Citrus Sinensis ID: 041597


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MAIKQLKAAKDFNGNLPNLDDYFTAYRVHQLPEMKSTRYDILAITDPEVDNITVKKQYKRLALMLHPEKNPSIAAEGAFQIVQSAGDVLTNPEKREAYYRRSFCSKKSKAGSNSSWSQPRADGDSNFSRARKPSPFRFQKTDPDPNNSS
cHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccEEEcccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccc
cHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHEEEccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccc
MAIKQLKAAKdfngnlpnlddyfTAYRVhqlpemkstrydilaitdpevdnitVKKQYKRLALMlhpeknpsiaAEGAFQIVQSagdvltnpekreaYYRRSFcskkskagsnsswsqpradgdsnfsrarkpspfrfqktdpdpnnss
MAIKQLKAakdfngnlpnLDDYFTAYRVHQLPEMKSTRYDILaitdpevdnitVKKQYKRLALMLHPEKNPSIAAEGAFQIVQSAgdvltnpekREAYYRRSfcskkskagsnsswsqpradgdsnfsrarkpspfrfqktdpdpnnss
MAIKQLKAAKDFNGNLPNLDDYFTAYRVHQLPEMKSTRYDILAITDPEVDNITVKKQYKRLALMLHPEKNPSIAAEGAFQIVQSAGDVLTNPEKREAYYRRSFCSKKSKAGSNSSWSQPRADGDSNFSRARKPSPFRFQKTDPDPNNSS
***********FNGNLPNLDDYFTAYRVHQLPEMKSTRYDILAITDPEVDNITVKKQYKRLALMLHPEK**SIAAEGAFQIVQSAGDVL************************************************************
**IK*LKAAKDFNGNLPNLDDYFTAYRVHQLPEMKSTRYDILAITDPEVDNITVKKQYKRLALMLHPEKNPSIAAEGAFQIVQSAGDVLTNPEKREAYY**************************************************
MAIKQLKAAKDFNGNLPNLDDYFTAYRVHQLPEMKSTRYDILAITDPEVDNITVKKQYKRLALMLHPEKNPSIAAEGAFQIVQSAGDVLTNPEKREAYYRRSF************************SRARKPSPFRFQK*********
MAIKQLKAAKDFNGNLPNLDDYFTAYRVHQLPEMKSTRYDILAITDPEVDNITVKKQYKRLALMLHPEKNPSIAAEGAFQIVQSAGDVLTNPEKREAYYRRSFC*********************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIKQLKAAKDFNGNLPNLDDYFTAYRVHQLPEMKSTRYDILAITDPEVDNITVKKQYKRLALMLHPEKNPSIAAEGAFQIVQSAGDVLTNPEKREAYYRRSFCSKKSKAGSNSSWSQPRADGDSNFSRARKPSPFRFQKTDPDPNNSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query149 2.2.26 [Sep-21-2011]
Q7VQL3 377 Chaperone protein DnaJ OS yes no 0.429 0.169 0.454 5e-09
Q5XIX0 703 DnaJ homolog subfamily C yes no 0.610 0.129 0.304 6e-08
Q9NXW2 375 DnaJ homolog subfamily B yes no 0.657 0.261 0.327 1e-07
Q921R4 703 DnaJ homolog subfamily C yes no 0.610 0.129 0.304 1e-07
Q493S6 375 Chaperone protein DnaJ OS yes no 0.422 0.168 0.461 2e-07
Q95J56 699 DnaJ homolog subfamily C yes no 0.449 0.095 0.352 2e-07
Q6Y2X3 702 DnaJ homolog subfamily C no no 0.610 0.129 0.293 5e-07
Q8D2Q6 374 Chaperone protein DnaJ OS yes no 0.422 0.168 0.446 5e-07
Q58DR2 370 DnaJ homolog subfamily B no no 0.503 0.202 0.384 6e-07
Q7ZXQ8 371 DnaJ homolog subfamily B N/A no 0.637 0.256 0.350 6e-07
>sp|Q7VQL3|DNAJ_BLOFL Chaperone protein DnaJ OS=Blochmannia floridanus GN=dnaJ PE=3 SV=1 Back     alignment and function desciption
 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query: 34 MKSTRYDILAITDPEVDNITVKKQYKRLALMLHPEKNPS-IAAEGAFQIVQSAGDVLTNP 92
          +KS  Y+IL ++    D   +KK YKRLA+  HP++NP  ++AE  F+ ++ A +VL+NP
Sbjct: 2  VKSDYYEILGVS-KNADEREIKKSYKRLAMKFHPDRNPGDVSAESKFKEIKEAYEVLSNP 60

