1G17240" [Arabidopsis 0.788 0.706 0.447 2.6e-109
TAIR|locus:2051628 1008 PSKR1 "phytosulfokin receptor 0.868 0.562 0.374 3.2e-88
TAIR|locus:2154709 1036 PSKR2 "phytosylfokine-alpha re 0.773 0.487 0.371 1.6e-79
TAIR|locus:2102499 964 AT3G56370 [Arabidopsis thalian 0.621 0.421 0.309 1.4e-63
TAIR|locus:2085949 1141 AT3G24240 [Arabidopsis thalian 0.773 0.442 0.307 6.4e-58
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.681 0.391 0.303 1.9e-57
TAIR|locus:2182870 1192 EMS1 "EXCESS MICROSPOROCYTES1" 0.764 0.418 0.277 9.8e-36
UNIPROTKB|P93194 1109 INRPK1 "Receptor-like protein 0.879 0.517 0.277 4.6e-55
TAIR|locus:2020382 RLP3 "AT1G17250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1124 (400.7 bits), Expect = 5.8e-114, P = 5.8e-114
 Identities = 240/532 (45%), Positives = 319/532 (59%)

Query:   123 IKIIDLSSNHFQGKI-PSTIFRL-TQNLITFNVSNNSFTGLISWSAWVDSFCSIRHLDLS 180
             I+I+DLSSN  QG+I PS+IF   T +LI+FNVS NSFTG I  S    S   +  LD S
Sbjct:   177 IRIVDLSSNFLQGEILPSSIFMQGTFDLISFNVSKNSFTGSIP-SFMCKSSPQLSKLDFS 235

Query:   181 NNRFTGPVPLGLGSCSRLKTFRAGFNYLTGSLPDDIYTATSLEQLSLSFNHISGSIKNGI 240
              N FTG +P GLG C +L   +AGFN ++G +P DIY  + LEQL L  NH+SG I + I
Sbjct:   236 YNDFTGNIPQGLGRCLKLSVLQAGFNNISGEIPSDIYNLSELEQLFLPVNHLSGKINDDI 295

Query:   241 VNLTSLRILELYSNSLTGLIPRDIGKLTNLESLVLHNNXXXXXXXXXXKNCINLTLLNLQ 300
              +LT L+ LELYSN L G IP DIG+L+ L+SL LH N           NC NL  LNL+
Sbjct:   296 THLTKLKSLELYSNHLGGEIPMDIGQLSRLQSLQLHINNITGTVPPSLANCTNLVKLNLR 355

Query:   301 SNFFEGDISVFNFSTLLKLRVLDLGSNLFTGSLPITLNSCKSLTAVNLARNQLEGQISPG 360
              N  EG +S  +FS    L +LDLG+N F+G  P  ++SCKSL+A+  A N+L GQISP 
Sbjct:   356 LNRLEGTLSELDFSRFQSLSILDLGNNSFSGDFPWRVHSCKSLSAMRFASNKLTGQISPH 415

Query:   361 IVAXXXXXXXXXXXXXXTNITGAIRILMGCKNLKVLIIPLNFMDETMPDNDRLTSANGFK 420
             ++                NITGA+ IL GC+NL  L+I  NF +ET P +  L S++GF 
Sbjct:   416 VLELESLSILSLSDNKLMNITGALGILQGCRNLSTLLIGKNFYNETFPSDKDLISSDGFP 475

Query:   421 NLQVLGLAECKLKGQVPSWIGKLKKLQVLDLSFNQLTGSVPRFLGNMSSLFHIDFSNNLI 480
             NLQ+       L+G++P+W+ KLK L V+DLS NQL GS+P +LG    LF+ID S NL+
Sbjct:   476 NLQIFASGGSGLRGEIPAWLIKLKSLAVIDLSHNQLVGSIPGWLGTFPHLFYIDLSENLL 535

Query:   481 SGEFPKEFCRLPALTPEQDKNKANESYLEFSLFKGSNNFIG--EYKKILTFHEQ-YTWKT 537
             SGE PK+  +L AL  ++  +    +YL+  +F   NN     +Y ++ +     Y  + 
Sbjct:   536 SGELPKDLFQLKALMSQKAYDATERNYLKLPVFVSPNNVTTHQQYNQLFSLPPGIYIRRN 595

Query:   538 TXXXXX---XXXXXXXXXXXXXHNNFSGNIPDQISQLTNLERMDLSKNHLSGEIPVSLKR 594
                                   HN  SG IP ++S+LT+LER+DLS NHLSG IP SL  
Sbjct:   596 NLKGSIPIEVGQLKVLHVLELSHNYLSGIIPHELSKLTSLERLDLSNNHLSGRIPWSLTS 655

Query:   595 LHFLSAFNVAENNLRGSIPSGGQFDTFPSSSFRGNPDLCGAIVQRSCSVQPR 646
             LH++S FNV  N+L G IP+G QFDTFP ++F+GNP LCG I+  SC    +
Sbjct:   656 LHYMSYFNVVNNSLDGPIPTGSQFDTFPQANFKGNPLLCGGILLTSCKASTK 707


GO:0004672 "protein kinase activity" evidence=ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2207056 PSY1R "PSY1 receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020402 RLP2 "AT1G17240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051628 PSKR1 "phytosulfokin receptor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154709 PSKR2 "phytosylfokine-alpha receptor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102499 AT3G56370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182870 EMS1 "EXCESS MICROSPOROCYTES1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P93194 INRPK1 "Receptor-like protein kinase" [Ipomoea nil (taxid:35883)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00033978001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (1078 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query653
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-81
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-04
PLN032101153 PLN03210, PLN03210, Resistant to P 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  275 bits (704), Expect = 8e-81
 Identities = 211/649 (32%), Positives = 327/649 (50%), Gaps = 85/649 (13%)

