Citrus Sinensis ID: 041582
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 153 | ||||||
| 255547065 | 190 | DNA binding protein, putative [Ricinus c | 0.862 | 0.694 | 0.616 | 2e-34 | |
| 224133052 | 101 | predicted protein [Populus trichocarpa] | 0.653 | 0.990 | 0.66 | 7e-28 | |
| 15239443 | 206 | basic leucine-zipper 70 [Arabidopsis tha | 0.921 | 0.684 | 0.52 | 5e-26 | |
| 10176910 | 188 | unnamed protein product [Arabidopsis tha | 0.941 | 0.765 | 0.509 | 1e-25 | |
| 297793643 | 194 | bZIP transcription factor family protein | 0.901 | 0.711 | 0.5 | 3e-25 | |
| 297835658 | 187 | bZIP transcription factor family protein | 0.901 | 0.737 | 0.5 | 6e-25 | |
| 449439673 | 224 | PREDICTED: light-inducible protein CPRF3 | 0.614 | 0.419 | 0.595 | 3e-24 | |
| 255579930 | 195 | Ocs element-binding factor, putative [Ri | 0.751 | 0.589 | 0.508 | 7e-21 | |
| 53983008 | 176 | putative bZIPtranscription factor protei | 0.836 | 0.727 | 0.496 | 2e-20 | |
| 297789341 | 178 | hypothetical protein ARALYDRAFT_920430 [ | 0.647 | 0.556 | 0.584 | 3e-20 |
| >gi|255547065|ref|XP_002514590.1| DNA binding protein, putative [Ricinus communis] gi|223546194|gb|EEF47696.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 150 bits (378), Expect = 2e-34, Method: Compositional matrix adjust.
Identities = 82/133 (61%), Positives = 103/133 (77%), Gaps = 1/133 (0%)
Query: 15 FHVPVHIFSPNTSVSPRSGSALDEARETPASIINEKRLKRVISNRESARRSRMRKKKLIE 74
H P+HIFS NTS + + S+L++ +E++LKR+ISNRESARRSR+RKKK IE
Sbjct: 58 IHFPLHIFSTNTSPA-SADSSLNKTSNHQVGNSHERKLKRMISNRESARRSRIRKKKQIE 116
Query: 75 ELQAQVNHVQTVNHQLSEKLISLLESNHQIVQENSQLKEKVSSLQLVISDLLAPLRGLEE 134
EL QVNH++T+NHQLSEK+I LLE+N QI+QENSQLKE+VSSLQLV+SDLL P+R +EE
Sbjct: 117 ELDCQVNHLRTMNHQLSEKVIHLLENNQQILQENSQLKERVSSLQLVLSDLLIPMRNVEE 176
Query: 135 VNGNMNRPRAEAS 147
N NR R E S
Sbjct: 177 SICNPNRLRGETS 189
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224133052|ref|XP_002321470.1| predicted protein [Populus trichocarpa] gi|222868466|gb|EEF05597.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|15239443|ref|NP_200891.1| basic leucine-zipper 70 [Arabidopsis thaliana] gi|332010001|gb|AED97384.1| basic leucine-zipper 70 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|10176910|dbj|BAB10103.1| unnamed protein product [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297793643|ref|XP_002864706.1| bZIP transcription factor family protein [Arabidopsis lyrata subsp. lyrata] gi|297310541|gb|EFH40965.1| bZIP transcription factor family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|297835658|ref|XP_002885711.1| bZIP transcription factor family protein [Arabidopsis lyrata subsp. lyrata] gi|297331551|gb|EFH61970.1| bZIP transcription factor family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449439673|ref|XP_004137610.1| PREDICTED: light-inducible protein CPRF3-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255579930|ref|XP_002530800.1| Ocs element-binding factor, putative [Ricinus communis] gi|223529621|gb|EEF31568.1| Ocs element-binding factor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|53983008|gb|AAV25871.1| putative bZIPtranscription factor protein [Brassica oleracea] | Back alignment and taxonomy information |
|---|
| >gi|297789341|ref|XP_002862649.1| hypothetical protein ARALYDRAFT_920430 [Arabidopsis lyrata subsp. lyrata] gi|297308294|gb|EFH38907.1| hypothetical protein ARALYDRAFT_920430 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 153 | ||||||
| TAIR|locus:2159325 | 206 | bZIP70 "AT5G60830" [Arabidopsi | 0.928 | 0.689 | 0.516 | 1.6e-29 | |
| TAIR|locus:2092595 | 173 | bZIP42 "AT3G30530" [Arabidopsi | 0.816 | 0.722 | 0.470 | 1.2e-19 | |
| TAIR|locus:2166650 | 165 | bZIP43 "AT5G38800" [Arabidopsi | 0.647 | 0.6 | 0.494 | 1.5e-19 | |
| TAIR|locus:1005716856 | 137 | bZIP75 "AT5G08141" [Arabidopsi | 0.490 | 0.547 | 0.610 | 1.8e-16 | |
| TAIR|locus:2143191 | 186 | bZIP3 "AT5G15830" [Arabidopsis | 0.627 | 0.516 | 0.444 | 4.7e-16 | |
| TAIR|locus:2009932 | 196 | bZIP58 "AT1G13600" [Arabidopsi | 0.607 | 0.474 | 0.436 | 3.3e-15 | |
| TAIR|locus:2827461 | 166 | bZIP48 "AT2G04038" [Arabidopsi | 0.614 | 0.566 | 0.382 | 7.9e-14 | |
| TAIR|locus:2139584 | 159 | GBF6 "AT4G34590" [Arabidopsis | 0.745 | 0.716 | 0.336 | 7.1e-13 | |
| TAIR|locus:2053124 | 171 | bZIP2 "AT2G18160" [Arabidopsis | 0.660 | 0.590 | 0.365 | 1.3e-11 | |
| TAIR|locus:2202852 | 148 | bZIP4 "AT1G59530" [Arabidopsis | 0.516 | 0.533 | 0.392 | 2.8e-11 |
| TAIR|locus:2159325 bZIP70 "AT5G60830" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 327 (120.2 bits), Expect = 1.6e-29, P = 1.6e-29
Identities = 78/151 (51%), Positives = 101/151 (66%)
Query: 4 NFSGRFLSNSQFHVPVHIFSPNTSVSPRSGSALDEARET----PASIINEKRLKRVISNR 59
+F+ FL N+ F+V H+ S N S + S LD E E+R +R++SNR
Sbjct: 24 HFNSAFLPNTDFNV--HLQS-NVSTRINNQSHLDPNAENIFHNEGLAPEERRARRMVSNR 80
Query: 60 ESARRSRMRKKKLIEELQAQVNHVQTVNHQLSEKLISLLESNHQIVQENSQLKEKVSSLQ 119
ESARRSRMRKKK IEELQ QV + +NH LSEK+I+LLESNHQI+QENSQLKEKVSS
Sbjct: 81 ESARRSRMRKKKQIEELQQQVEQLMMLNHHLSEKVINLLESNHQILQENSQLKEKVSSFH 140
Query: 120 LVISDLLAPLRGLEE-VNG-NMNRPRAEASS 148
L+++D+L P+R E +N N+N R E S+
Sbjct: 141 LLMADVLLPMRNAESNINDRNVNYLRGEPSN 171
|
|
| TAIR|locus:2092595 bZIP42 "AT3G30530" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166650 bZIP43 "AT5G38800" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:1005716856 bZIP75 "AT5G08141" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2143191 bZIP3 "AT5G15830" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009932 bZIP58 "AT1G13600" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2827461 bZIP48 "AT2G04038" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2139584 GBF6 "AT4G34590" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2053124 bZIP2 "AT2G18160" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2202852 bZIP4 "AT1G59530" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| gw1.XV.683.1 | hypothetical protein (101 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 153 | |||
| smart00338 | 65 | smart00338, BRLZ, basic region leucin zipper | 3e-11 | |
| pfam00170 | 64 | pfam00170, bZIP_1, bZIP transcription factor | 1e-06 | |
| pfam07716 | 54 | pfam07716, bZIP_2, Basic region leucine zipper | 1e-05 |
| >gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper | Back alignment and domain information |
|---|
Score = 55.3 bits (134), Expect = 3e-11
Identities = 24/62 (38%), Positives = 37/62 (59%)
Query: 49 EKRLKRVISNRESARRSRMRKKKLIEELQAQVNHVQTVNHQLSEKLISLLESNHQIVQEN 108
EKR +R NRE+ARRSR RKK IEEL+ +V ++ N +L +++ L ++ E
Sbjct: 4 EKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSEL 63
Query: 109 SQ 110
+
Sbjct: 64 EE 65
|
Length = 65 |
| >gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor | Back alignment and domain information |
|---|
| >gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 153 | |||
| smart00338 | 65 | BRLZ basic region leucin zipper. | 99.49 | |
| KOG4005 | 292 | consensus Transcription factor XBP-1 [Transcriptio | 99.47 | |
| KOG4343 | 655 | consensus bZIP transcription factor ATF6 [Transcri | 99.44 | |
| PF00170 | 64 | bZIP_1: bZIP transcription factor cAMP response el | 99.43 | |
| PF07716 | 54 | bZIP_2: Basic region leucine zipper; InterPro: IPR | 99.2 | |
| KOG3584 | 348 | consensus cAMP response element binding protein an | 99.19 | |
| KOG0709 | 472 | consensus CREB/ATF family transcription factor [Tr | 99.1 | |
| PF03131 | 92 | bZIP_Maf: bZIP Maf transcription factor; InterPro: | 98.11 | |
| KOG4571 | 294 | consensus Activating transcription factor 4 [Trans | 97.99 | |
| KOG0837 | 279 | consensus Transcriptional activator of the JUN fam | 97.98 | |
| KOG4196 | 135 | consensus bZIP transcription factor MafK [Transcri | 97.28 | |
| KOG3119 | 269 | consensus Basic region leucine zipper transcriptio | 97.21 | |
| TIGR02449 | 65 | conserved hypothetical protein TIGR02449. Members | 97.11 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 96.74 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 96.6 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 96.6 | |
| KOG3863 | 604 | consensus bZIP transcription factor NRF1 [Transcri | 96.55 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 96.49 | |
| PRK13169 | 110 | DNA replication intiation control protein YabA; Re | 96.46 | |
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 96.44 | |
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 95.98 | |
| PRK13169 | 110 | DNA replication intiation control protein YabA; Re | 95.22 | |
| PF02183 | 45 | HALZ: Homeobox associated leucine zipper; InterPro | 95.07 | |
| COG4467 | 114 | Regulator of replication initiation timing [Replic | 94.69 | |
| TIGR02449 | 65 | conserved hypothetical protein TIGR02449. Members | 94.61 | |
| PF13747 | 89 | DUF4164: Domain of unknown function (DUF4164) | 94.23 | |
| KOG1414 | 395 | consensus Transcriptional activator FOSB/c-Fos and | 94.22 | |
| COG4467 | 114 | Regulator of replication initiation timing [Replic | 94.05 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 94.03 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 93.8 | |
| KOG1318 | 411 | consensus Helix loop helix transcription factor EB | 93.73 | |
| PRK13729 | 475 | conjugal transfer pilus assembly protein TraB; Pro | 93.66 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 93.59 | |
| PF07989 | 75 | Microtub_assoc: Microtubule associated; InterPro: | 93.41 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 93.36 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 93.3 | |
| PF04102 | 69 | SlyX: SlyX; InterPro: IPR007236 The SlyX protein h | 93.14 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 92.83 | |
| KOG4005 | 292 | consensus Transcription factor XBP-1 [Transcriptio | 92.64 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 92.54 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 92.46 | |
| PF10224 | 80 | DUF2205: Predicted coiled-coil protein (DUF2205); | 92.33 | |
| PRK02119 | 73 | hypothetical protein; Provisional | 92.19 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 91.98 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 91.83 | |
| PRK11637 | 428 | AmiB activator; Provisional | 91.77 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 91.76 | |
| PRK00295 | 68 | hypothetical protein; Provisional | 91.67 | |
| PRK02793 | 72 | phi X174 lysis protein; Provisional | 91.6 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 91.58 | |
| PF12808 | 52 | Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 | 91.44 | |
| TIGR00219 | 283 | mreC rod shape-determining protein MreC. MreC (mur | 91.31 | |
| PRK11637 | 428 | AmiB activator; Provisional | 91.22 | |
| PRK00736 | 68 | hypothetical protein; Provisional | 91.02 | |
| PRK04325 | 74 | hypothetical protein; Provisional | 90.98 | |
| PRK04406 | 75 | hypothetical protein; Provisional | 90.91 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 90.71 | |
| PF12711 | 86 | Kinesin-relat_1: Kinesin motor; InterPro: IPR02465 | 90.33 | |
| PRK02119 | 73 | hypothetical protein; Provisional | 90.32 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 90.17 | |
| PF04880 | 166 | NUDE_C: NUDE protein, C-terminal conserved region; | 90.07 | |
| PRK04406 | 75 | hypothetical protein; Provisional | 89.55 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 89.28 | |
| PRK00846 | 77 | hypothetical protein; Provisional | 88.78 | |
| KOG3119 | 269 | consensus Basic region leucine zipper transcriptio | 88.68 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 88.53 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 88.42 | |
| smart00338 | 65 | BRLZ basic region leucin zipper. | 88.41 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 88.28 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 88.26 | |
| KOG4797 | 123 | consensus Transcriptional regulator [Transcription | 88.24 | |
| PRK13922 | 276 | rod shape-determining protein MreC; Provisional | 88.23 | |
| PRK04325 | 74 | hypothetical protein; Provisional | 88.22 | |
| PF01166 | 59 | TSC22: TSC-22/dip/bun family; InterPro: IPR000580 | 88.16 | |
| KOG2264 | 907 | consensus Exostosin EXT1L [Signal transduction mec | 87.69 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 87.57 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 87.56 | |
| PF04102 | 69 | SlyX: SlyX; InterPro: IPR007236 The SlyX protein h | 87.52 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 87.44 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 87.24 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 87.17 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 86.76 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 86.69 | |
| PF05103 | 131 | DivIVA: DivIVA protein; InterPro: IPR007793 The Ba | 86.47 | |
| PF00170 | 64 | bZIP_1: bZIP transcription factor cAMP response el | 86.46 | |
| PRK00846 | 77 | hypothetical protein; Provisional | 86.38 | |
| PRK02793 | 72 | phi X174 lysis protein; Provisional | 86.27 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 86.1 | |
| PRK09039 | 343 | hypothetical protein; Validated | 86.07 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 85.92 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 85.9 | |
| PRK00295 | 68 | hypothetical protein; Provisional | 85.7 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 85.65 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 85.54 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 85.4 | |
| smart00340 | 44 | HALZ homeobox associated leucin zipper. | 85.2 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 85.12 | |
| PF10805 | 106 | DUF2730: Protein of unknown function (DUF2730); In | 85.12 | |
| PF08172 | 248 | CASP_C: CASP C terminal; InterPro: IPR012955 This | 84.99 | |
| PRK09039 | 343 | hypothetical protein; Validated | 84.96 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 84.83 | |
| PRK00888 | 105 | ftsB cell division protein FtsB; Reviewed | 84.71 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 84.68 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 84.5 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 84.26 | |
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 84.2 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 84.02 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 84.0 | |
| KOG1414 | 395 | consensus Transcriptional activator FOSB/c-Fos and | 83.85 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 83.84 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 83.82 | |
| PF15058 | 200 | Speriolin_N: Speriolin N terminus | 83.45 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 82.82 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 82.53 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 82.5 | |
| PRK00888 | 105 | ftsB cell division protein FtsB; Reviewed | 82.18 | |
| PF15035 | 182 | Rootletin: Ciliary rootlet component, centrosome c | 82.14 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 81.91 | |
| PF02183 | 45 | HALZ: Homeobox associated leucine zipper; InterPro | 81.91 | |
| KOG4196 | 135 | consensus bZIP transcription factor MafK [Transcri | 81.75 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 81.25 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 81.13 | |
| PF04977 | 80 | DivIC: Septum formation initiator; InterPro: IPR00 | 80.46 | |
| PRK00736 | 68 | hypothetical protein; Provisional | 80.19 |
| >smart00338 BRLZ basic region leucin zipper | Back alignment and domain information |
|---|
Probab=99.49 E-value=2.8e-13 Score=91.58 Aligned_cols=62 Identities=39% Similarity=0.484 Sum_probs=56.5
Q ss_pred hhHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 041582 47 INEKRLKRVISNRESARRSRMRKKKLIEELQAQVNHVQTVNHQLSEKLISLLESNHQIVQEN 108 (153)
Q Consensus 47 ~e~KR~RR~lkNReSArrSR~RKk~~l~eLE~kv~~Le~eN~~L~~~i~~L~~~~~~L~~EN 108 (153)
.|+|+.+|+++||+||++||.||+.|+.+||.+|..|+.+|..|..++..|..++..|..++
T Consensus 2 ~~~k~~rR~~rNR~aA~~~R~rKk~~~~~Le~~~~~L~~en~~L~~~~~~l~~e~~~lk~~~ 63 (65)
T smart00338 2 EDEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSEL 63 (65)
T ss_pred ccHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence 57899999999999999999999999999999999999999999999998877777666654
|
|
| >KOG4005 consensus Transcription factor XBP-1 [Transcription] | Back alignment and domain information |
|---|
| >KOG4343 consensus bZIP transcription factor ATF6 [Transcription] | Back alignment and domain information |
|---|
| >PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization | Back alignment and domain information |
|---|
| >PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization | Back alignment and domain information |
|---|
| >KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] | Back alignment and domain information |
|---|
| >KOG0709 consensus CREB/ATF family transcription factor [Transcription] | Back alignment and domain information |
|---|
| >PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell | Back alignment and domain information |
|---|
| >KOG4571 consensus Activating transcription factor 4 [Transcription] | Back alignment and domain information |
|---|
| >KOG0837 consensus Transcriptional activator of the JUN family [Transcription] | Back alignment and domain information |
|---|
| >KOG4196 consensus bZIP transcription factor MafK [Transcription] | Back alignment and domain information |
|---|
| >KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] | Back alignment and domain information |
|---|
| >TIGR02449 conserved hypothetical protein TIGR02449 | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >KOG3863 consensus bZIP transcription factor NRF1 [Transcription] | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >PRK13169 DNA replication intiation control protein YabA; Reviewed | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >PRK13169 DNA replication intiation control protein YabA; Reviewed | Back alignment and domain information |
|---|
| >PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] | Back alignment and domain information |
|---|
| >COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02449 conserved hypothetical protein TIGR02449 | Back alignment and domain information |
|---|
| >PF13747 DUF4164: Domain of unknown function (DUF4164) | Back alignment and domain information |
|---|
| >KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] | Back alignment and domain information |
|---|
| >COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG1318 consensus Helix loop helix transcription factor EB [Transcription] | Back alignment and domain information |
|---|
| >PRK13729 conjugal transfer pilus assembly protein TraB; Provisional | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG4005 consensus Transcription factor XBP-1 [Transcription] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure | Back alignment and domain information |
|---|
| >PRK02119 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >PRK00295 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02793 phi X174 lysis protein; Provisional | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi | Back alignment and domain information |
|---|
| >TIGR00219 mreC rod shape-determining protein MreC | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PRK00736 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04325 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04406 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF12711 Kinesin-relat_1: Kinesin motor; InterPro: IPR024658 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >PRK02119 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins | Back alignment and domain information |
|---|
| >PRK04406 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK00846 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >smart00338 BRLZ basic region leucin zipper | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG4797 consensus Transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK13922 rod shape-determining protein MreC; Provisional | Back alignment and domain information |
|---|
| >PRK04325 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01166 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation | Back alignment and domain information |
|---|
| >KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF05103 DivIVA: DivIVA protein; InterPro: IPR007793 The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate minicells [] | Back alignment and domain information |
|---|
| >PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization | Back alignment and domain information |
|---|
| >PRK00846 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02793 phi X174 lysis protein; Provisional | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PRK00295 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >smart00340 HALZ homeobox associated leucin zipper | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins | Back alignment and domain information |
|---|
| >PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >PRK00888 ftsB cell division protein FtsB; Reviewed | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF15058 Speriolin_N: Speriolin N terminus | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PRK00888 ftsB cell division protein FtsB; Reviewed | Back alignment and domain information |
|---|
| >PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] | Back alignment and domain information |
|---|
| >KOG4196 consensus bZIP transcription factor MafK [Transcription] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] | Back alignment and domain information |
|---|
| >PRK00736 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 153 | |||
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 4e-09 | |
| 1dh3_A | 55 | Transcription factor CREB; protein-DNA complex, tr | 7e-09 | |
| 3a5t_A | 107 | Transcription factor MAFG; protein-DNA complex, BZ | 2e-07 | |
| 2wt7_A | 63 | Proto-oncogene protein C-FOS; transcription, trans | 2e-07 | |
| 1jnm_A | 62 | Proto-oncogene C-JUN; BZIP, protein-DNA complex, t | 5e-07 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 2e-06 | |
| 2wt7_B | 90 | Transcription factor MAFB; transcription, transcri | 1e-05 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 1e-04 |
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 | Back alignment and structure |
|---|
Score = 49.3 bits (118), Expect = 4e-09
Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 7/66 (10%)
Query: 50 KRLKRVISNRESARRSRMRKKKLIEELQAQVNHVQTVNHQLSEKLISLLESNHQIVQENS 109
KR K + NR +A RSR ++K ++ L+ + + ++N QL ++ L E +
Sbjct: 1 KRRKFLERNRAAASRSRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRN-------EVA 53
Query: 110 QLKEKV 115
QLK+ +
Sbjct: 54 QLKQLL 59
|
| >1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 | Back alignment and structure |
|---|
| >3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 | Back alignment and structure |
|---|
| >2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 | Back alignment and structure |
|---|
| >1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 | Back alignment and structure |
|---|
| >2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 153 | |||
| 1dh3_A | 55 | Transcription factor CREB; protein-DNA complex, tr | 99.57 | |
| 2wt7_A | 63 | Proto-oncogene protein C-FOS; transcription, trans | 99.42 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 99.38 | |
| 1jnm_A | 62 | Proto-oncogene C-JUN; BZIP, protein-DNA complex, t | 99.3 | |
| 2dgc_A | 63 | Protein (GCN4); basic domain, leucine zipper, DNA | 99.28 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 99.11 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 99.08 | |
| 1hjb_A | 87 | Ccaat/enhancer binding protein beta; transcription | 98.69 | |
| 1gu4_A | 78 | CAAT/enhancer binding protein beta; transcription/ | 98.68 | |
| 2wt7_B | 90 | Transcription factor MAFB; transcription, transcri | 98.3 | |
| 3a5t_A | 107 | Transcription factor MAFG; protein-DNA complex, BZ | 98.28 | |
| 2oqq_A | 42 | Transcription factor HY5; homodimer leucine zipper | 97.58 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 96.88 | |
| 1skn_P | 92 | DNA-binding domain of SKN-1; complex (transcriptio | 96.59 | |
| 2w6a_A | 63 | ARF GTPase-activating protein GIT1; PIX, zinc, sig | 95.77 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 95.46 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 95.44 | |
| 1deb_A | 54 | APC protein, adenomatous polyposis coli protein; c | 94.96 | |
| 3cve_A | 72 | Homer protein homolog 1; coiled coil, alternative | 94.07 | |
| 3s9g_A | 104 | Protein hexim1; cyclin T-binding domain (TBD), cyc | 93.75 | |
| 3he5_A | 49 | Synzip1; heterodimeric coiled-coil, de novo protei | 93.49 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 93.41 | |
| 3m48_A | 33 | General control protein GCN4; leucine zipper, synt | 93.4 | |
| 2oxj_A | 34 | Hybrid alpha/beta peptide based on the GCN4-P1 Se | 93.0 | |
| 1kd8_B | 36 | GABH BLL, GCN4 acid base heterodimer base-D12LA16L | 92.81 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 92.63 | |
| 2w83_C | 77 | C-JUN-amino-terminal kinase-interacting protein 4; | 92.43 | |
| 3vmx_A | 48 | Voltage-gated hydrogen channel 1; coiled-coil, ION | 92.21 | |
| 1kd8_A | 36 | GABH AIV, GCN4 acid base heterodimer acid-D12IA16V | 91.75 | |
| 2c9l_Y | 63 | EB1, zebra, BZLF1 trans-activator protein; viral p | 91.75 | |
| 3c3f_A | 34 | Alpha/beta peptide with the GCN4-PLI SIDE chain S | 91.56 | |
| 1go4_E | 100 | MAD1 (mitotic arrest deficient)-like 1; mitotic sp | 91.35 | |
| 3a2a_A | 58 | Voltage-gated hydrogen channel 1; voltage-gated pr | 91.05 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 90.88 | |
| 3c3g_A | 33 | Alpha/beta peptide with the GCN4-PLI SIDE chain S | 90.54 | |
| 3efg_A | 78 | Protein SLYX homolog; xanthomonas campestris PV. c | 90.48 | |
| 3m91_A | 51 | Proteasome-associated ATPase; coil COIL alpha heli | 90.46 | |
| 2wq1_A | 33 | General control protein GCN4; TAA, nucleus, coiled | 90.16 | |
| 2bni_A | 34 | General control protein GCN4; four helix bundle, a | 90.02 | |
| 1uo4_A | 34 | General control protein GCN4; four helix bundle, c | 90.01 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 89.99 | |
| 2kz5_A | 91 | Transcription factor NF-E2 45 kDa subunit; structu | 89.95 | |
| 2hy6_A | 34 | General control protein GCN4; protein design, para | 89.83 | |
| 2oxj_A | 34 | Hybrid alpha/beta peptide based on the GCN4-P1 Se | 89.56 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 89.35 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 89.27 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 89.04 | |
| 2yy0_A | 53 | C-MYC-binding protein; conserved hypothetical prot | 88.99 | |
| 2dgc_A | 63 | Protein (GCN4); basic domain, leucine zipper, DNA | 88.68 | |
| 2xdj_A | 83 | Uncharacterized protein YBGF; unknown function; 1. | 88.58 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 87.93 | |
| 3m48_A | 33 | General control protein GCN4; leucine zipper, synt | 87.75 | |
| 1hjb_A | 87 | Ccaat/enhancer binding protein beta; transcription | 87.69 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 87.38 | |
| 1fmh_A | 33 | General control protein GCN4; coiled coil, leucine | 87.33 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 87.1 | |
| 1gk6_A | 59 | Vimentin; intermediate filament, dimer, parallel c | 86.97 | |
| 1t6f_A | 37 | Geminin; coiled-coil, cell cycle; 1.47A {Synthetic | 86.42 | |
| 2yy0_A | 53 | C-MYC-binding protein; conserved hypothetical prot | 86.13 | |
| 1dh3_A | 55 | Transcription factor CREB; protein-DNA complex, tr | 85.83 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 85.53 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 85.4 | |
| 3c3f_A | 34 | Alpha/beta peptide with the GCN4-PLI SIDE chain S | 85.0 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 84.88 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 84.8 | |
| 3c3g_A | 33 | Alpha/beta peptide with the GCN4-PLI SIDE chain S | 84.78 | |
| 4emc_A | 190 | Monopolin complex subunit CSM1; RWD domain, kineto | 84.42 | |
| 3swy_A | 46 | Cyclic nucleotide-gated cation channel alpha-3; co | 84.33 | |
| 3swf_A | 74 | CGMP-gated cation channel alpha-1; coiled-coil, as | 84.3 | |
| 1dip_A | 78 | Delta-sleep-inducing peptide immunoreactive peptid | 84.0 | |
| 1jnm_A | 62 | Proto-oncogene C-JUN; BZIP, protein-DNA complex, t | 83.78 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 83.69 | |
| 1uii_A | 83 | Geminin; human, DNA replication, cell cycle; 2.00A | 83.57 | |
| 2zxx_A | 79 | Geminin; coiled-coil, cell cycle, coiled coil, DNA | 83.42 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 83.32 | |
| 4h22_A | 103 | Leucine-rich repeat flightless-interacting protei; | 83.32 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 83.06 | |
| 3efg_A | 78 | Protein SLYX homolog; xanthomonas campestris PV. c | 83.05 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 82.85 | |
| 3m9b_A | 251 | Proteasome-associated ATPase; coil COIL with 5 bet | 82.53 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 82.47 | |
| 2oqq_A | 42 | Transcription factor HY5; homodimer leucine zipper | 82.3 | |
| 2r2v_A | 34 | GCN4 leucine zipper; coiled coils, anti-parallel t | 82.2 | |
| 1kd8_B | 36 | GABH BLL, GCN4 acid base heterodimer base-D12LA16L | 81.94 | |
| 2bni_A | 34 | General control protein GCN4; four helix bundle, a | 81.68 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 81.53 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 81.39 | |
| 1wlq_A | 83 | Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2z | 81.29 | |
| 2w83_C | 77 | C-JUN-amino-terminal kinase-interacting protein 4; | 81.06 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 81.03 | |
| 1p9i_A | 31 | Cortexillin I/GCN4 hybrid peptide; coiled-coil, un | 80.69 | |
| 2xv5_A | 74 | Lamin-A/C; structural protein, intermediate filame | 80.49 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 80.24 | |
| 1uo4_A | 34 | General control protein GCN4; four helix bundle, c | 80.04 |
| >1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 | Back alignment and structure |
|---|
Probab=99.57 E-value=4e-15 Score=98.26 Aligned_cols=51 Identities=37% Similarity=0.528 Sum_probs=47.5
Q ss_pred HHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 041582 50 KRLKRVISNRESARRSRMRKKKLIEELQAQVNHVQTVNHQLSEKLISLLES 100 (153)
Q Consensus 50 KR~RR~lkNReSArrSR~RKk~~l~eLE~kv~~Le~eN~~L~~~i~~L~~~ 100 (153)
|+.+|+++||+||++||.||++|+++||.+|..|+.+|..|..++..|+..
T Consensus 1 kr~rR~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~ 51 (55)
T 1dh3_A 1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDL 51 (55)
T ss_dssp CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred ChHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 588999999999999999999999999999999999999999998887654
|
| >2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D | Back alignment and structure |
|---|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A | Back alignment and structure |
|---|
| >2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A | Back alignment and structure |
|---|
| >2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A | Back alignment and structure |
|---|
| >3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 | Back alignment and structure |
|---|
| >2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 | Back alignment and structure |
|---|
| >3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A | Back alignment and structure |
|---|
| >3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A | Back alignment and structure |
|---|
| >2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* | Back alignment and structure |
|---|
| >1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} | Back alignment and structure |
|---|
| >1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A | Back alignment and structure |
|---|
| >2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y | Back alignment and structure |
|---|
| >3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 | Back alignment and structure |
|---|
| >3a2a_A Voltage-gated hydrogen channel 1; voltage-gated proton channel, alternative splicing, coiled C transport, ionic channel, membrane, transmembrane; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* | Back alignment and structure |
|---|
| >3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A | Back alignment and structure |
|---|
| >2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... | Back alignment and structure |
|---|
| >2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... | Back alignment and structure |
|---|
| >1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >2kz5_A Transcription factor NF-E2 45 kDa subunit; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A | Back alignment and structure |
|---|
| >2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D | Back alignment and structure |
|---|
| >2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A | Back alignment and structure |
|---|
| >1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fmh_A General control protein GCN4; coiled coil, leucine zipper, inter-helical ION pairing, transcription; NMR {Synthetic} SCOP: k.6.1.1 PDB: 1u2u_A | Back alignment and structure |
|---|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1gk6_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, leucine zipper, fusion protein; 1.9A {Saccharomyces cerevisiae} SCOP: h.1.20.1 | Back alignment and structure |
|---|
| >1t6f_A Geminin; coiled-coil, cell cycle; 1.47A {Synthetic} SCOP: h.1.28.1 | Back alignment and structure |
|---|
| >2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B | Back alignment and structure |
|---|
| >3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* | Back alignment and structure |
|---|
| >4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A | Back alignment and structure |
|---|
| >3swy_A Cyclic nucleotide-gated cation channel alpha-3; coiled-coil, assembly domain, transport protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3swf_A CGMP-gated cation channel alpha-1; coiled-coil, assembly domain, transport protein; 2.14A {Bos taurus} | Back alignment and structure |
|---|
| >1dip_A Delta-sleep-inducing peptide immunoreactive peptide; structure, leucine zipper, PIG, acetylation; NMR {Sus scrofa} SCOP: h.1.12.1 | Back alignment and structure |
|---|
| >1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >1uii_A Geminin; human, DNA replication, cell cycle; 2.00A {Homo sapiens} SCOP: h.1.28.1 | Back alignment and structure |
|---|
| >2zxx_A Geminin; coiled-coil, cell cycle, coiled coil, DNA replication inhibitor, phosphoprotein, DNA-binding, nucleus, proto-oncogene; HET: DNA; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2r2v_A GCN4 leucine zipper; coiled coils, anti-parallel tetramer, protein design, de novo protein; HET: CIT; 1.90A {Saccharomyces cerevisiae} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B | Back alignment and structure |
|---|
| >2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >1wlq_A Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2zxx_A* | Back alignment and structure |
|---|
| >2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1p9i_A Cortexillin I/GCN4 hybrid peptide; coiled-coil, unknown function; 1.17A {Synthetic} SCOP: h.1.10.1 | Back alignment and structure |
|---|
| >2xv5_A Lamin-A/C; structural protein, intermediate filaments, nuclear membrane LEFT-handed coiled coil, right-handed coiled coil; HET: MSE; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 153 | |||
| d1sknp_ | 74 | Skn-1 {Caenorhabditis elegans [TaxId: 6239]} | 93.88 | |
| d1seta1 | 110 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 85.91 | |
| d1nkpa_ | 88 | Myc proto-oncogene protein {Human (Homo sapiens) [ | 82.35 |
| >d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: A DNA-binding domain in eukaryotic transcription factors superfamily: A DNA-binding domain in eukaryotic transcription factors family: A DNA-binding domain in eukaryotic transcription factors domain: Skn-1 species: Caenorhabditis elegans [TaxId: 6239]
Probab=93.88 E-value=0.013 Score=38.86 Aligned_cols=27 Identities=22% Similarity=0.377 Sum_probs=23.1
Q ss_pred HHHHHHHHHhHHHHHHHHHHHHHHHHH
Q 041582 49 EKRLKRVISNRESARRSRMRKKKLIEE 75 (153)
Q Consensus 49 ~KR~RR~lkNReSArrSR~RKk~~l~e 75 (153)
-+-.||.=+|+.+|+.+|+||....++
T Consensus 47 irDIRRRGKNKvAAqnCRKRKld~~d~ 73 (74)
T d1sknp_ 47 IRKIRRRGKNKVAARTCRQRRTDRHDK 73 (74)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHTTT
T ss_pred HHHHHHhcccHHHHHHHHHhhhhhhcc
Confidence 356789999999999999999887654
|
| >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|