Query: 93 EKREAY 98
          EKR AY
Sbjct: 61 EKRSAY 66




Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins.
Blochmannia floridanus (taxid: 203907)
>sp|Q5XIX0|DJC14_RAT DnaJ homolog subfamily C member 14 OS=Rattus norvegicus GN=Dnajc14 PE=1 SV=1 Back     alignment and function description
>sp|Q9NXW2|DJB12_HUMAN DnaJ homolog subfamily B member 12 OS=Homo sapiens GN=DNAJB12 PE=1 SV=4 Back     alignment and function description
>sp|Q921R4|DJC14_MOUSE DnaJ homolog subfamily C member 14 OS=Mus musculus GN=Dnajc14 PE=2 SV=2 Back     alignment and function description
>sp|Q493S6|DNAJ_BLOPB Chaperone protein DnaJ OS=Blochmannia pennsylvanicus (strain BPEN) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q95J56|DJC14_BOVIN DnaJ homolog subfamily C member 14 OS=Bos taurus GN=DNAJC14 PE=1 SV=1 Back     alignment and function description
>sp|Q6Y2X3|DJC14_HUMAN DnaJ homolog subfamily C member 14 OS=Homo sapiens GN=DNAJC14 PE=2 SV=2 Back     alignment and function description
>sp|Q8D2Q6|DNAJ_WIGBR Chaperone protein DnaJ OS=Wigglesworthia glossinidia brevipalpis GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q58DR2|DJB12_BOVIN DnaJ homolog subfamily B member 12 OS=Bos taurus GN=DNAJB12 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZXQ8|DJB14_XENLA DnaJ homolog subfamily B member 14 OS=Xenopus laevis GN=dnajb14 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
255564086 753 conserved hypothetical protein [Ricinus 0.637 0.126 0.454 4e-13
356561770 779 PREDICTED: uncharacterized protein LOC10 0.604 0.115 0.428 7e-12
326510321 762 predicted protein [Hordeum vulgare subsp 0.724 0.141 0.412 3e-11
356529354 812 PREDICTED: uncharacterized protein LOC10 0.838 0.153 0.340 2e-10
359473614 1168 PREDICTED: uncharacterized protein LOC10 0.610 0.077 0.432 2e-10
449469196 785 PREDICTED: uncharacterized protein LOC10 0.738 0.140 0.362 2e-10
357512127 1084 Chaperone protein dnaJ [Medicago truncat 0.651 0.089 0.386 3e-10
224057750 670 predicted protein [Populus trichocarpa] 0.711 0.158 0.380 9e-10
224132944 654 predicted protein [Populus trichocarpa] 0.395 0.090 0.516 1e-09
225432412 1044 PREDICTED: uncharacterized protein LOC10 0.738 0.105 0.371 1e-09
>gi|255564086|ref|XP_002523041.1| conserved hypothetical protein [Ricinus communis] gi|223537724|gb|EEF39345.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score = 79.3 bits (194), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 66/99 (66%), Gaps = 4/99 (4%)

Query: 35  KSTRYDILAITDPEVDNITVKKQYKRLALMLHPEKNPSIAAEGAFQIVQSAGDVLTNPEK 94
           +S  Y IL  TDP+ D+ TV+KQY++LALMLHP+KN SI A+GAF+++  A  +L++  K
Sbjct: 64  ESDWYGILG-TDPQADDETVRKQYRKLALMLHPDKNKSIGADGAFKLISEAWSLLSDKTK 122

Query: 95  REAYYRRSFCSKKSKAGSN---SSWSQPRADGDSNFSRA 130
           R AY ++    K S+  SN    S + P + G SNF+R+
Sbjct: 123 RVAYDQKRKNVKASQKVSNPAGGSSAAPESSGFSNFTRS 161