Query: 19  IIIIILSCFSSFCQACNQIDQDSLLSLGFNISSPG---LNWSSSTDCCLWEGIKCDANGR 75
           I ++     +       +++   LLS   +I+ P     NW+SS D CLW+GI C+ + R
Sbjct: 13  IFMLFFLFLNFSMLHAEELEL--LLSFKSSINDPLKYLSNWNSSADVCLWQGITCNNSSR 70

Query: 76  VSHLWLPWKGLTGTISLSIGNLTHLSHLNLSHNRLSGEFPSSL--SSNYIKIIDLSSNHF 133
           V  + L  K ++G IS +I  L ++  +NLS+N+LSG  P  +  +S+ ++ ++LS+N+F
Sbjct: 71  VVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNF 130

Query: 134 QGKIPSTIFRLTQNLITFNVSNNSFTGLISWSAWVDSFCSIRHLDL-------------- 179
            G IP        NL T ++SNN  +G I     + SF S++ LDL              
Sbjct: 131 TGSIPRGSI---PNLETLDLSNNMLSGEIP--NDIGSFSSLKVLDLGGNVLVGKIPNSLT 185

Query: 180 ----------SNNRFTGPVPLGLGSCSRLKTFRAGFNYLTGSLPDDIYTATSLEQLSLSF 229
                     ++N+  G +P  LG    LK    G+N L+G +P +I   TSL  L L +
Sbjct: 186 NLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVY 245

Query: 230 NHISGSIKNGIVNLTSLRILELYSNSLTGLIPRDIGKLTNLESLVLHNNSLSGSLPSSLK 289
           N+++G I + + NL +L+ L LY N L+G IP  I  L  L SL L +NSLSG +P  + 
Sbjct: 246 NNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVI 305

Query: 290 NCINLTLLNLQSNFFEGDISVFNFSTLLKLRVLDLGSNLFTGSLPITLNSCKSLTAVNLA 349
              NL +L+L SN F G I V   ++L +L+VL L SN F+G +P  L    +LT ++L+
Sbjct: 306 QLQNLEILHLFSNNFTGKIPV-ALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLS 364

Query: 350 RNQLEGQISPGIVALKSLSFLSLSNNSLTNITGAI-RILMGCKNLKVLIIPLNFMDETMP 408
            N L G+I  G+ +  +L  L L +NSL    G I + L  C++L+ + +  N     +P
Sbjct: 365 TNNLTGEIPEGLCSSGNLFKLILFSNSLE---GEIPKSLGACRSLRRVRLQDNSFSGELP 421

Query: 409 DNDRLTSANGFKNLQV---LGLAECKLKGQVPSWIGKLKKLQVLDLSFNQLTGSVPRFLG 465
                   + F  L +   L ++   L+G++ S    +  LQ+L L+ N+  G +P   G
Sbjct: 422 --------SEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFG 473

Query: 466 NMSSLFHIDFSNNLISGEFPKEFCRLPALTPEQDKNKANESYLEFSLFKGSNNFIGEYKK 525
           +   L ++D S N  SG  P++   L  L             ++  L +  N   GE   
Sbjct: 474 S-KRLENLDLSRNQFSGAVPRKLGSLSEL-------------MQLKLSE--NKLSGEIPD 517

Query: 526 ILTFHEQYTWKTTASAAVSLLRLLLHMLDLSHNNFSGNIPDQISQLTNLERMDLSKNHLS 585
            L+  ++                 L  LDLSHN  SG IP   S++  L ++DLS+N LS
Sbjct: 518 ELSSCKK-----------------LVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLS 560

Query: 586 GEIPVSLKRLHFLSAFNVAENNLRGSIPSGGQFDTFPSSSFRGNPDLCG 634
           GEIP +L  +  L   N++ N+L GS+PS G F    +S+  GN DLCG
Sbjct: 561 GEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCG 609


Length = 968

>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 653
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
PLN032101153 Resistant to P. syringae 6; Provisional 99.92
KOG4237498 consensus Extracellular matrix protein slit, conta 99.9
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
KOG0617264 consensus Ras suppressor protein (contains leucine 99.63
PLN03150623 hypothetical protein; Provisional 99.61
PLN03150623 hypothetical protein; Provisional 99.35
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.29
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.19
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.16
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.13
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.12
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.12
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.12
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.12
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.05
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.01
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.96
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.96
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.93
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.89
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.86
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.85
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.84
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.7
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.67
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.52
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.49
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.43
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.36
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.33
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.31
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.3
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.22
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.11
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.9
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.88
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.88
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.81
PRK15386 426 type III secretion protein GogB; Provisional 97.78
KOG4341483 consensus F-box protein containing LRR [General fu 97.72
PRK15386 426 type III secretion protein GogB; Provisional 97.68
KOG4341483 consensus F-box protein containing LRR [General fu 97.68
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.65
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.47
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.43
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.09
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.05
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.7
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.52
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.51
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.42
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.31
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.12
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.05
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.55
KOG4308478 consensus LRR-containing protein [Function unknown 95.47
KOG4308478 consensus LRR-containing protein [Function unknown 93.39
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.76
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.31
smart0037026 LRR Leucine-rich repeats, outliers. 89.31
smart0037026 LRR Leucine-rich repeats, outliers. 88.97
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.97
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.93
KOG0473326 consensus Leucine-rich repeat protein [Function un 81.5
KOG0473326 consensus Leucine-rich repeat protein [Function un 81.4
KOG3864221 consensus Uncharacterized conserved protein [Funct 81.13
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.4e-71  Score=655.30  Aligned_cols=585  Identities=34%  Similarity=0.504  Sum_probs=521.2

Q ss_pred             CHHhHHHHHHhhhcCCCCC---CCCCCCCCCccccceEeCCCCCEEEEEcCCCCcceeccccccCCCCCCEEECCCCCCC
Q 041562           35 NQIDQDSLLSLGFNISSPG---LNWSSSTDCCLWEGIKCDANGRVSHLWLPWKGLTGTISLSIGNLTHLSHLNLSHNRLS  111 (653)
Q Consensus        35 ~~~~~~~ll~~k~~~~~~~---~~W~~~~~~c~w~gv~c~~~~~v~~L~L~~~~l~g~~~~~l~~l~~L~~L~Ls~n~~~  111 (653)
                      .++|++||++||+++.++.   .+|+.+.+||.|.||+|+..++|+.|+|++++++|.+++.+..+++|++|+|++|.+.
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~  106 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWNSSADVCLWQGITCNNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLS  106 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCCCCCCCCcCcceecCCCCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccC
Confidence            4689999999999997654   6898788999999999998889999999999999999999999999999999999999


Q ss_pred             CCCCcccc-C-CCcCEEEccCCCCCCCCchHHHhcCCCCcEEEccCCcCcccCChhhhhcCCCCCCEEEccCCcCccCCC
Q 041562          112 GEFPSSLS-S-NYIKIIDLSSNHFQGKIPSTIFRLTQNLITFNVSNNSFTGLISWSAWVDSFCSIRHLDLSNNRFTGPVP  189 (653)
Q Consensus       112 ~~~p~~~~-~-~~L~~L~Ls~n~l~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~  189 (653)
                      +.+|..+. . ++|++|+|++|+++|.+|..   .+++|++|++++|.+.+.+|..+.  .+++|++|++++|.+.+.+|
T Consensus       107 ~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~---~l~~L~~L~Ls~n~~~~~~p~~~~--~l~~L~~L~L~~n~l~~~~p  181 (968)
T PLN00113        107 GPIPDDIFTTSSSLRYLNLSNNNFTGSIPRG---SIPNLETLDLSNNMLSGEIPNDIG--SFSSLKVLDLGGNVLVGKIP  181 (968)
T ss_pred             CcCChHHhccCCCCCEEECcCCccccccCcc---ccCCCCEEECcCCcccccCChHHh--cCCCCCEEECccCcccccCC
Confidence            99998765 3 99999999999999999863   488999999999999998887765  79999999999999999999


Q ss_pred             ccCCCCCCCCEEEcccCCCCCCccccccCCCCCCEEeccCCcCcccccccccCCCCCcEEEcccCcCCcccCccccCCCC
Q 041562          190 LGLGSCSRLKTFRAGFNYLTGSLPDDIYTATSLEQLSLSFNHISGSIKNGIVNLTSLRILELYSNSLTGLIPRDIGKLTN  269 (653)
Q Consensus       190 ~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~i~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~  269 (653)
                      ..++++++|++|++++|.+.+.+|..+.++++|++|++++|.+.+.+|..++++++|++|++++|.+.+.+|..++++++
T Consensus       182 ~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~  261 (968)
T PLN00113        182 NSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKN  261 (968)
T ss_pred             hhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCeEEeecCcCcccCCccccCCCCCcEEEccCCcCccccChhhccCCCCcCEEEccCCcccccCCccCcCCCCCCeEEcc
Q 041562          270 LESLVLHNNSLSGSLPSSLKNCINLTLLNLQSNFFEGDISVFNFSTLLKLRVLDLGSNLFTGSLPITLNSCKSLTAVNLA  349 (653)
Q Consensus       270 L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~i~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~  349 (653)
                      |++|++++|.+.+.+|..+.++++|++|++++|.+.+.+|. .+..+++|+.|++++|.+.+..|..+..+++|+.|+++
T Consensus       262 L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~-~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~  340 (968)
T PLN00113        262 LQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPE-LVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLW  340 (968)
T ss_pred             CCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCCh-hHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECc
Confidence            99999999999999999999999999999999999988885 78899999999999999999999999999999999999


Q ss_pred             CccccccCchhhcCCCCCCEEECCCCCCCCCCcchhhccCCCCCcEEECCCCCCCccCCCcccccCCCCCCCcCEEEccC
Q 041562          350 RNQLEGQISPGIVALKSLSFLSLSNNSLTNITGAIRILMGCKNLKVLIIPLNFMDETMPDNDRLTSANGFKNLQVLGLAE  429 (653)
Q Consensus       350 ~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~~~~~L~~L~L~~  429 (653)
                      +|.+.+.+|..++.+++|+.|++++|+++...  ...+..+++|+.++++.|.+.+.+|...     ..+++|+.|++++
T Consensus       341 ~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~--p~~~~~~~~L~~L~l~~n~l~~~~p~~~-----~~~~~L~~L~L~~  413 (968)
T PLN00113        341 SNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEI--PEGLCSSGNLFKLILFSNSLEGEIPKSL-----GACRSLRRVRLQD  413 (968)
T ss_pred             CCCCcCcCChHHhCCCCCcEEECCCCeeEeeC--ChhHhCcCCCCEEECcCCEecccCCHHH-----hCCCCCCEEECcC
Confidence            99999999999999999999999999987422  2345677899999999999988887644     3678999999999


Q ss_pred             CcCcccchhhhcCCccCCeeeCcCCcCccCCchhhcCCCCCCEEEccCCcCcccCCccccCCCCCCcccccccccccccc
Q 041562          430 CKLKGQVPSWIGKLKKLQVLDLSFNQLTGSVPRFLGNMSSLFHIDFSNNLISGEFPKEFCRLPALTPEQDKNKANESYLE  509 (653)
Q Consensus       430 n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~l~~~~~~~~~~~~  509 (653)
                      |.+++.+|..+..++.|+.|++++|++.+.+|..+..+++|++|++++|++.+.+|..+ ..+.|+.++++++......+
T Consensus       414 n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~  492 (968)
T PLN00113        414 NSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVP  492 (968)
T ss_pred             CEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccC
Confidence            99999999999999999999999999999999888899999999999999998888765 35778888877654332211


Q ss_pred             cccccCCccccccccccccccccc-ceeeeCChHHHhHHhccCeeecCCccCccccccccccCCCCCeEeCCCCeeeeec
Q 041562          510 FSLFKGSNNFIGEYKKILTFHEQY-TWKTTASAAVSLLRLLLHMLDLSHNNFSGNIPDQISQLTNLERMDLSKNHLSGEI  588 (653)
Q Consensus       510 ~~~~~~~~~~~~~~~~~~~~~~~~-~l~g~ip~~l~~l~~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~LdLs~N~l~~~i  588 (653)
                      .. +.       ....+..+.... .+.+.+|..++.++ +|++|+|++|.+++.+|..|+.+++|++|||++|+++|.+
T Consensus       493 ~~-~~-------~l~~L~~L~Ls~N~l~~~~p~~~~~l~-~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~  563 (968)
T PLN00113        493 RK-LG-------SLSELMQLKLSENKLSGEIPDELSSCK-KLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEI  563 (968)
T ss_pred             hh-hh-------hhhccCEEECcCCcceeeCChHHcCcc-CCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccC
Confidence            10 00       011111222221 26788999999999 9999999999999999999999999999999999999999


Q ss_pred             CcccccCCCCCeeecCCCcccccCCCCCCCCCcCCCccCCCCCCCCCCC---CCCCC
Q 041562          589 PVSLKRLHFLSAFNVAENNLRGSIPSGGQFDTFPSSSFRGNPDLCGAIV---QRSCS  642 (653)
Q Consensus       589 p~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gn~~lc~~~~---~~~c~  642 (653)
                      |..+..+++|++|++++|+++|.+|..++|.++.+.+|.||+++||.+.   .++|.
T Consensus       564 p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~~~~~~~~c~  620 (968)
T PLN00113        564 PKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGDTTSGLPPCK  620 (968)
T ss_pred             ChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCccccCCCCCc
Confidence            9999999999999999999999999999999999999999999998653   24674



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query653
3rgx_A768 Structural Insight Into Brassinosteroid Perception 4e-36
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-36
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-13
1ogq_A 313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-06
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 8e-06
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 149 bits (377), Expect = 4e-36, Method: Compositional matrix adjust. Identities = 158/575 (27%), Positives = 241/575 (41%), Gaps = 111/575 (19%) Query: 112 GEFPSSLSS-NYIKIIDLSSNHFQGKIPSTIFRLTQNLITFNVSNNSFTGLISWSAWVDS 170 G+F ++S+ +K++++SSN F G IP + Q L +++ N FTG I ++ Sbjct: 237 GDFSRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYL---SLAENKFTGEIP--DFLSG 291 Query: 171 FC-SIRHLDLSNNRFTGPVPLGLGSCSRLKTFRAGFNYLTGSLP-DDIYTATSLEQLSLS 228 C ++ LDLS N F G VP GSCS L++ N +G LP D + L+ L LS Sbjct: 292 ACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLS 351 Query: 229 FNHISGSIKNGIVNLT-SLRILELYSNSLTGLIPRDIGK--LTNLESLVLHNNXXXXXXX 285 FN SG + + NL+ SL L+L SN+ +G I ++ + L+ L L NN Sbjct: 352 FNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIP 411 Query: 286 XXXKNCINLTLLNLQSNFFEGDISVFNFSTLLKLRVLDLGSNLFTGSLPITLNSCKSLTA 345 NC L L+L N+ +G++P +L S L Sbjct: 412 PTLSNCSELVSLHLSFNYL-------------------------SGTIPSSLGSLSKLRD 446 Query: 346 VNLARNQLEGQISPGIVAXXXXXXXXXXXXXXTNITGAIRILMGCKNLKVLIIPLNFMDE 405 + L N LEG+I + LM K L+ LI+ N + Sbjct: 447 LKLWLNMLEGEIP--------------------------QELMYVKTLETLILDFNDLTG 480 Query: 406 TMPDNDRLTSANGFKNLQVLGLAECKLKGQVPSWIGKLKKLQVLDLSFNQLTGSVPRFLG 465 +P + + NL + L+ +L G++P WIG+L+ L +L LS N +G++P LG Sbjct: 481 EIP-----SGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELG 535 Query: 466 NMSSLFHIDFSNNLISGEFPKEFCRLPALTPEQDKNKANESYLEFSLFK----GSNNFIG 521 + SL +D + NL +G P + Y++ K G+ N + Sbjct: 536 DCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLL- 594 Query: 522 EYKKILTFHEQYTWKTTX-------------XXXXXXXXXXXXXXXXXHNNFSGNIPDQI 568 E++ I + EQ +T +N SG IP +I Sbjct: 595 EFQGIRS--EQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEI 652 Query: 569 ------------------------SQLTNLERMDLSKNHLSGEIPVSLKRLHFLSAFNVA 604 L L +DLS N L G IP ++ L L+ +++ Sbjct: 653 GSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLS 712 Query: 605 ENNLRGSIPSGGQFDTFPSSSFRGNPDLCGAIVQR 639 NNL G IP GQF+TFP + F NP LCG + R Sbjct: 713 NNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPR 747
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query653
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-115
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-95
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-19
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-76
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-73
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-70
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-64
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-63
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-46
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-76
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-60
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-44
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-41
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-74
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-38
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-69
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-56
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-46
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-44
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-17
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-62
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-61
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-55
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-52
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-48
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-35
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-56
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-54
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-54
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-54
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-52
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-50
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-43
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-43
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-43
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-40
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-22
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 7e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-43
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-42
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-40
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-38
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-29
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-18
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-36
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-27
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-39
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-38
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-37
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-35
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-25
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-37
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-34
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-24
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-36
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-36
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-31
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-21
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-34
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-33
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-30
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-22
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-33
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-30
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-25
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-19
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-32
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-25
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-31
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-29
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-26
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-21
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-29
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-28
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-24
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-23
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-26
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-25
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-23
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-20
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-23
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-20
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-19
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-19
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-15
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-14
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-15
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-13
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-12
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-11
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 5e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-12
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 8e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 6e-05
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  360 bits (926), Expect = e-115
 Identities = 166/595 (27%), Positives = 259/595 (43%), Gaps = 76/595 (12%)

Query: 77  SHLWLPWKGLTGTISLSIGNLTHLSHLNLSHNRLSGEFPSSLSSNY-IKIIDLSSNHFQG 135
             L +     +  I   +G+ + L HL++S N+LSG+F  ++S+   +K++++SSN F G
Sbjct: 203 EFLDVSSNNFSTGIP-FLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVG 261

Query: 136 KIPSTIFRLTQNLITFNVSNNSFTGLISWSAWVDSFCSIRHLDLSNNRFTGPVPLGLGSC 195
            IP       ++L   +++ N FTG I       +  ++  LDLS N F G VP   GSC
Sbjct: 262 PIPPLPL---KSLQYLSLAENKFTGEIP-DFLSGACDTLTGLDLSGNHFYGAVPPFFGSC 317

Query: 196 SRLKTFRAGFNYLTGSLPDD-IYTATSLEQLSLSFNHISGSIKNGIVNLT-SLRILELYS 253
           S L++     N  +G LP D +     L+ L LSFN  SG +   + NL+ SL  L+L S
Sbjct: 318 SLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSS 377

Query: 254 NSLTGLIPRDIGK--LTNLESLVLHNNSLSGSLPSSLKNCINLTLLNLQSNFFEGDISVF 311
           N+ +G I  ++ +     L+ L L NN  +G +P +L NC  L  L+L  N+  G I   
Sbjct: 378 NNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPS- 436

Query: 312 NFSTLLKLRVLDLGSNLFTGSLPITLNSCKSLTAVNLARNQLEGQISPGIVALKSLSFLS 371
           +  +L KLR L L  N+  G +P  L   K+L  + L  N L G+I  G+    +L+++S
Sbjct: 437 SLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWIS 496

Query: 372 LSNNSLTNITGAIRILMGCKNLKVLIIPLNFMDETMPDNDRLTSANGFKNLQVLGLAECK 431
           LSNN    +TG I   +G                              +NL +L L+   
Sbjct: 497 LSNN---RLTGEIPKWIG----------------------------RLENLAILKLSNNS 525

Query: 432 LKGQVPSWIGKLKKLQVLDLSFNQLTGSVPRFLGNMSSLFHIDFSNNLISGEFPKEFCRL 491
             G +P+ +G  + L  LDL+ N   G++P  +   S       + N I+G+        
Sbjct: 526 FSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSG----KIAANFIAGKRYVYIKND 581

Query: 492 PALTPEQDKNKANESYLEFSLFKGSNNFIGEYKKILTFHEQYTWKTTASAAVSLLRLLLH 551
                       N    +    +  N         +T      +    S        +  
Sbjct: 582 GMKKECHGAG--NLLEFQGIRSEQLNRLSTRNPCNITSR---VYGGHTSPTFDNNGSM-M 635

Query: 552 MLDLSHNNFSGNIPDQISQLTNLERMDLSKNHLSGEIPVSLKRLHFLSAFNVAENNLRGS 611
            LD+S+N  SG IP +I  +  L  ++L  N +SG IP  +  L  L+  +++ N L G 
Sbjct: 636 FLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGR 695

Query: 612 I------------------------PSGGQFDTFPSSSFRGNPDLCGAIVQRSCS 642
           I                        P  GQF+TFP + F  NP LCG  + R   
Sbjct: 696 IPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDP 750


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query653
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.95
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.73
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.57
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.56
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.54
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.46
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.44
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.43
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.42
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.41
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.38
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.35
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.32
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.3
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.24
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.23
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.21
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.16
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.12
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.92
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.92
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.89
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.82
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.59
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.53
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.33
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.3
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.9
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.86
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.2
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.92
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.62
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.45
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.3e-82  Score=729.55  Aligned_cols=604  Identities=30%  Similarity=0.448  Sum_probs=460.8

Q ss_pred             ccCCcCCHHhHHHHHHhhhcCCCCC--CCCCCCCCCccccceEeCCCCCEEEEEcCCCCccee---cc------------
Q 041562           29 SFCQACNQIDQDSLLSLGFNISSPG--LNWSSSTDCCLWEGIKCDANGRVSHLWLPWKGLTGT---IS------------   91 (653)
Q Consensus        29 ~~~~~~~~~~~~~ll~~k~~~~~~~--~~W~~~~~~c~w~gv~c~~~~~v~~L~L~~~~l~g~---~~------------   91 (653)
                      ++++++.++|++||++||+++.++.  ++|+.++|||+|+||+|+ .|||++|+|+++++.|.   ++            
T Consensus         4 ~~~~~~~~~~~~all~~k~~~~~~~~l~~W~~~~~~C~w~gv~C~-~~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~l   82 (768)
T 3rgz_A            4 ASPSQSLYREIHQLISFKDVLPDKNLLPDWSSNKNPCTFDGVTCR-DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESL   82 (768)
T ss_dssp             ----CCHHHHHHHHHHHHTTCSCTTSSTTCCTTSCGGGSTTEEEE-TTEEEEEECTTSCCCEEHHHHHHHTTTCTTCCEE
T ss_pred             CccccCCHHHHHHHHHHHhhCCCcccccCCCCCCCCcCCcceEEC-CCcEEEEECCCCCcCCccCccChhHhccCccccc
Confidence            3444557889999999999998775  799888899999999998 79999999999999987   44            


Q ss_pred             -----------ccccCCCCCCEEECCCCCCCCCCCc--cccC-CCcCEEEccCCCCCCCCchHHHhcCCCCcEEEccCCc
Q 041562           92 -----------LSIGNLTHLSHLNLSHNRLSGEFPS--SLSS-NYIKIIDLSSNHFQGKIPSTIFRLTQNLITFNVSNNS  157 (653)
Q Consensus        92 -----------~~l~~l~~L~~L~Ls~n~~~~~~p~--~~~~-~~L~~L~Ls~n~l~~~ip~~~~~~l~~L~~L~Ls~n~  157 (653)
                                 +.++++++|++|||++|.++|.+|.  .++. ++|++|+|++|.+.+.+|..++..+++|++|++++|.
T Consensus        83 ~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~  162 (768)
T 3rgz_A           83 FLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANS  162 (768)
T ss_dssp             ECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSC
T ss_pred             CCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCc
Confidence                       4678889999999999999888887  6666 8888888888888877777655567777777777777


Q ss_pred             CcccCChhhh-h----------------------cCCCCCCEEEccCCcCccCCCccCCCCCCCCEEEcccCCCCCCccc
Q 041562          158 FTGLISWSAW-V----------------------DSFCSIRHLDLSNNRFTGPVPLGLGSCSRLKTFRAGFNYLTGSLPD  214 (653)
Q Consensus       158 l~~~~~~~~~-~----------------------~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~  214 (653)
                      +++..+..+. .                      ..+++|++|++++|.+++.+|. ++++++|++|++++|.+++.+|.
T Consensus       163 l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~  241 (768)
T 3rgz_A          163 ISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSR  241 (768)
T ss_dssp             CEEETHHHHHHTTCCTTCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHH
T ss_pred             cCCcCChhhhhhccCCCCCEEECCCCcccccCCcccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccH
Confidence            7665554310 1                      2456677777777777766665 77777777777777777777777


Q ss_pred             cccCCCCCCEEeccCCcCcccccccccCCCCCcEEEcccCcCCcccCccccCC-CCCCeEEeecCcCcccCCccccCCCC
Q 041562          215 DIYTATSLEQLSLSFNHISGSIKNGIVNLTSLRILELYSNSLTGLIPRDIGKL-TNLESLVLHNNSLSGSLPSSLKNCIN  293 (653)
Q Consensus       215 ~l~~l~~L~~L~Ls~n~i~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l-~~L~~L~L~~n~l~~~~p~~l~~l~~  293 (653)
                      .+..+++|++|++++|.+.+.+|..  .+++|++|++++|++++.+|..+... ++|++|++++|.+++.+|..++++++
T Consensus       242 ~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~  319 (768)
T 3rgz_A          242 AISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSL  319 (768)
T ss_dssp             HTTTCSSCCEEECCSSCCEESCCCC--CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTT
T ss_pred             HHhcCCCCCEEECCCCcccCccCcc--ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCC
Confidence            7777777777777777776655543  56667777777777766777766654 77888888888877777777777888


Q ss_pred             CcEEEccCCcCccccChhhccCCCCcCEEEccCCcccccCCccCcC---------------------------CCCCCeE
Q 041562          294 LTLLNLQSNFFEGDISVFNFSTLLKLRVLDLGSNLFTGSLPITLNS---------------------------CKSLTAV  346 (653)
Q Consensus       294 L~~L~L~~n~l~~~i~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~---------------------------l~~L~~L  346 (653)
                      |++|++++|.+.|.+|...+..+++|++|++++|.+++.+|..+..                           +++|++|
T Consensus       320 L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L  399 (768)
T 3rgz_A          320 LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQEL  399 (768)
T ss_dssp             CCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEE
T ss_pred             ccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEE
Confidence            8888888887777777655777777777777777776655555443                           3455666


Q ss_pred             EccCccccccCchhhcCCCCCCEEECCCCCCCCCCcchhhccCCCCCcEEECCCCCCCccCCCcccccCCCCCCCcCEEE
Q 041562          347 NLARNQLEGQISPGIVALKSLSFLSLSNNSLTNITGAIRILMGCKNLKVLIIPLNFMDETMPDNDRLTSANGFKNLQVLG  426 (653)
Q Consensus       347 ~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~~~~~L~~L~  426 (653)
                      ++++|.+++.+|..+..+++|++|++++|.++....  ..+..+++|+.|++++|.+.+.+|..+.     .+++|++|+
T Consensus       400 ~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p--~~l~~l~~L~~L~L~~n~l~~~~p~~~~-----~l~~L~~L~  472 (768)
T 3rgz_A          400 YLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIP--SSLGSLSKLRDLKLWLNMLEGEIPQELM-----YVKTLETLI  472 (768)
T ss_dssp             ECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCC--GGGGGCTTCCEEECCSSCCCSCCCGGGG-----GCTTCCEEE
T ss_pred             ECCCCccccccCHHHhcCCCCCEEECcCCcccCccc--HHHhcCCCCCEEECCCCcccCcCCHHHc-----CCCCceEEE
Confidence            666666666666666777777777777776653221  3456677788888888887777765443     578888889


Q ss_pred             ccCCcCcccchhhhcCCccCCeeeCcCCcCccCCchhhcCCCCCCEEEccCCcCcccCCccccCCCCCCccccccccccc
Q 041562          427 LAECKLKGQVPSWIGKLKKLQVLDLSFNQLTGSVPRFLGNMSSLFHIDFSNNLISGEFPKEFCRLPALTPEQDKNKANES  506 (653)
Q Consensus       427 L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~l~~~~~~~~~  506 (653)
                      +++|++++.+|..+.++++|++|++++|++++.+|.+++.+++|++|++++|+++|.+|..+..+++|+.+++.++....
T Consensus       473 L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g  552 (768)
T 3rgz_A          473 LDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNG  552 (768)
T ss_dssp             CCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEES
T ss_pred             ecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCC
Confidence            99998888888888888899999999999888888888888899999999999988888888888888888887665432


Q ss_pred             ccccccccCCcc------------------------------------------------ccc--------------ccc
Q 041562          507 YLEFSLFKGSNN------------------------------------------------FIG--------------EYK  524 (653)
Q Consensus       507 ~~~~~~~~~~~~------------------------------------------------~~~--------------~~~  524 (653)
                      .++...+.....                                                ...              ...
T Consensus       553 ~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~  632 (768)
T 3rgz_A          553 TIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNG  632 (768)
T ss_dssp             BCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSB
T ss_pred             cCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccc
Confidence            222111110000                                                000              001


Q ss_pred             ccccccccc-ceeeeCChHHHhHHhccCeeecCCccCccccccccccCCCCCeEeCCCCeeeeecCcccccCCCCCeeec
Q 041562          525 KILTFHEQY-TWKTTASAAVSLLRLLLHMLDLSHNNFSGNIPDQISQLTNLERMDLSKNHLSGEIPVSLKRLHFLSAFNV  603 (653)
Q Consensus       525 ~~~~~~~~~-~l~g~ip~~l~~l~~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~LdLs~N~l~~~ip~~l~~l~~L~~L~l  603 (653)
                      .+..++.+. .++|.+|.+++.++ .|+.|||++|+++|.+|..|+++++|++||||+|+++|.+|..+..+++|++||+
T Consensus       633 ~L~~LdLs~N~l~g~ip~~l~~l~-~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~l  711 (768)
T 3rgz_A          633 SMMFLDMSYNMLSGYIPKEIGSMP-YLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDL  711 (768)
T ss_dssp             CCCEEECCSSCCBSCCCGGGGGCT-TCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEEC
T ss_pred             cccEEECcCCcccccCCHHHhccc-cCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEEC
Confidence            111122221 27899999999999 9999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcccccCCCCCCCCCcCCCccCCCCCCCCCCCCCCCCCCC
Q 041562          604 AENNLRGSIPSGGQFDTFPSSSFRGNPDLCGAIVQRSCSVQP  645 (653)
Q Consensus       604 s~N~l~g~iP~~~~~~~~~~~~~~gn~~lc~~~~~~~c~~~~  645 (653)
                      ++|+++|.||++++|.+|+..+|.|||+|||+|+. +|....
T Consensus       712 s~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~~  752 (768)
T 3rgz_A          712 SNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDPSN  752 (768)
T ss_dssp             CSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCSCC
T ss_pred             cCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCCCc
Confidence            99999999999999999999999999999999985 897543



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 653
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-20
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-18
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-16
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 8e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.003
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 90.2 bits (222), Expect = 2e-20
 Identities = 69/320 (21%), Positives = 123/320 (38%), Gaps = 19/320 (5%)

Query: 32  QACNQIDQDSLLSLGFNISSPGL--NWSSSTDCC--LWEGIKCDANG---RVSHLWLPWK 84
           + CN  D+ +LL +  ++ +P    +W  +TDCC   W G+ CD +    RV++L L   
Sbjct: 1   ELCNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGL 60

Query: 85  GLTGTISL--SIGNLTHLSHLNLS--HNRLSGEFPSSLSSNYIKIIDLSSNHFQGKIPST 140
            L     +  S+ NL +L+ L +   +N +    P+      +  + ++  +  G IP  
Sbjct: 61  NLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDF 120

Query: 141 IFRLTQNLITFNVSNNSFTGLISWSAWVDSFCSIRHLDLSNNRFTGPVPLGLGSCSRLKT 200
           + ++   +      N       +    + S  ++  +    NR +G +P   GS S+L T
Sbjct: 121 LSQIKTLVTLDFSYNALS---GTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFT 177

Query: 201 FRAGFNYLTGSLPDDIYTATSLEQLSLSFNHISGSIKNGIVNLTSLRILELYSNSLTGLI 260
                           +   +L  + LS N + G       +  +       + +     
Sbjct: 178 SMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKN-TQKIHLAKNSLAFD 236

Query: 261 PRDIGKLTNLESLVLHNNSLSGSLPSSLKNCINLTLLNLQSNFFEGDISVFNFSTLLKLR 320
              +G   NL  L L NN + G+LP  L     L  LN+  N   G+I       L +  
Sbjct: 237 LGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP--QGGNLQRFD 294

Query: 321 VLDLGSNLFTGSLPITLNSC 340
           V    +N      P  L +C
Sbjct: 295 VSAYANNKCLCGSP--LPAC 312


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query653
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.98
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.83
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.79
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.67
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.63
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.45
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.21
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.21
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.17
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.17
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.28
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.15
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.54
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.53
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.87
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.83
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=1.7e-41  Score=344.68  Aligned_cols=289  Identities=27%  Similarity=0.442  Sum_probs=183.3

Q ss_pred             cCCHHhHHHHHHhhhcCCCCC--CCCCCCCCCc--cccceEeCC---CCCEEEEEcCCCCcce--eccccccCCCCCCEE
Q 041562           33 ACNQIDQDSLLSLGFNISSPG--LNWSSSTDCC--LWEGIKCDA---NGRVSHLWLPWKGLTG--TISLSIGNLTHLSHL  103 (653)
Q Consensus        33 ~~~~~~~~~ll~~k~~~~~~~--~~W~~~~~~c--~w~gv~c~~---~~~v~~L~L~~~~l~g--~~~~~l~~l~~L~~L  103 (653)
                      -|.++||+||++||+++.++.  ++|..++|||  .|+||+|+.   .+||++|+|++++++|  .+|+++++|++|++|
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L   81 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFL   81 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCGGGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTCSEE
T ss_pred             CCCHHHHHHHHHHHHHCCCCCcCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChHHhcCcccccc
Confidence            499999999999999998877  8998889999  499999985   3489999999999988  588999999999999


Q ss_pred             ECCC-CCCCCCCCccccC-CCcCEEEccCCCCCCCCchHHHhcCCCCcEEEccCCcCcccCChhhhhcCCCCCCEEEccC
Q 041562          104 NLSH-NRLSGEFPSSLSS-NYIKIIDLSSNHFQGKIPSTIFRLTQNLITFNVSNNSFTGLISWSAWVDSFCSIRHLDLSN  181 (653)
Q Consensus       104 ~Ls~-n~~~~~~p~~~~~-~~L~~L~Ls~n~l~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~l~~L~~L~Ls~  181 (653)
                      +|++ |+++|.+|..++. ++|++|+|++|++.+..+. .+..+.+|+++++++|.+.+.                    
T Consensus        82 ~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~-~~~~~~~L~~l~l~~N~~~~~--------------------  140 (313)
T d1ogqa_          82 YIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPD-FLSQIKTLVTLDFSYNALSGT--------------------  140 (313)
T ss_dssp             EEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCG-GGGGCTTCCEEECCSSEEESC--------------------
T ss_pred             ccccccccccccccccccccccchhhhccccccccccc-cccchhhhccccccccccccc--------------------
Confidence            9986 7888888877666 6666666666666643333 233355555555555555444                    


Q ss_pred             CcCccCCCccCCCCCCCCEEEcccCCCCCCccccccCCCCC-CEEeccCCcCcccccccccCCCCCcEEEcccCcCCccc
Q 041562          182 NRFTGPVPLGLGSCSRLKTFRAGFNYLTGSLPDDIYTATSL-EQLSLSFNHISGSIKNGIVNLTSLRILELYSNSLTGLI  260 (653)
Q Consensus       182 n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L-~~L~Ls~n~i~~~~~~~l~~l~~L~~L~L~~n~l~~~~  260 (653)
                            +|..+.++++++++++++|.+.+.+|..+..+..+ +.+++++|++++..|..+..+..+ +++++.+...+.+
T Consensus       141 ------~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~  213 (313)
T d1ogqa_         141 ------LPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDA  213 (313)
T ss_dssp             ------CCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECC
T ss_pred             ------CchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccc-ccccccccccccc
Confidence                  44444445555555555555544455444444443 445555555555555444444332 4555555555555


Q ss_pred             CccccCCCCCCeEEeecCcCcccCCccccCCCCCcEEEccCCcCccccChhhccCCCCcCEEEccCCcccccCCccCcCC
Q 041562          261 PRDIGKLTNLESLVLHNNSLSGSLPSSLKNCINLTLLNLQSNFFEGDISVFNFSTLLKLRVLDLGSNLFTGSLPITLNSC  340 (653)
Q Consensus       261 p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~i~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l  340 (653)
                      |..++.+++++.+++++|.+.+.+| .+..+++|+.|++++|+++|.+|. .++.+++|++|+|++|+++|.+|. ++++
T Consensus       214 ~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~-~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L  290 (313)
T d1ogqa_         214 SVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQ-GLTQLKFLHSLNVSFNNLCGEIPQ-GGNL  290 (313)
T ss_dssp             GGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCG-GGGGCTTCCEEECCSSEEEEECCC-STTG
T ss_pred             ccccccccccccccccccccccccc-ccccccccccccCccCeecccCCh-HHhCCCCCCEEECcCCcccccCCC-cccC
Confidence            5555555555555555555554333 345555555555555555555553 455555555555555555555553 3455


Q ss_pred             CCCCeEEccCcc
Q 041562          341 KSLTAVNLARNQ  352 (653)
Q Consensus       341 ~~L~~L~L~~n~  352 (653)
                      ++|+.+++++|+
T Consensus       291 ~~L~~l~l~~N~  302 (313)
T d1ogqa_         291 QRFDVSAYANNK  302 (313)
T ss_dssp             GGSCGGGTCSSS
T ss_pred             CCCCHHHhCCCc
Confidence            555556666554



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure