Citrus Sinensis ID: 041569
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 285 | ||||||
| 255590973 | 337 | conserved hypothetical protein [Ricinus | 0.712 | 0.602 | 0.312 | 4e-24 | |
| 356557323 | 833 | PREDICTED: uncharacterized protein LOC10 | 0.733 | 0.250 | 0.298 | 6e-21 | |
| 147810265 | 310 | hypothetical protein VITISV_027852 [Viti | 0.736 | 0.677 | 0.323 | 8e-21 | |
| 224121624 | 528 | predicted protein [Populus trichocarpa] | 0.747 | 0.403 | 0.306 | 9e-21 | |
| 225442254 | 520 | PREDICTED: putative F-box protein At3g44 | 0.736 | 0.403 | 0.323 | 1e-20 | |
| 297743071 | 552 | unnamed protein product [Vitis vinifera] | 0.736 | 0.380 | 0.323 | 1e-20 | |
| 147833276 | 521 | hypothetical protein VITISV_011919 [Viti | 0.750 | 0.410 | 0.311 | 8e-19 | |
| 449476919 | 575 | PREDICTED: uncharacterized protein LOC10 | 0.715 | 0.354 | 0.326 | 1e-17 | |
| 449458245 | 575 | PREDICTED: uncharacterized protein LOC10 | 0.715 | 0.354 | 0.326 | 1e-17 | |
| 357454739 | 607 | F-box/FBD/LRR-repeat protein [Medicago t | 0.726 | 0.341 | 0.297 | 3e-15 |
| >gi|255590973|ref|XP_002535407.1| conserved hypothetical protein [Ricinus communis] gi|223523200|gb|EEF26976.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 117 bits (294), Expect = 4e-24, Method: Compositional matrix adjust.
Identities = 80/256 (31%), Positives = 134/256 (52%), Gaps = 53/256 (20%)
Query: 3 ETVDQISDLPPSIIHHIMTYLS-AKEVTRTSILSTSWNQFQNSFPILDFDLMNF-----I 56
+++D IS LP +IHHI++ L K+ RTSILS W S+ ILDFD F
Sbjct: 67 DSIDLISQLPNHVIHHILSLLRCKKDAARTSILSKRWRAIWASYLILDFDQRKFQKQEKK 126
Query: 57 VR-----------IEI--------------------------KLRIYVCPLDVEGSSPLF 79
VR +EI K ++++ +VE S+ +
Sbjct: 127 VRRLSSKSKKRKEVEINKKNEMFRAFVENTLRTHIEQDSGIQKFKLHLTSYNVELSAHV- 185
Query: 80 DKWIELATENGLEVLDFMVIADENTYYALPQTIFSAKLLTSLKLVGCKLELPSFTC---- 135
D+WI AT N ++ LD + + ++ Y LPQT+F+A +T+L++ GCKL TC
Sbjct: 186 DQWIGFATTNNIKDLDLYIPSKKDRCYNLPQTVFAASTITALRISGCKLR----TCIDIK 241
Query: 136 -AHLKKLLLSEFPLNDRELHHLISKCPLLEDLSISHCHSLGRIMISSNKLEHLLISSCYG 194
++L+KL ++ ++ + + +L+ CPL++DL + +C L +++SSNKL + I C+G
Sbjct: 242 LSNLQKLCFAKLRVDGQMIQNLMLSCPLIDDLRLIYCTGLKTLLLSSNKLYRVDIHFCHG 301
Query: 195 LNALDVDAPRLLSFIF 210
L ++V +P L +F +
Sbjct: 302 LKNVEVLSPNLQTFWY 317
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356557323|ref|XP_003546966.1| PREDICTED: uncharacterized protein LOC100794867 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147810265|emb|CAN71448.1| hypothetical protein VITISV_027852 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224121624|ref|XP_002330747.1| predicted protein [Populus trichocarpa] gi|222872523|gb|EEF09654.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225442254|ref|XP_002275641.1| PREDICTED: putative F-box protein At3g44060 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297743071|emb|CBI35938.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147833276|emb|CAN68530.1| hypothetical protein VITISV_011919 [Vitis vinifera] gi|297743067|emb|CBI35934.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449476919|ref|XP_004154876.1| PREDICTED: uncharacterized protein LOC101224445 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449458245|ref|XP_004146858.1| PREDICTED: uncharacterized protein LOC101214024 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357454739|ref|XP_003597650.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] gi|355486698|gb|AES67901.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 285 | ||||||
| TAIR|locus:2151316 | 456 | AT5G02700 "AT5G02700" [Arabido | 0.764 | 0.478 | 0.279 | 1.1e-14 | |
| TAIR|locus:2088882 | 465 | AT3G28410 "AT3G28410" [Arabido | 0.775 | 0.475 | 0.272 | 6.8e-13 | |
| TAIR|locus:2010032 | 416 | AT1G13570 "AT1G13570" [Arabido | 0.442 | 0.302 | 0.293 | 1.4e-12 | |
| TAIR|locus:2037578 | 458 | AT1G78750 "AT1G78750" [Arabido | 0.694 | 0.432 | 0.268 | 8.5e-11 | |
| TAIR|locus:2157922 | 444 | AT5G53840 "AT5G53840" [Arabido | 0.561 | 0.360 | 0.292 | 1.9e-10 | |
| TAIR|locus:2081408 | 427 | AT3G44060 "AT3G44060" [Arabido | 0.652 | 0.435 | 0.269 | 2.4e-10 | |
| TAIR|locus:2099019 | 457 | AT3G58860 "AT3G58860" [Arabido | 0.522 | 0.326 | 0.283 | 3.2e-10 | |
| TAIR|locus:505006162 | 422 | AT1G32375 "AT1G32375" [Arabido | 0.680 | 0.459 | 0.246 | 5.4e-10 | |
| TAIR|locus:2201527 | 442 | AT1G66310 "AT1G66310" [Arabido | 0.189 | 0.122 | 0.407 | 2e-09 | |
| TAIR|locus:2175861 | 388 | AT5G60610 "AT5G60610" [Arabido | 0.575 | 0.422 | 0.312 | 2.1e-09 |
| TAIR|locus:2151316 AT5G02700 "AT5G02700" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 203 (76.5 bits), Expect = 1.1e-14, P = 1.1e-14
Identities = 69/247 (27%), Positives = 114/247 (46%)
Query: 6 DQISDLPPSIIHHIMTYLSAKEVTRTSILSTSWNQFQNSFPILDFDLMNFIVRIEIKLRI 65
D I+ +P I+HHI++++ RTS+LS W P LD L + + L
Sbjct: 27 DFINYMPDDILHHILSFIPTDLAMRTSVLSRRWRHVWCETPCLDITLKHGAMNQT--LTS 84
Query: 66 YVCPL--------DVEGSS-PLFDKWIELATENGLEVLDFMVIADENTY---YALPQTIF 113
Y P+ D+ ++ P D WIE A ++ L V + TY Y P +
Sbjct: 85 YTAPIITSFKLVMDLNSNTVPQVDSWIEFALSRNVQNLS--VFVRDFTYSKTYRFPDIFY 142
Query: 114 SAKLLTSLKLVGCKLE----LPSFTCA--HLKKLLLSEFPLNDRELHHLISKCPLLEDLS 167
L +SLKL+ L+ +P+ T + L+ L L + D +H+++S CP+LE L+
Sbjct: 143 ---LSSSLKLLDVTLDFFDMIPTCTVSWKSLRNLTLRFCQIPDESIHNILSGCPILESLT 199
Query: 168 ISHCHSLGRIMIS-SNKLEHLLISSCYGLNA-LDVDAPRL--LSFIFDLNPIPIISTNAL 223
+ C L R+ +S S L L I+ Y + + AP + L + P I+ ++L
Sbjct: 200 LDTCRLLERLDLSKSPNLRRLDINQQYRRTGPVAIVAPHIYYLRLTYSSTPSTIVDVSSL 259
Query: 224 CPWNVTL 230
N+T+
Sbjct: 260 SEANLTI 266
|
|
| TAIR|locus:2088882 AT3G28410 "AT3G28410" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2010032 AT1G13570 "AT1G13570" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2037578 AT1G78750 "AT1G78750" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2157922 AT5G53840 "AT5G53840" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2081408 AT3G44060 "AT3G44060" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2099019 AT3G58860 "AT3G58860" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:505006162 AT1G32375 "AT1G32375" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201527 AT1G66310 "AT1G66310" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175861 AT5G60610 "AT5G60610" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00034157001 | SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (520 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 285 | |||
| pfam00646 | 48 | pfam00646, F-box, F-box domain | 0.002 |
| >gnl|CDD|201368 pfam00646, F-box, F-box domain | Back alignment and domain information |
|---|
Score = 34.9 bits (81), Expect = 0.002
Identities = 12/47 (25%), Positives = 23/47 (48%)
Query: 6 DQISDLPPSIIHHIMTYLSAKEVTRTSILSTSWNQFQNSFPILDFDL 52
+ DLP ++ I++ L K++ R S++S W +S + L
Sbjct: 1 FSLLDLPDDLLLEILSRLDPKDLLRLSLVSKRWRSLVDSLKLWKKRL 47
|
This domain is approximately 50 amino acids long, and is usually found in the N-terminal half of a variety of proteins. Two motifs that are commonly found associated with the F-box domain are the leucine rich repeats (LRRs; pfam00560 and pfam07723) and the WD repeat (pfam00400). The F-box domain has a role in mediating protein-protein interactions in a variety of contexts, such as polyubiquitination, transcription elongation, centromere binding and translational repression. Length = 48 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 285 | |||
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.78 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.29 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 98.92 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.69 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.53 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.49 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.37 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.34 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.17 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.13 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.12 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 98.08 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.07 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 98.03 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.97 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.94 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.79 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.76 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.69 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 97.57 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.57 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 97.35 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 97.34 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.32 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 97.25 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.25 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.16 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.09 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 96.9 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 96.74 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 96.59 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 96.57 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 96.54 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 96.39 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.05 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 96.0 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 95.87 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 95.69 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 95.68 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 95.49 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.35 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 95.3 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.28 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 95.21 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 94.99 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 94.66 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 94.56 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 94.44 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 94.38 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 94.37 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 93.97 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 93.76 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 93.75 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 93.25 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 93.21 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 92.91 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 92.22 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 91.85 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 91.82 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 91.17 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 90.28 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 90.18 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 89.45 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 89.29 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 88.23 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 88.09 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 86.87 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 81.73 | |
| PF13013 | 109 | F-box-like_2: F-box-like domain | 81.59 |
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.78 E-value=8e-21 Score=156.33 Aligned_cols=200 Identities=21% Similarity=0.255 Sum_probs=144.2
Q ss_pred CCCCCHHHHHHHhcCCChhhHHhhhhcccchhhc------ccccceeeEecccccccccccccccccccccC-----CCh
Q 041569 8 ISDLPPSIIHHIMTYLSAKEVTRTSILSTSWNQF------QNSFPILDFDLMNFIVRIEIKLRIYVCPLDVE-----GSS 76 (285)
Q Consensus 8 ~~~LP~~il~~I~s~L~~~~~~~~~~vskrWr~l------w~~~~~l~~~~~~~~~~v~~~~~l~~~~~~~~-----~~~ 76 (285)
|..|||||+..||+.|+-+++.+++.|||||+++ |.. ++.......+.+- .+.+++-...++ .+.
T Consensus 98 ~~slpDEill~IFs~L~kk~LL~~~~VC~Rfyr~~~de~lW~~---lDl~~r~i~p~~l-~~l~~rgV~v~Rlar~~~~~ 173 (419)
T KOG2120|consen 98 WDSLPDEILLGIFSCLCKKELLKVSGVCKRFYRLASDESLWQT---LDLTGRNIHPDVL-GRLLSRGVIVFRLARSFMDQ 173 (419)
T ss_pred cccCCHHHHHHHHHhccHHHHHHHHHHHHHHhhccccccceee---eccCCCccChhHH-HHHHhCCeEEEEcchhhhcC
Confidence 8899999999999999999999999999999987 654 3444433333221 111111111111 011
Q ss_pred hHHHHHHHHHHHCCCceEEEEeeeCCCccccCCccccCcCCccEEEEcCeeecC----CCccccccceEEeeee-ecChH
Q 041569 77 PLFDKWIELATENGLEVLDFMVIADENTYYALPQTIFSAKLLTSLKLVGCKLEL----PSFTCAHLKKLLLSEF-PLNDR 151 (285)
Q Consensus 77 ~~~~~~l~~~~~~~l~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~L~~~~~~~----~~~~~~~L~~L~L~~~-~~~~~ 151 (285)
..+.... ..+..+++.++++. .......+...+..|..|+.|.|.|..+.+ -.+.-.+|+.|+|+.| .++..
T Consensus 174 prlae~~-~~frsRlq~lDLS~--s~it~stl~~iLs~C~kLk~lSlEg~~LdD~I~~~iAkN~~L~~lnlsm~sG~t~n 250 (419)
T KOG2120|consen 174 PRLAEHF-SPFRSRLQHLDLSN--SVITVSTLHGILSQCSKLKNLSLEGLRLDDPIVNTIAKNSNLVRLNLSMCSGFTEN 250 (419)
T ss_pred chhhhhh-hhhhhhhHHhhcch--hheeHHHHHHHHHHHHhhhhccccccccCcHHHHHHhccccceeeccccccccchh
Confidence 1111111 11345799999988 556667777788889999999999999877 2234688999999999 68999
Q ss_pred HHHHHHhCCCccceeeeecCCCcCeE---EEc--cCCcceEEEeecC------CCceEEEeCCCccEEEEeeCc
Q 041569 152 ELHHLISKCPLLEDLSISHCHSLGRI---MIS--SNKLEHLLISSCY------GLNALDVDAPRLLSFIFDLNP 214 (285)
Q Consensus 152 ~l~~l~~~cp~Le~L~l~~c~~~~~~---~i~--~~~L~~L~l~~~~------~~~~~~~~~p~L~~l~~~~~~ 214 (285)
++..+++.|..|..|++++|...+.. .|. +++|+.|++++|. ++..+...+|+|..|+++++.
T Consensus 251 ~~~ll~~scs~L~~LNlsWc~l~~~~Vtv~V~hise~l~~LNlsG~rrnl~~sh~~tL~~rcp~l~~LDLSD~v 324 (419)
T KOG2120|consen 251 ALQLLLSSCSRLDELNLSWCFLFTEKVTVAVAHISETLTQLNLSGYRRNLQKSHLSTLVRRCPNLVHLDLSDSV 324 (419)
T ss_pred HHHHHHHhhhhHhhcCchHhhccchhhhHHHhhhchhhhhhhhhhhHhhhhhhHHHHHHHhCCceeeecccccc
Confidence 99999999999999999999765533 122 2899999999998 334445578999999998875
|
|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF13013 F-box-like_2: F-box-like domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 285 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 1e-09 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 3e-06 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 6e-07 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 5e-05 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-06 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-05 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-04 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
Score = 56.8 bits (137), Expect = 1e-09
Identities = 34/201 (16%), Positives = 69/201 (34%), Gaps = 15/201 (7%)
Query: 8 ISDLPPSIIHHIMTYLSAKEVTRTSILSTSWNQFQNSFP---ILDFDLMNFIVRIEIKLR 64
LP ++ I + L E+ + S + W + + LD N + +L
Sbjct: 9 WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLL 68
Query: 65 IYVCPLDVEGSSPLFDKWIELATENGLEVLDFMVIADENTYYALPQTIFSAKLLTSLKLV 124
S + E + ++ +D L + L +L L
Sbjct: 69 SQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLS--NSVIEVSTLHGILSQCSKLQNLSLE 126
Query: 125 GCKLELPSFT----CAHLKKLLLSEFP-LNDRELHHLISKCPLLEDLSISHCHSLGRIMI 179
G +L P ++L +L LS ++ L L+S C L++L++S C
Sbjct: 127 GLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFD-----F 181
Query: 180 SSNKLEHLLISSCYGLNALDV 200
+ ++ + + L++
Sbjct: 182 TEKHVQVAVAHVSETITQLNL 202
|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 285 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.81 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.77 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.75 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.15 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.06 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 99.01 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.88 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.86 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.85 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.83 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.83 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.82 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.82 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.79 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.78 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.78 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.78 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.77 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.75 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.73 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.72 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.71 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.7 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.69 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.69 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.69 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.69 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.67 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.67 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.66 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.66 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.63 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.62 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.62 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.62 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.62 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.62 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.6 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.59 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.59 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.58 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.58 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.58 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.58 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.57 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.56 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.56 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.54 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.54 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.54 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.54 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.53 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.53 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.52 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.49 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.49 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.48 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.48 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.46 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.46 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.46 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.44 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.44 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.43 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.43 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.43 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.43 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.42 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.42 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.42 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.41 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.41 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.4 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.39 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.39 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.39 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.39 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.38 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.38 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.37 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.36 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.35 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.35 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.35 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.35 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.34 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.34 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.33 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.33 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.32 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.32 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.31 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.31 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.29 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.28 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.27 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.25 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.24 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.24 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.23 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.23 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.22 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.2 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.2 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 98.19 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 98.14 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.13 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.13 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.12 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.07 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.07 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.06 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.05 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.04 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.02 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.01 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 97.99 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.95 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.95 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.95 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 97.9 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.82 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.8 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.8 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.77 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.76 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.74 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.72 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.72 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.7 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 97.68 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 97.67 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.58 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.51 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.39 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.36 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.36 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.34 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.33 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.23 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.15 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.13 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.13 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.13 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.09 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.06 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 96.91 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 96.83 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 96.83 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 96.8 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 96.75 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 96.64 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 96.52 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 96.04 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 95.85 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 95.71 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 95.48 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 94.74 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 92.63 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 91.93 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 91.84 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 89.87 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
Probab=99.81 E-value=1.2e-20 Score=164.15 Aligned_cols=245 Identities=16% Similarity=0.190 Sum_probs=132.9
Q ss_pred CCCcCCCCCHHHHHHHhcCCChhhHHhhhhcccchhhcccc---cceeeEecccccccccc---ccccccccccc---CC
Q 041569 4 TVDQISDLPPSIIHHIMTYLSAKEVTRTSILSTSWNQFQNS---FPILDFDLMNFIVRIEI---KLRIYVCPLDV---EG 74 (285)
Q Consensus 4 ~~d~~~~LP~~il~~I~s~L~~~~~~~~~~vskrWr~lw~~---~~~l~~~~~~~~~~v~~---~~~l~~~~~~~---~~ 74 (285)
+...|+.||+|++.+||+||+.+|+++++.|||+|+.+... ...++++...+.+..-. ...++.+.... ..
T Consensus 5 ~~~~~~~LP~eil~~If~~L~~~d~~~~~~vc~~W~~~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~l~~L~l~~n~l~~ 84 (336)
T 2ast_B 5 PGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQ 84 (336)
T ss_dssp --CCSSSSCHHHHHHHHTTSCHHHHHHTTSSCHHHHHHHTCSTTSSEEECTTCBCCHHHHHHHHHTTCSEEECTTCEECS
T ss_pred ccCChhhCCHHHHHHHHHhCCHHHHHHHHHHHHHHHHHhcCchhheeeccccccCCHHHHHhhhhccceEEEcCCccccc
Confidence 44668999999999999999999999999999999998422 11233333221111000 00011110000 00
Q ss_pred ChhHHHHHHHHHHHCCCceEEEEeeeCCCccccCCccccCcCCccEEEEcCeeecC----CCccccccceEEeeee-ecC
Q 041569 75 SSPLFDKWIELATENGLEVLDFMVIADENTYYALPQTIFSAKLLTSLKLVGCKLEL----PSFTCAHLKKLLLSEF-PLN 149 (285)
Q Consensus 75 ~~~~~~~~l~~~~~~~l~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~L~~~~~~~----~~~~~~~L~~L~L~~~-~~~ 149 (285)
.... ....+++++++++. +......++..+..+++|++|++++|.+.. ....+++|++|++.++ .++
T Consensus 85 ~~~~------~~~~~~L~~L~L~~--~~l~~~~~~~~~~~~~~L~~L~L~~~~l~~~~~~~l~~~~~L~~L~L~~~~~l~ 156 (336)
T 2ast_B 85 PLAE------HFSPFRVQHMDLSN--SVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFS 156 (336)
T ss_dssp CCCS------CCCCBCCCEEECTT--CEECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHHHTTCTTCSEEECTTCBSCC
T ss_pred cchh------hccCCCCCEEEccC--CCcCHHHHHHHHhhCCCCCEEeCcCcccCHHHHHHHhcCCCCCEEECCCCCCCC
Confidence 0000 00113455555543 221222244445556777777777776543 1224677777777777 566
Q ss_pred hHHHHHHHhCCCccceeeeecCCCcCeEEEc-----cC-CcceEEEeecC-CCc-----eEEEeCCCccEEEEeeCc-Ee
Q 041569 150 DRELHHLISKCPLLEDLSISHCHSLGRIMIS-----SN-KLEHLLISSCY-GLN-----ALDVDAPRLLSFIFDLNP-IP 216 (285)
Q Consensus 150 ~~~l~~l~~~cp~Le~L~l~~c~~~~~~~i~-----~~-~L~~L~l~~~~-~~~-----~~~~~~p~L~~l~~~~~~-~~ 216 (285)
+..+..++..||+|++|++++|..++...+. .+ +|++|++.+|. .+. .....+|+|++|++.++. +.
T Consensus 157 ~~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~~L~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~l~ 236 (336)
T 2ast_B 157 EFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLK 236 (336)
T ss_dssp HHHHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCC
T ss_pred HHHHHHHHhcCCCCCEEcCCCCCCcChHHHHHHHHhcccCCCEEEeCCCcccCCHHHHHHHHhhCCCCCEEeCCCCCcCC
Confidence 6666666777777777777777444432111 15 77777777763 121 111246777777777665 21
Q ss_pred ------eecCCCcccceeccccCCCCChhhHHHHHHHhccCCCceEEEEEeC
Q 041569 217 ------IISTNALCPWNVTLDCDSNLDCDWFLSLKEFLGASSQIERLCIDFS 262 (285)
Q Consensus 217 ------~~~~~~L~~l~i~~~~~~~~~~~~~~~l~~~l~~~~~L~~L~L~~~ 262 (285)
+...++|+++++.... ....... ..+..+++|+.|+++..
T Consensus 237 ~~~~~~l~~l~~L~~L~l~~~~--~~~~~~~----~~l~~~~~L~~L~l~~~ 282 (336)
T 2ast_B 237 NDCFQEFFQLNYLQHLSLSRCY--DIIPETL----LELGEIPTLKTLQVFGI 282 (336)
T ss_dssp GGGGGGGGGCTTCCEEECTTCT--TCCGGGG----GGGGGCTTCCEEECTTS
T ss_pred HHHHHHHhCCCCCCEeeCCCCC--CCCHHHH----HHHhcCCCCCEEeccCc
Confidence 2233567766665432 1111110 23456778888777644
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 285 | ||||
| d2ovrb1 | 102 | a.158.1.1 (B:2263-2364) F-box/WD repeat-containing | 4e-04 | |
| d1nexb1 | 100 | a.158.1.1 (B:270-369) Cdc4 F-box and linker domain | 4e-04 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 0.003 |
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: F-box domain superfamily: F-box domain family: F-box domain domain: F-box/WD repeat-containing protein 7, FBXW7 species: Human (Homo sapiens) [TaxId: 9606]
Score = 37.0 bits (85), Expect = 4e-04
Identities = 8/36 (22%), Positives = 18/36 (50%)
Query: 6 DQISDLPPSIIHHIMTYLSAKEVTRTSILSTSWNQF 41
D IS LP + +++++L K++ + + W
Sbjct: 17 DFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRIL 52
|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 285 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.38 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 99.18 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.09 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.83 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.81 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 98.8 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.6 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.58 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.55 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.49 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.48 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.37 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.32 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.23 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.1 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.08 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.96 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.94 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.94 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.91 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.89 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.86 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.85 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.77 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.65 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.6 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.57 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.53 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 97.53 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.48 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.42 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 97.19 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 97.17 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 97.02 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.0 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 96.8 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 96.74 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 96.44 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.4 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 96.17 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.07 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 95.84 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 95.66 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 94.25 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 94.24 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 94.08 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.38 E-value=6.2e-15 Score=123.27 Aligned_cols=183 Identities=19% Similarity=0.189 Sum_probs=114.1
Q ss_pred CCceEEEEeeeCCCccccCCccccCcCCccEEEEcCeeecC----CCccccccceEEeeee-ecChHHHHHHHhCCCccc
Q 041569 90 GLEVLDFMVIADENTYYALPQTIFSAKLLTSLKLVGCKLEL----PSFTCAHLKKLLLSEF-PLNDRELHHLISKCPLLE 164 (285)
Q Consensus 90 ~l~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~L~~~~~~~----~~~~~~~L~~L~L~~~-~~~~~~l~~l~~~cp~Le 164 (285)
++++++++. +......+...+..|++|++|++++|.+.. ....+++|++|++++| .+++.++..++..||+|+
T Consensus 47 ~L~~LdLs~--~~i~~~~l~~l~~~c~~L~~L~L~~~~l~~~~~~~l~~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~ 124 (284)
T d2astb2 47 RVQHMDLSN--SVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLD 124 (284)
T ss_dssp CCCEEECTT--CEECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHHHTTCTTCSEEECTTCBSCCHHHHHHHHHHCTTCC
T ss_pred CCCEEECCC--CccCHHHHHHHHHhCCCcccccccccCCCcHHHHHHhcCCCCcCccccccccccccccchhhHHHHhcc
Confidence 466666554 322333344445568888888888887654 2235788888888887 568888888888888888
Q ss_pred eeeeecCCCcCeEEEc------cCCcceEEEeecC-CC-----ceEEEeCCCccEEEEeeCc-E------eeecCCCccc
Q 041569 165 DLSISHCHSLGRIMIS------SNKLEHLLISSCY-GL-----NALDVDAPRLLSFIFDLNP-I------PIISTNALCP 225 (285)
Q Consensus 165 ~L~l~~c~~~~~~~i~------~~~L~~L~l~~~~-~~-----~~~~~~~p~L~~l~~~~~~-~------~~~~~~~L~~ 225 (285)
+|++++|..++...+. +++|++|++.+|. .+ ..+.-.+|+|++|++.++. + .+...++|++
T Consensus 125 ~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~~~~~L~~ 204 (284)
T d2astb2 125 ELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQH 204 (284)
T ss_dssp EEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGGCTTCCE
T ss_pred ccccccccccccccchhhhcccccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhhcccCcCCE
Confidence 8888888766543221 2688888888764 12 1222357888888887754 2 1234467887
Q ss_pred ceecc-ccCCCCChhhHHHHHHHhccCCCceEEEEEeCCCccCCCchhhhhhhheeec
Q 041569 226 WNVTL-DCDSNLDCDWFLSLKEFLGASSQIERLCIDFSSVETNSEDATLHFLYKLRLW 282 (285)
Q Consensus 226 l~i~~-~~~~~~~~~~~~~l~~~l~~~~~L~~L~L~~~~~~~~~~~~~f~~L~~L~l~ 282 (285)
++++. ..+. +... ..++.+|+|+.|++.-. ........+...+++|++.
T Consensus 205 L~L~~C~~i~---~~~l----~~L~~~~~L~~L~l~~~-~~d~~l~~l~~~lp~L~i~ 254 (284)
T d2astb2 205 LSLSRCYDII---PETL----LELGEIPTLKTLQVFGI-VPDGTLQLLKEALPHLQIN 254 (284)
T ss_dssp EECTTCTTCC---GGGG----GGGGGCTTCCEEECTTS-SCTTCHHHHHHHSTTSEES
T ss_pred EECCCCCCCC---hHHH----HHHhcCCCCCEEeeeCC-CCHHHHHHHHHhCcccccc
Confidence 77764 2221 1111 23567888888887422 2222233344556666653
|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|