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356561770|ref|XP_003549151.1| PREDICTED: uncharacterized protein LOC100806402 [Glycine max] Back     alignment and taxonomy information
>gi|326510321|dbj|BAJ87377.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|356529354|ref|XP_003533259.1| PREDICTED: uncharacterized protein LOC100816712 [Glycine max] Back     alignment and taxonomy information
>gi|359473614|ref|XP_002271091.2| PREDICTED: uncharacterized protein LOC100257476 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449469196|ref|XP_004152307.1| PREDICTED: uncharacterized protein LOC101221103 [Cucumis sativus] gi|449484851|ref|XP_004156998.1| PREDICTED: uncharacterized LOC101221103 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357512127|ref|XP_003626352.1| Chaperone protein dnaJ [Medicago truncatula] gi|124360144|gb|ABN08160.1| Heat shock protein DnaJ [Medicago truncatula] gi|355501367|gb|AES82570.1| Chaperone protein dnaJ [Medicago truncatula] Back     alignment and taxonomy information
>gi|224057750|ref|XP_002299311.1| predicted protein [Populus trichocarpa] gi|222846569|gb|EEE84116.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224132944|ref|XP_002321448.1| predicted protein [Populus trichocarpa] gi|222868444|gb|EEF05575.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225432412|ref|XP_002276957.1| PREDICTED: uncharacterized protein LOC100244334 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
TAIR|locus:2151714241 AT5G37750 [Arabidopsis thalian 0.825 0.510 0.389 9.1e-13
TAIR|locus:2182508 287 AT5G37440 [Arabidopsis thalian 0.617 0.320 0.441 1.2e-12
TAIR|locus:2169170 431 AT5G37380 [Arabidopsis thalian 0.691 0.238 0.414 2.5e-11
TAIR|locus:2122950 558 AT4G19570 [Arabidopsis thalian 0.718 0.191 0.359 1.8e-10
TAIR|locus:2195281138 AT1G09260 [Arabidopsis thalian 0.577 0.623 0.333 2.5e-10
TAIR|locus:2122970 345 AT4G19590 [Arabidopsis thalian 0.496 0.214 0.486 3.1e-10
TAIR|locus:2097880 350 AT3G47940 [Arabidopsis thalian 0.718 0.305 0.377 6.8e-10
POMBASE|SPBC17A3.05c 403 SPBC17A3.05c "DNAJ/DUF1977 DNA 0.590 0.218 0.4 1.2e-09
TAIR|locus:2180024 884 AT5G18750 [Arabidopsis thalian 0.416 0.070 0.444 2.9e-09
UNIPROTKB|C9JDE6211 DNAJA4 "DnaJ homolog subfamily 0.550 0.388 0.363 5.9e-09
TAIR|locus:2151714 AT5G37750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 169 (64.5 bits), Expect = 9.1e-13, P = 9.1e-13
 Identities = 53/136 (38%), Positives = 74/136 (54%)

Query:     4 KQLKAAKDFNGNLPNLDDYF-TAYRVHQLPEM--KSTRYDILAITDPEVDNITVKKQYKR 60
             K    A  F    PNLD  + T   V+       +S  Y +L + DP  D+ TVKK YK+
Sbjct:    34 KDYVGAMKFINLFPNLDGRWNTMIDVYICGSNVGESDWYGVLGV-DPLSDDETVKKHYKQ 92

Query:    61 LALMLHPEKNPSIAAEGAFQIVQSAGDVLTNPEKREAYYRRSFCSKKSKAGSNSSWSQPR 120
             LAL+LHP+KN    AEGAF++V  A  +L++  +R +Y +R    K SK G +S   +P+
Sbjct:    93 LALLLHPDKNKCYGAEGAFKLVSEAWCLLSDKVQRSSYDQRR---KNSKQGKSS---KPK 146

Query:   121 ADGDSNFSRARKPSPF 136
             A  DS  S+ RK   F
Sbjct:   147 AT-DS--SKQRKSRTF 159




GO:0005737 "cytoplasm" evidence=ISM
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
TAIR|locus:2182508 AT5G37440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169170 AT5G37380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122950 AT4G19570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195281 AT1G09260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122970 AT4G19590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097880 AT3G47940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPBC17A3.05c SPBC17A3.05c "DNAJ/DUF1977 DNAJB12 homolog (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TAIR|locus:2180024 AT5G18750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|C9JDE6 DNAJA4 "DnaJ homolog subfamily A member 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00002795001
SubName- Full=Chromosome chr1 scaffold_136, whole genome shotgun sequence; (817 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
pfam0022663 pfam00226, DnaJ, DnaJ domain 5e-13
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 3e-11
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 1e-10
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 1e-10
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 4e-10
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 7e-09
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 9e-09
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 9e-09
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 1e-08
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 2e-08
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 5e-08
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 5e-08
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 2e-07
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 4e-07
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 5e-07
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 5e-07
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 7e-07
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 1e-06
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 7e-06
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 7e-06
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 7e-06
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 8e-06
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 8e-06
PRK14299 291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 1e-05
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 2e-05
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 4e-05
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 5e-05
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 5e-05
COG2214 237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 1e-04
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 3e-04
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 5e-04
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 0.001
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein Cbp 0.001
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 0.002
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 0.002
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 0.004
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
 Score = 59.9 bits (146), Expect = 5e-13
 Identities = 26/61 (42%), Positives = 39/61 (63%), Gaps = 2/61 (3%)

Query: 39 YDILAITDPEVDNITVKKQYKRLALMLHPEKNPSI-AAEGAFQIVQSAGDVLTNPEKREA 97
          Y+IL +   +  +  +KK Y++LAL  HP+KNP   AAE  F+ +  A +VL++PEKR  
Sbjct: 3  YEILGV-PRDASDEEIKKAYRKLALKYHPDKNPGDPAAEEKFKEINEAYEVLSDPEKRAI 61

Query: 98 Y 98
          Y
Sbjct: 62 Y 62


DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63

>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 149
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.95
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.93
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.9
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 99.9
PRK14288 369 chaperone protein DnaJ; Provisional 99.89
PRK14296 372 chaperone protein DnaJ; Provisional 99.88
PRK14299 291 chaperone protein DnaJ; Provisional 99.86
PRK14279 392 chaperone protein DnaJ; Provisional 99.86
PRK14298 377 chaperone protein DnaJ; Provisional 99.85
PRK14287 371 chaperone protein DnaJ; Provisional 99.85
PRK14286 372 chaperone protein DnaJ; Provisional 99.85
PRK14291 382 chaperone protein DnaJ; Provisional 99.85
PRK14278 378 chaperone protein DnaJ; Provisional 99.85
PRK14276 380 chaperone protein DnaJ; Provisional 99.85
PRK14282 369 chaperone protein DnaJ; Provisional 99.85
PRK14285 365 chaperone protein DnaJ; Provisional 99.84
PRK14283 378 chaperone protein DnaJ; Provisional 99.84
PRK14277 386 chaperone protein DnaJ; Provisional 99.84
PRK14280 376 chaperone protein DnaJ; Provisional 99.84
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.83
PRK14301 373 chaperone protein DnaJ; Provisional 99.83
PRK14294 366 chaperone protein DnaJ; Provisional 99.83
PRK14295 389 chaperone protein DnaJ; Provisional 99.83
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.83
PRK14281 397 chaperone protein DnaJ; Provisional 99.83
PRK14297 380 chaperone protein DnaJ; Provisional 99.83
PRK14284 391 chaperone protein DnaJ; Provisional 99.82
PRK10767 371 chaperone protein DnaJ; Provisional 99.82
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.82
PRK14300 372 chaperone protein DnaJ; Provisional 99.82
PRK14290 365 chaperone protein DnaJ; Provisional 99.81
PRK14293 374 chaperone protein DnaJ; Provisional 99.81
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.81
KOG0716 279 consensus Molecular chaperone (DnaJ superfamily) [ 99.8
PRK14292 371 chaperone protein DnaJ; Provisional 99.8
PRK14289 386 chaperone protein DnaJ; Provisional 99.8
KOG0715 288 consensus Molecular chaperone (DnaJ superfamily) [ 99.8
KOG0691 296 consensus Molecular chaperone (DnaJ superfamily) [ 99.8
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.79
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.79
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.79
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.77
KOG0719 264 consensus Molecular chaperone (DnaJ superfamily) [ 99.75
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.75
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.74
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.7
COG2214 237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.69
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.69
PHA03102153 Small T antigen; Reviewed 99.68
PRK01356166 hscB co-chaperone HscB; Provisional 99.63
PRK05014171 hscB co-chaperone HscB; Provisional 99.63
PRK03578176 hscB co-chaperone HscB; Provisional 99.58
PRK00294173 hscB co-chaperone HscB; Provisional 99.58
KOG0720 490 consensus Molecular chaperone (DnaJ superfamily) [ 99.57
KOG0714 306 consensus Molecular chaperone (DnaJ superfamily) [ 99.57
KOG0722 329 consensus Molecular chaperone (DnaJ superfamily) [ 99.53
PTZ00100116 DnaJ chaperone protein; Provisional 99.51
PHA02624 647 large T antigen; Provisional 99.43
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.41
PRK01773173 hscB co-chaperone HscB; Provisional 99.37
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 99.33
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.29
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 99.26
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 99.2
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.59
KOG0568 342 consensus Molecular chaperone (DnaJ superfamily) [ 98.57
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 98.45
KOG0431453 consensus Auxilin-like protein and related protein 98.11
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.96
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 97.26
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.94
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 96.42
KOG0724 335 consensus Zuotin and related molecular chaperones 90.67
PF1344662 RPT: A repeated domain in UCH-protein 87.76
PF14687112 DUF4460: Domain of unknown function (DUF4460) 86.51
PF11833194 DUF3353: Protein of unknown function (DUF3353); In 84.36
COG555288 Uncharacterized conserved protein [Function unknow 81.4
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.95  E-value=3.9e-28  Score=198.87  Aligned_cols=74  Identities=35%  Similarity=0.595  Sum_probs=70.1

Q ss_pred             CccChhhhcCCCCCCCCHHHHHHHHHHHHHHhCCCCCC-ChhHHHHHHHHHHHHHhcCChhhHHHHhhhccccCCC
Q 041597           34 MKSTRYDILAITDPEVDNITVKKQYKRLALMLHPEKNP-SIAAEGAFQIVQSAGDVLTNPEKREAYYRRSFCSKKS  108 (149)
Q Consensus        34 ~~~d~Y~iLgv~~~~as~~~Ik~ayr~l~~~~HPD~~~-~~~a~~~f~~i~~Ay~~L~d~~~R~~YD~~~~~~~~~  108 (149)
                      +.+|||+|||| +++||.+|||+|||+||++||||+|+ +.+|+++|++|++||+||+||++|+.||++|..+...
T Consensus         2 ~~~dyYeiLGV-~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~   76 (371)
T COG0484           2 AKRDYYEILGV-SKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKA   76 (371)
T ss_pred             CccchhhhcCC-CCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCcccccc
Confidence            56799999999 99999999999999999999999999 6679999999999999999999999999999888773



>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>PF14687 DUF4460: Domain of unknown function (DUF4460) Back     alignment and domain information
>PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised Back     alignment and domain information
>COG5552 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 4e-08
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 1e-05
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-05
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 2e-05
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 2e-05
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-05
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 3e-05
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 3e-05
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 2e-04
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 4e-04
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 4e-04
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 5e-04
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure

Iteration: 1

Score = 53.9 bits (128), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Query: 39 YDILAITDPEVDNITVKKQYKRLALMLHPEKNPSIAAEGAFQIVQSAGDVLTNPEKREAY 98 Y+IL ++ D +KK Y+RLAL HP+KN + A AF+ + +A VL+NPEKR+ Y Sbjct: 10 YEILGVSRGASDE-DLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQY 68
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 6e-12
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 7e-12
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 1e-10
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 2e-10
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 3e-10
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 3e-10
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 3e-10
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 3e-10
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 4e-10
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 4e-10
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 5e-10
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 5e-10
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 7e-10
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 1e-09
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 2e-09
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 2e-09
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 3e-09
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 3e-09
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 3e-09
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 1e-08
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 1e-08
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 1e-08
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 3e-08
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 4e-08
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-08
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 2e-07
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 2e-06
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 2e-05
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 2e-05
2guz_A71 Mitochondrial import inner membrane translocase su 4e-05
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 1e-04
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 3e-04
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 3e-04
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 9e-04
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
 Score = 56.8 bits (138), Expect = 6e-12
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 1/65 (1%)

Query: 34 MKSTRYDILAITDPEVDNITVKKQYKRLALMLHPEKNPSIAAEGAFQIVQSAGDVLTNPE 93
          M    Y  L +      +  +K+ Y+R AL  HP+KN    AE  F+ +  A DVL++P 
Sbjct: 1  MGKDYYQTLGL-ARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPR 59

Query: 94 KREAY 98
          KRE +
Sbjct: 60 KREIF 64


>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.91
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.91
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.9
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.9
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.89
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.89
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.89
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.89
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.89
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.89
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.88
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.88
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.87
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.87
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.86
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.84
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.83
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.82
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.82
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.78
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.78
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.78
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.78
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.77
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.77
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.77
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.77
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.77
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.77
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.74
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.72
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.7
2guz_A71 Mitochondrial import inner membrane translocase su 99.69
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.57
2guz_B65 Mitochondrial import inner membrane translocase su 99.09
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 96.42
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
Probab=99.91  E-value=1.3e-24  Score=141.75  Aligned_cols=73  Identities=34%  Similarity=0.501  Sum_probs=68.4

Q ss_pred             CccChhhhcCCCCCCCCHHHHHHHHHHHHHHhCCCCCCChhHHHHHHHHHHHHHhcCChhhHHHHhhhccccCC
Q 041597           34 MKSTRYDILAITDPEVDNITVKKQYKRLALMLHPEKNPSIAAEGAFQIVQSAGDVLTNPEKREAYYRRSFCSKK  107 (149)
Q Consensus        34 ~~~d~Y~iLgv~~~~as~~~Ik~ayr~l~~~~HPD~~~~~~a~~~f~~i~~Ay~~L~d~~~R~~YD~~~~~~~~  107 (149)
                      |+.|||+|||| +++++.++||++|++|++++|||+++...+.+.|+.|++||++|+||.+|..||+++.++..
T Consensus         1 m~~~~y~iLgv-~~~as~~~Ik~ayr~l~~~~HPD~~~~~~~~~~f~~i~~Ay~~L~d~~~R~~Yd~~~~~~~~   73 (77)
T 1hdj_A            1 MGKDYYQTLGL-ARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLK   73 (77)
T ss_dssp             CCCCSHHHHTC-CTTCCHHHHHHHHHHHHHTTCTTTCCCTTHHHHHHHHHHHHHHTTCHHHHHHHHHTCGGGCC
T ss_pred             CCCCHHHHcCC-CCCCCHHHHHHHHHHHHHHHCcCCCCCccHHHHHHHHHHHHHHHCCHHHHHHHHHHcccccc
Confidence            46799999999 99999999999999999999999998877899999999999999999999999999876654



>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 149
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 7e-08
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 3e-07
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 1e-06
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 4e-06
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 4e-05
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 4e-04
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 0.002
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Auxilin J-domain
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 45.3 bits (107), Expect = 7e-08
 Identities = 16/72 (22%), Positives = 31/72 (43%), Gaps = 6/72 (8%)

Query: 31 LPEMKSTRYDILAITDPEVDNITVKKQYKRLALMLHPEKNPS----IAAEGAFQIVQSAG 86
          L   ++ ++  + + D  V    VKK Y++  L++HP+K         A+  F  +  A 
Sbjct: 29 LWAGET-KWKPVGMAD-LVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAW 86

Query: 87 DVLTNPEKREAY 98
              N  ++  Y
Sbjct: 87 SEFENQGQKPLY 98


>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.92
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.88
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.85
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.8
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.79
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.75
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.73
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: HSP40
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93  E-value=7.5e-26  Score=146.38  Aligned_cols=73  Identities=34%  Similarity=0.501  Sum_probs=69.1

Q ss_pred             CccChhhhcCCCCCCCCHHHHHHHHHHHHHHhCCCCCCChhHHHHHHHHHHHHHhcCChhhHHHHhhhccccCC
Q 041597           34 MKSTRYDILAITDPEVDNITVKKQYKRLALMLHPEKNPSIAAEGAFQIVQSAGDVLTNPEKREAYYRRSFCSKK  107 (149)
Q Consensus        34 ~~~d~Y~iLgv~~~~as~~~Ik~ayr~l~~~~HPD~~~~~~a~~~f~~i~~Ay~~L~d~~~R~~YD~~~~~~~~  107 (149)
                      |.+|||+|||| +++|+.++|++||+++++++|||++....+.+.|..|++||+||+||.+|..||++|..+..
T Consensus         1 m~kdyY~iLgv-~~~as~~eIk~ay~~l~~~~hPD~~~~~~~~~~~~~i~~Ay~vLsdp~~R~~YD~~g~~~~~   73 (77)
T d1hdja_           1 MGKDYYQTLGL-ARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLK   73 (77)
T ss_dssp             CCCCSHHHHTC-CTTCCHHHHHHHHHHHHHTTCTTTCCCTTHHHHHHHHHHHHHHTTCHHHHHHHHHTCGGGCC
T ss_pred             CCCChHHHcCC-CCCcCHHHHHHHHHHHHHHhccccccchhHHHHHHHHHHHHHHhcCHHHHHHHHhhhhhhhc
Confidence            56899999999 99999999999999999999999998888999999999999999999999999999887764



>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure