Citrus Sinensis ID: 041634


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360---
MSSIGIEDTDAKLKINSELYNALMIKKDEQKVSELCRKVPDHALYVFTIHDDTVLLMATYTKKSDLVIKLLDELPDQSLDKMTRQNKAGNTIQHETATRRLVRKIDYNGNTILHMAGIKIKDYGSEKMEGPALLLRDELLWYERVKSVTMAHFLNHGNNMGFTPEELFATANNELRAQSKEWLIRTTEGCSVVAFAAAYTVPGGSDENTGYPILINHLFFVAFTVSDVLSLTFSLAAVVPFLSMLTSPFRLEDCKHSLPNKMILGFTFLLLSVCLMMVAFIATILLMIKSEESWAKIMLYTCTFIPVGVFALSYFPLYITKSVTRGLNYLRDKAKIFLPQWLVNIFCFSSNSFKVKATSSSIP
cccccccccHHHHHHcHHHHHHHHHcccHHHHHHHHHHccccccEEcccccccHHHHHHHcccHHHHHHHHHHcccccHHHHHcccccccHHHcccccccHHHccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHcccccccccccccccc
cccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEccccccccccccccccccHHHHEHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHccHHHHHHcccEEccHHEEEEEEccccccEEEEcccccc
mssigiedtdAKLKINSELYNALMIKKDEQKVSELCRKVPDHALYVFTIHDDTVLLMATYTKKSDLVIKLLDelpdqsldKMTRqnkagntiqhETATRRLVRKIDYNGNTILHMAGIKikdygsekmegpallLRDELLWYERVKSVTMAHFLnhgnnmgftpEELFATANNELRAQSKEWLIRTTEGCSVVAFAAAytvpggsdentgypiLINHLFFVAFTVSDVLSLTFSLAAVVpflsmltspfrledckhslpnkmiLGFTFLLLSVCLMMVAFIATILLMIKSEESWAKIMLYTCTFIpvgvfalsyfplyitKSVTRGLNYLRDKAKIFLPQWLVNIFCfssnsfkvkatsssip
mssigiedtdaklKINSELYNALMIKKDEQKVSELCRKVPDHALYVFTIHDDTVLLMATYTKKSDLVIKLLDELPDQSLDkmtrqnkagntiqhetatrrlvrkidyngntILHMAGIKIKDYGSEKMEGPALLLRDELLWYERVKSVTMAHFLNHGNNMGFTPEELFATANNELRAQSKEWLIRTTEGCSVVAFAAAYTVPGGSDENTGYPILINHLFFVAFTVSDVLSLTFSLAAVVPFLSMLTSPFRLEDCKHSLPNKMILGFTFLLLSVCLMMVAFIATILLMIKSEESWAKIMLYTCTFIPVGVFALSYFPLYITKSVTRGLNYLRDKAKIFLPQWLVNIFCFssnsfkvkatsssip
MSSIGIEDTDAKLKINSELYNALMIKKDEQKVSELCRKVPDHALYVFTIHDDTVLLMATYTKKSDLVIKLLDELPDQSLDKMTRQNKAGNTIQHETATRRLVRKIDYNGNTILHMAGIKIKDYGSEKMEGPALLLRDELLWYERVKSVTMAHFLNHGNNMGFTPEELFATANNELRAQSKEWLIRTTEGCSVVAFAAAYTVPGGSDENTGYPILINHLFFVAFTVSDVLSLTFSLAAVVPFLSMLTSPFRLEDCKHSLPNKMILGFTFLLLSVCLMMVAFIATILLMIKSEESWAKIMLYTCTFIPVGVFALSYFPLYITKSVTRGLNYLRDKAKIFLPQWLVNIFCFSSNSFKVKATSSSIP
************LKINSELYNALMIKKDEQKVSELCRKVPDHALYVFTIHDDTVLLMATYTKKSDLVIKLLDEL*********************TATRRLVRKIDYNGNTILHMAGIKIKDYGSEKMEGPALLLRDELLWYERVKSVTMAHFLNHGNNMGFTPEELFATANNELRAQSKEWLIRTTEGCSVVAFAAAYTVPGGSDENTGYPILINHLFFVAFTVSDVLSLTFSLAAVVPFLSMLTSPFRLEDCKHSLPNKMILGFTFLLLSVCLMMVAFIATILLMIKSEESWAKIMLYTCTFIPVGVFALSYFPLYITKSVTRGLNYLRDKAKIFLPQWLVNIFCFSSNS***********
*****************ELYNALMIKKDEQKVSELCRKVPDHALYVFTIHDDTVLLMATYTKKSDLVIKLLDELPDQSLDKMTRQNKAGNTIQHETATRRLVRKIDYNGNTILHMAGIKIKDYGSEKMEGPALLLRDELLWYERVKSVTMAHFLNHGNNMGFTPEELFATANNELRAQSKEWLIRTTEGCSVVAFAAAYTVPGGSDENTGYPILINHLFFVAFTVSDVLSLTFSLAAVVPFLSMLTSPFRLEDCKHSLPNKMILGFTFLLLSVCLMMVAFIATILLMIKSEESWAKIMLYTCTFIPVGVFALSYFPLYITKSVTRGLNYLRDKAKIFLPQWLVNIFCFSS*************
MSSIGIEDTDAKLKINSELYNALMIKKDEQKVSELCRKVPDHALYVFTIHDDTVLLMATYTKKSDLVIKLLDELPDQSLDKMTRQNKAGNTIQHETATRRLVRKIDYNGNTILHMAGIKIKDYGSEKMEGPALLLRDELLWYERVKSVTMAHFLNHGNNMGFTPEELFATANNELRAQSKEWLIRTTEGCSVVAFAAAYTVPGGSDENTGYPILINHLFFVAFTVSDVLSLTFSLAAVVPFLSMLTSPFRLEDCKHSLPNKMILGFTFLLLSVCLMMVAFIATILLMIKSEESWAKIMLYTCTFIPVGVFALSYFPLYITKSVTRGLNYLRDKAKIFLPQWLVNIFCFSSNSFK*********
***IGIEDTDAKLKINSELYNALMIKKDEQKVSELCRKVPDHALYVFTIHDDTVLLMATYTKKSDLVIKLLDELPDQSLDKMTRQNKAGNTIQHETATRRLVRKIDYNGNTILHMAGIKIKDYGSEKMEGPALLLRDELLWYERVKSVTMAHFLNHGNNMGFTPEELFATANNELRAQSKEWLIRTTEGCSVVAFAAAYTVPGGSDENTGYPILINHLFFVAFTVSDVLSLTFSLAAVVPFLSMLTSPFRLEDCKHSLPNKMILGFTFLLLSVCLMMVAFIATILLMIKSEESWAKIMLYTCTFIPVGVFALSYFPLYITKSVTRGLNYLRDKAKIFLPQWLVNIFCFSSNSFKVKATS**I*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSIGIEDTDAKLKINSELYNALMIKKDEQKVSELCRKVPDHALYVFTIHDDTVLLMATYTKKSDLVIKLLDELPDQSLDKMTRQNKAGNTIQHETATRRLVRKIDYNGNTILHMAGIKIKDYGSEKMEGPALLLRDELLWYERVKSVTMAHFLNHGNNMGFTPEELFATANNELRAQSKEWLIRTTEGCSVVAFAAAYTVPGGSDENTGYPILINHLFFVAFTVSDVLSLTFSLAAVVPFLSMLTSPFRLEDCKHSLPNKMILGFTFLLLSVCLMMVAFIATILLMIKSEESWAKIMLYTCTFIPVGVFALSYFPLYITKSVTRGLNYLRDKAKIFLPQWLVNIFCFSSNSFKVKATSSSIP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query363 2.2.26 [Sep-21-2011]
Q9C7A2590 Ankyrin repeat-containing no no 0.658 0.405 0.263 9e-07
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function desciption
 Score = 55.1 bits (131), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 126/285 (44%), Gaps = 46/285 (16%)

Query: 52  DTVLLMATYTKKSDLVIKLLDELPDQSLDKMTRQNKAGNTIQHETATRRLVRKIDYNGNT 111
           +T L +AT  K++++V +LL  LPD + + +TR +K    I        L  +  Y    
Sbjct: 301 NTALHVATRKKRAEIV-ELLLSLPDTNANTLTRDHKTALDIAEGLP---LSEESSYIKEC 356

Query: 112 ILHMAGIKIKDYGSEKMEGPALLLRDELLWYERVKSVTMAHFLNHGNNMGFTPEELFATA 171
           +     ++     + ++  P    RDEL       +VT        N++    E+   T 
Sbjct: 357 LARSGALR-----ANELNQP----RDELR-----STVTQIK-----NDVHIQLEQTKRTN 397

Query: 172 NN------ELRAQSKEWLIRTTEGCSVVA-------FAAAYTVPGGSDENTGYPILINHL 218
            N      ELR   +E +   T   +VVA       FAA +TVPGG D N G  +++   
Sbjct: 398 KNVHNISKELRKLHREGINNATNSVTVVAVLFATVAFAAIFTVPGG-DNNDGSAVVVGRA 456

Query: 219 FFVAFTVSDVLSLTFSLAAVVPFLSMLTSPFRLEDCKHSLPNKMILGFTFLLLSVCLMMV 278
            F  F + + L+L  SLA VV  ++++    + E     + NK++      L S+C   V
Sbjct: 457 SFKIFFIFNALALFTSLAVVVVQITLVRGETKAEKRVVEVINKLM-----WLASMC-TSV 510

Query: 279 AFIATILLMIKSEESW-AKIMLYTCTFIPVGVFALSYFPLYITKS 322
           AF+A+  +++  +  W A+++      I  GV  L     Y+ KS
Sbjct: 511 AFLASSYIVVGRKNEWAAELVTVVGGVIMAGV--LGTMTYYVVKS 553





Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query363
224115944 579 predicted protein [Populus trichocarpa] 0.630 0.395 0.654 4e-82
224115930 551 predicted protein [Populus trichocarpa] 0.746 0.491 0.551 1e-77
224115926370 predicted protein [Populus trichocarpa] 0.823 0.808 0.483 2e-73
359496086 1514 PREDICTED: uncharacterized protein LOC10 0.730 0.175 0.481 5e-69
359496761 490 PREDICTED: ankyrin repeat-containing pro 0.730 0.540 0.481 8e-69
147841570 636 hypothetical protein VITISV_039462 [Viti 0.730 0.416 0.481 9e-69
224115932 581 predicted protein [Populus trichocarpa] 0.559 0.349 0.609 4e-68
296080840 493 unnamed protein product [Vitis vinifera] 0.630 0.464 0.542 6e-68
224115940 581 predicted protein [Populus trichocarpa] 0.559 0.349 0.604 1e-67
359497521 512 PREDICTED: ankyrin repeat-containing pro 0.862 0.611 0.424 1e-65
>gi|224115944|ref|XP_002317167.1| predicted protein [Populus trichocarpa] gi|222860232|gb|EEE97779.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  311 bits (797), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 155/237 (65%), Positives = 185/237 (78%), Gaps = 8/237 (3%)

Query: 99  RRLVRKIDYNGNTILHMAGIKIKDYGS-EKMEGPALLLRDELLWYERVKSVTMAHFLNHG 157
           +RL RKID +GN+ILH  G K KD+ S EKMEGPA LL++ELLW+ERVK VT +HFLNH 
Sbjct: 312 KRLTRKIDGDGNSILHTVGRKRKDFVSDEKMEGPAFLLQEELLWFERVKEVTPSHFLNHQ 371

Query: 158 NNMGFTPEELFATANNELRAQSKEWLIRTTEGCSVVA-------FAAAYTVPGGSDENTG 210
           NNM  T E  F TAN+ELR  +KEWL  T EGCSVVA       FAAAYTVPGG +++TG
Sbjct: 372 NNMKLTAEGYFITANSELRNLAKEWLKTTAEGCSVVAVLIATVAFAAAYTVPGGPNQSTG 431

Query: 211 YPILINHLFFVAFTVSDVLSLTFSLAAVVPFLSMLTSPFRLEDCKHSLPNKMILGFTFLL 270
            P+L+N  FFV FTV+DVLSLTF+L +VV FLS+LTSPFR +D KH+LPNK+++GFTFL 
Sbjct: 432 VPVLVNKPFFVVFTVTDVLSLTFALTSVVTFLSILTSPFRFKDFKHTLPNKLMVGFTFLF 491

Query: 271 LSVCLMMVAFIATILLMIKSEESWAKIMLYTCTFIPVGVFALSYFPLYITKSVTRGL 327
           LSV +MMVAF ATI+LMI S+ESW KI LY  +FIPVG+FALSYFPLY + S T  L
Sbjct: 492 LSVAMMMVAFGATIILMIYSKESWTKITLYAVSFIPVGIFALSYFPLYPSLSKTYNL 548




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224115930|ref|XP_002317163.1| predicted protein [Populus trichocarpa] gi|222860228|gb|EEE97775.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224115926|ref|XP_002317161.1| predicted protein [Populus trichocarpa] gi|222860226|gb|EEE97773.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359496086|ref|XP_003635148.1| PREDICTED: uncharacterized protein LOC100853163 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496761|ref|XP_003635326.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147841570|emb|CAN77609.1| hypothetical protein VITISV_039462 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224115932|ref|XP_002317164.1| predicted protein [Populus trichocarpa] gi|222860229|gb|EEE97776.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296080840|emb|CBI18764.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224115940|ref|XP_002317166.1| predicted protein [Populus trichocarpa] gi|222860231|gb|EEE97778.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359497521|ref|XP_003635551.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query363
TAIR|locus:2175448603 AT5G04730 "AT5G04730" [Arabido 0.691 0.416 0.338 9.3e-30
TAIR|locus:2180228625 AT5G04690 "AT5G04690" [Arabido 0.578 0.336 0.309 1e-27
TAIR|locus:2175413669 AT5G04700 "AT5G04700" [Arabido 0.578 0.313 0.333 4.7e-27
TAIR|locus:2080240574 AT3G54070 "AT3G54070" [Arabido 0.570 0.360 0.308 1.2e-26
TAIR|locus:2165174347 AT5G35810 "AT5G35810" [Arabido 0.650 0.680 0.281 7.6e-25
TAIR|locus:2075009607 AT3G09550 [Arabidopsis thalian 0.374 0.224 0.280 4.6e-08
TAIR|locus:2092522590 ITN1 "INCREASED TOLERANCE TO N 0.713 0.438 0.249 1.3e-07
TAIR|locus:2020833616 AT1G03670 "AT1G03670" [Arabido 0.680 0.400 0.252 0.00039
TAIR|locus:2026489543 AT1G07710 "AT1G07710" [Arabido 0.278 0.186 0.293 0.00053
TAIR|locus:2175448 AT5G04730 "AT5G04730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 320 (117.7 bits), Expect = 9.3e-30, Sum P(2) = 9.3e-30
 Identities = 91/269 (33%), Positives = 142/269 (52%)

Query:    84 RQNKAGNTIQHETATRR--LVRKIDYNGNTILHMAG-IKIKDYGSEKMEGPALLLRDELL 140
             ++ K  N I H    R+  L+R  D   N ILH+AG +   D  S K+ G AL ++ E  
Sbjct:   340 KKEKIFNLI-HGLDDRKVTLLRSYDKGNNNILHIAGRLSTPDQLS-KISGAALKMQRESQ 397

Query:   141 WYERVKSVTMAHFLNHGNNMGFTPEELFATANNELRAQSKEWLIRTTEGCSVVA------ 194
             W++ V+S+     +   N    TP ++F   +  LR + +EW+  T   CS VA      
Sbjct:   398 WFKEVESLVSEREVVQKNKDNKTPRQIFEHYHEHLRKEGEEWMKYTATACSFVAALIATV 457

Query:   195 -FAAAYTVPGGSDENTGYPILINHLFFVAFTVSDVLSLTFSLAAVVPFLSMLTSPFRLED 253
              F A +TVPGG D  +G P+++N L F AF  +D L+   S  +V+ FLS+LTS +  +D
Sbjct:   458 TFQAIFTVPGGIDGTSGSPLILNDLHFRAFIFTDTLAFFASCISVLIFLSILTSRYSFDD 517

Query:   254 CKHSLPNKMILGFTFLLLSVCLMMVAFIATILLMIKSEESWAKIMLYTCTFIPVGVFALS 313
                SLP KMILG + L +S+  M+VAFI ++   ++ + +    +    +F P  +F + 
Sbjct:   518 FIVSLPRKMILGQSILFISIASMLVAFITSLSASMRHKPALVYPLKPLASF-PSLLFLML 576

Query:   314 YFPLY---ITKSVTRGLNYLRDKAKIFLP 339
              +PL    I+ +  + L Y RD  K +LP
Sbjct:   577 QYPLLKEMISSTYGKRLFY-RD-TKNWLP 603


GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2180228 AT5G04690 "AT5G04690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175413 AT5G04700 "AT5G04700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080240 AT3G54070 "AT3G54070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165174 AT5G35810 "AT5G35810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075009 AT3G09550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092522 ITN1 "INCREASED TOLERANCE TO NACL" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020833 AT1G03670 "AT1G03670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026489 AT1G07710 "AT1G07710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00110147
hypothetical protein (579 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query363
pfam13962114 pfam13962, PGG, Domain of unknown function 3e-17
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information
 Score = 76.4 bits (189), Expect = 3e-17
 Identities = 41/118 (34%), Positives = 55/118 (46%), Gaps = 20/118 (16%)

Query: 180 KEWLIRTTEGCSVVA-------FAAAYTVPGG-----SDENTGYPILINHL-FFVAFTVS 226
            EWL +T     VVA       FAA +T PGG        + G PIL      F AF VS
Sbjct: 1   SEWLEKTRNSLLVVATLIATVTFAAGFTPPGGYWQDDGGHHAGTPILAGKPRRFKAFFVS 60

Query: 227 DVLSLTFSLAAVVPFLSMLTSPFRLEDCKHSLPNKMILGFTFLLLSVCLMMVAFIATI 284
           + ++   SL AV+  L ++ S  R       LP +++   T L LS+  +MVAF A  
Sbjct: 61  NTIAFVASLVAVILLLYIVPSFSR------RLP-RLLALLTLLWLSLLSLMVAFAAGS 111


The PGG domain is named for the highly conserved sequence motif found at the startt of the domain. The function is not known. Length = 114

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 363
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.83
PF13962113 PGG: Domain of unknown function 99.81
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.79
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.75
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.68
PHA02874434 ankyrin repeat protein; Provisional 99.68
PHA02946446 ankyin-like protein; Provisional 99.66
PHA02859209 ankyrin repeat protein; Provisional 99.65
PHA02878477 ankyrin repeat protein; Provisional 99.64
PHA02876682 ankyrin repeat protein; Provisional 99.64
KOG0510 929 consensus Ankyrin repeat protein [General function 99.63
PHA02874434 ankyrin repeat protein; Provisional 99.63
PHA03095471 ankyrin-like protein; Provisional 99.63
PHA02875413 ankyrin repeat protein; Provisional 99.63
PHA02876682 ankyrin repeat protein; Provisional 99.62
KOG0510 929 consensus Ankyrin repeat protein [General function 99.62
PHA02791284 ankyrin-like protein; Provisional 99.61
PHA02875413 ankyrin repeat protein; Provisional 99.61
PHA02791284 ankyrin-like protein; Provisional 99.6
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.6
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.59
PHA02878477 ankyrin repeat protein; Provisional 99.59
PLN03192823 Voltage-dependent potassium channel; Provisional 99.59
PHA02743166 Viral ankyrin protein; Provisional 99.59
PHA03100480 ankyrin repeat protein; Provisional 99.59
PHA02859209 ankyrin repeat protein; Provisional 99.58
PHA02798489 ankyrin-like protein; Provisional 99.57
PHA02989494 ankyrin repeat protein; Provisional 99.56
PHA02741169 hypothetical protein; Provisional 99.55
PHA03095471 ankyrin-like protein; Provisional 99.53
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.51
PHA02946446 ankyin-like protein; Provisional 99.51
PHA02741169 hypothetical protein; Provisional 99.51
PHA03100480 ankyrin repeat protein; Provisional 99.5
PHA02736154 Viral ankyrin protein; Provisional 99.49
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.47
PHA02795437 ankyrin-like protein; Provisional 99.46
PHA02884300 ankyrin repeat protein; Provisional 99.46
KOG0508 615 consensus Ankyrin repeat protein [General function 99.44
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.38
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.38
PHA02736154 Viral ankyrin protein; Provisional 99.38
PHA02989494 ankyrin repeat protein; Provisional 99.35
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.35
PHA02798489 ankyrin-like protein; Provisional 99.34
KOG0514452 consensus Ankyrin repeat protein [General function 99.34
PHA02743166 Viral ankyrin protein; Provisional 99.32
KOG0508 615 consensus Ankyrin repeat protein [General function 99.32
PHA02795437 ankyrin-like protein; Provisional 99.31
PHA02917 661 ankyrin-like protein; Provisional 99.3
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.29
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.27
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.27
PHA02730 672 ankyrin-like protein; Provisional 99.26
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.25
PHA02884300 ankyrin repeat protein; Provisional 99.21
PHA02730672 ankyrin-like protein; Provisional 99.2
PHA02792 631 ankyrin-like protein; Provisional 99.19
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.18
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.18
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.15
PHA02917 661 ankyrin-like protein; Provisional 99.13
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.13
PLN03192823 Voltage-dependent potassium channel; Provisional 99.12
PHA02792 631 ankyrin-like protein; Provisional 99.1
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.09
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.08
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.04
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.02
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.0
KOG0502296 consensus Integral membrane ankyrin-repeat protein 98.97
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 98.97
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 98.93
KOG0514452 consensus Ankyrin repeat protein [General function 98.86
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 98.86
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.86
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 98.84
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 98.73
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 98.69
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.66
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 98.63
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 98.63
KOG4214117 consensus Myotrophin and similar proteins [Transcr 98.54
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 98.53
PF1360630 Ank_3: Ankyrin repeat 98.43
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.34
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.29
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.29
KOG4214117 consensus Myotrophin and similar proteins [Transcr 98.27
KOG0522 560 consensus Ankyrin repeat protein [General function 98.17
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 98.16
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.02
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 97.87
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 97.82
KOG0705749 consensus GTPase-activating protein Centaurin gamm 97.68
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 97.65
KOG0783 1267 consensus Uncharacterized conserved protein, conta 97.63
KOG0520975 consensus Uncharacterized conserved protein, conta 97.45
KOG0783 1267 consensus Uncharacterized conserved protein, conta 97.14
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 97.06
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 97.06
KOG0521785 consensus Putative GTPase activating proteins (GAP 96.72
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 96.69
KOG0522 560 consensus Ankyrin repeat protein [General function 96.66
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.46
KOG2384223 consensus Major histocompatibility complex protein 96.29
PF1360630 Ank_3: Ankyrin repeat 96.11
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 96.02
KOG0511 516 consensus Ankyrin repeat protein [General function 95.79
KOG0521785 consensus Putative GTPase activating proteins (GAP 95.78
KOG0705749 consensus GTPase-activating protein Centaurin gamm 95.45
KOG0520975 consensus Uncharacterized conserved protein, conta 95.35
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 94.47
KOG2505591 consensus Ankyrin repeat protein [General function 92.13
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 87.89
KOG2384223 consensus Major histocompatibility complex protein 85.7
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.83  E-value=2.9e-21  Score=166.68  Aligned_cols=144  Identities=22%  Similarity=0.118  Sum_probs=114.6

Q ss_pred             CCCCccccccccccHHHHHHHHccCChHHHHHHhhcCCCCcccccCcCCCcHHhHHHhcCcHHHHHHHHHh-CCCCchhh
Q 041634            3 SIGIEDTDAKLKINSELYNALMIKKDEQKVSELCRKVPDHALYVFTIHDDTVLLMATYTKKSDLVIKLLDE-LPDQSLDK   81 (363)
Q Consensus         3 ~~~~~~~~~~~~ln~~Lh~A~~~~g~~~~v~~lL~~~~~~~~~~~d~~G~TpLh~Aa~~G~~eiV~~LL~~-~p~~~~~~   81 (363)
                      +|-.-...++|+..++||.|+.- |..+ ++++|++.++..++..|..|+||||+||..|+.|+|+.|+.+ +|| .+  
T Consensus        26 ~~kSL~~r~dqD~Rt~LHwa~S~-g~~e-iv~fLlsq~nv~~ddkDdaGWtPlhia~s~g~~evVk~Ll~r~~ad-vn--  100 (226)
T KOG4412|consen   26 DPKSLNARDDQDGRTPLHWACSF-GHVE-IVYFLLSQPNVKPDDKDDAGWTPLHIAASNGNDEVVKELLNRSGAD-VN--  100 (226)
T ss_pred             ChhhhhccccccCCceeeeeeec-Cchh-HHHHHHhcCCCCCCCccccCCchhhhhhhcCcHHHHHHHhcCCCCC-cc--
Confidence            44344456677888999999987 7766 556666567788888899999999999999999999999999 888 55  


Q ss_pred             hhccCCCCCcHHHHHHh-------------chhhccccCCCCcHHHHHHhhCcccCccccCCchhhhHHHHHHHHHhhhh
Q 041634           82 MTRQNKAGNTIQHETAT-------------RRLVRKIDYNGNTILHMAGIKIKDYGSEKMEGPALLLRDELLWYERVKSV  148 (363)
Q Consensus        82 ~~~~d~~G~t~LH~Aa~-------------~~lin~~D~~GnT~LHlAa~~~~~~~~~~~~~~al~l~~~l~~~~~V~~~  148 (363)
                        ..++.|+|+||+|+-             ++.++.+|..|.||||-||..|..+++            +++..++.   
T Consensus       101 --a~tn~G~T~LHyAagK~r~eIaqlLle~ga~i~~kD~~~qtplHRAAavGklkvi------------e~Li~~~a---  163 (226)
T KOG4412|consen  101 --ATTNGGQTCLHYAAGKGRLEIAQLLLEKGALIRIKDKQGQTPLHRAAAVGKLKVI------------EYLISQGA---  163 (226)
T ss_pred             --eecCCCcceehhhhcCChhhHHHHHHhcCCCCcccccccCchhHHHHhccchhhH------------HHHHhcCC---
Confidence              689999999999996             678899999999999999999976544            22222222   


Q ss_pred             ccccccccCCCCCCCHHHHH-HHhc
Q 041634          149 TMAHFLNHGNNMGFTPEELF-ATAN  172 (363)
Q Consensus       149 ~~~~~~~~~N~~G~Tp~dl~-~~~~  172 (363)
                          ..+..|+.|+||+..+ .+.|
T Consensus       164 ----~~n~qDk~G~TpL~~al~e~~  184 (226)
T KOG4412|consen  164 ----PLNTQDKYGFTPLHHALAEGH  184 (226)
T ss_pred             ----CCCcccccCccHHHHHHhccC
Confidence                2678899999998887 3344



>PF13962 PGG: Domain of unknown function Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query363
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 41.0 bits (95), Expect = 5e-04
 Identities = 39/243 (16%), Positives = 76/243 (31%), Gaps = 77/243 (31%)

Query: 1   MSSIGIEDTDAKLKINSELY----------NALMIKKD---EQKVSELCRKVPDHALYVF 47
           MS I  E     +   + +Y          N +  K +    Q   +L R+    AL   
Sbjct: 95  MSPIKTEQRQPSM--MTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKL-RQ----ALLEL 147

Query: 48  TIHDDTVLL-MATYTKKSDLVIK-LLDELPDQSLD------KMTRQNKAGNTIQHETATR 99
               + ++  +   + K+ + +   L       +D       +   N     ++     +
Sbjct: 148 RPAKNVLIDGVLG-SGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEM---LQ 203

Query: 100 RLVRKIDYNGNTIL-HMAGIK-----IKDYGSEKMEGP----ALL-LRDELLWYERV--- 145
           +L+ +ID N  +   H + IK     I+      ++       LL L +  +   +    
Sbjct: 204 KLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLN--VQNAKAWNA 261

Query: 146 -------------KSVT-------MAHF-LNHGNNMGFTPEE---LFA----TANNELRA 177
                        K VT         H  L+H ++M  TP+E   L          +L  
Sbjct: 262 FNLSCKILLTTRFKQVTDFLSAATTTHISLDH-HSMTLTPDEVKSLLLKYLDCRPQDLPR 320

Query: 178 QSK 180
           +  
Sbjct: 321 EVL 323


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query363
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.85
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.8
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.8
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.79
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.79
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.79
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.78
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.78
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.77
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.77
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.77
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.77
2rfa_A232 Transient receptor potential cation channel subfa 99.76
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.76
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.76
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.76
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.76
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.75
3hra_A201 Ankyrin repeat family protein; structural protein; 99.75
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.75
2rfa_A232 Transient receptor potential cation channel subfa 99.75
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.74
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.74
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.74
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.74
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.74
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.74
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.73
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.73
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.73
3hra_A201 Ankyrin repeat family protein; structural protein; 99.72
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.72
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.72
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.72
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.72
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.72
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.71
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.71
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.71
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.71
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.71
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.7
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.7
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.7
2etb_A256 Transient receptor potential cation channel subfam 99.7
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.7
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.7
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.69
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.69
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.69
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.68
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.68
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.68
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.68
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.68
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.67
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.67
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.67
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.67
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.67
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.67
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.66
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.66
2etb_A256 Transient receptor potential cation channel subfam 99.66
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.66
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.66
2pnn_A273 Transient receptor potential cation channel subfa 99.66
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.66
2pnn_A273 Transient receptor potential cation channel subfa 99.66
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.65
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.65
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.65
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.65
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.64
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.64
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.64
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.63
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.63
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.63
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.63
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.62
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.62
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.62
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.61
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.61
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.61
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.61
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.61
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.6
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.59
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.59
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.58
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.58
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.57
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.57
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.56
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.54
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.54
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.53
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.53
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.52
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.51
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.51
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.51
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.48
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.45
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.44
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.42
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.37
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.29
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.27
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.2
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.19
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.16
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.85  E-value=7e-21  Score=166.09  Aligned_cols=135  Identities=22%  Similarity=0.205  Sum_probs=111.0

Q ss_pred             cccHHHHHHHHccCChHHHHHHhhcCCCCcccccCcCCCcHHhHHHhcCcHHHHHHHHHhCCCCchhhhhccCCCCCcHH
Q 041634           14 KINSELYNALMIKKDEQKVSELCRKVPDHALYVFTIHDDTVLLMATYTKKSDLVIKLLDELPDQSLDKMTRQNKAGNTIQ   93 (363)
Q Consensus        14 ~ln~~Lh~A~~~~g~~~~v~~lL~~~~~~~~~~~d~~G~TpLh~Aa~~G~~eiV~~LL~~~p~~~~~~~~~~d~~G~t~L   93 (363)
                      +++++|+.|+.. |+.+.|..|+..  +.+++.+|.+|.||||.|+..|+.++++.|++.+++ +.    .+|.+|+|||
T Consensus         3 dlg~~L~~Aa~~-G~~~~v~~Ll~~--Gadvn~~d~~g~t~l~~a~~~~~~~~~~~ll~~gad-~~----~~d~~g~TpL   74 (169)
T 4gpm_A            3 ELGKRLIEAAEN-GNKDRVKDLIEN--GADVNASDSDGRTPLHHAAENGHKEVVKLLISKGAD-VN----AKDSDGRTPL   74 (169)
T ss_dssp             HHHHHHHHHHHT-TCHHHHHHHHHT--TCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCC-TT----CCCTTSCCHH
T ss_pred             HHHHHHHHHHHc-CCHHHHHHHHHC--CCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHhcccc-hh----hhccCCCCHH
Confidence            456789999998 998877776654  678899999999999999999999999999999998 54    6899999999


Q ss_pred             HHHHh-------------chhhccccCCCCcHHHHHHhhCcccCccccCCchhhhHHHHHHHHHhhhhccccccccCCCC
Q 041634           94 HETAT-------------RRLVRKIDYNGNTILHMAGIKIKDYGSEKMEGPALLLRDELLWYERVKSVTMAHFLNHGNNM  160 (363)
Q Consensus        94 H~Aa~-------------~~lin~~D~~GnT~LHlAa~~~~~~~~~~~~~~al~l~~~l~~~~~V~~~~~~~~~~~~N~~  160 (363)
                      |+|+.             +..+|.+|.+|+||||+|++.|+.+++            +++....+       ..+.+|++
T Consensus        75 h~A~~~g~~~~v~~Ll~~gadvn~~d~~G~TpLh~A~~~g~~~~v------------~~Ll~~ga-------d~~~~d~~  135 (169)
T 4gpm_A           75 HHAAENGHKEVVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVV------------KLLISKGA-------DVNTSDSD  135 (169)
T ss_dssp             HHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHH------------HHHHHTTC-------CTTCCCTT
T ss_pred             HHHHHcCCHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCCHHHH------------HHHHHcCC-------CccccCCC
Confidence            99998             567899999999999999999976554            12211122       25788999


Q ss_pred             CCCHHHHHHHh-cHHH
Q 041634          161 GFTPEELFATA-NNEL  175 (363)
Q Consensus       161 G~Tp~dl~~~~-~~~l  175 (363)
                      |+||++++.+. +.++
T Consensus       136 G~TpL~~A~~~g~~~i  151 (169)
T 4gpm_A          136 GRTPLDLAREHGNEEV  151 (169)
T ss_dssp             SCCHHHHHHHTTCHHH
T ss_pred             CCCHHHHHHHcCCHHH
Confidence            99999998764 4443



>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query363
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.78
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.78
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.76
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.76
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.75
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.72
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.71
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.7
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.7
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.68
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.64
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.64
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.64
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.64
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.61
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.59
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.57
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.56
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.52
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.48
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.44
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.44
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.44
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.42
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.41
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.41
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.4
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.39
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.34
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.33
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.31
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.16
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.78  E-value=3.4e-19  Score=160.39  Aligned_cols=157  Identities=20%  Similarity=0.079  Sum_probs=110.9

Q ss_pred             ccccHHHHHHHHccCChHHHHHHhhcC-CCCcccccCcCCCcHHhHHHhcCcHHHHHHHHHhCCCCchhhhhccCCCCCc
Q 041634           13 LKINSELYNALMIKKDEQKVSELCRKV-PDHALYVFTIHDDTVLLMATYTKKSDLVIKLLDELPDQSLDKMTRQNKAGNT   91 (363)
Q Consensus        13 ~~ln~~Lh~A~~~~g~~~~v~~lL~~~-~~~~~~~~d~~G~TpLh~Aa~~G~~eiV~~LL~~~p~~~~~~~~~~d~~G~t   91 (363)
                      ++++++||+|+.. |+.+.+..++... ....++.+|.+|.||||+|+..|+.++++.|++.+++ +.    .+|++|+|
T Consensus         7 ~~G~t~Lh~A~~~-~~~~~v~~Ll~~~a~~~~i~~~~~~g~TpL~~A~~~g~~~iv~~Ll~~ga~-i~----~~d~~g~t   80 (255)
T d1oy3d_           7 EDGDTALHLAVIH-QHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAG-VL----VAERGGHT   80 (255)
T ss_dssp             TTCCCHHHHHHHT-TCHHHHHHHHHHHTTSGGGGCCCTTSCCHHHHHHHHTCHHHHHHHHHTTCC-SS----CCCTTSCC
T ss_pred             cCCCCHHHHHHHc-CCHHHHHHHHHcCCCcccccCcCCCCCCccchHHhhccccccccccccccc-cc----ccccccch
Confidence            4578999999998 8877555444432 2234678899999999999999999999999999988 44    68999999


Q ss_pred             HHHHHHh------------------------------------------------------------chhhccccCCCCc
Q 041634           92 IQHETAT------------------------------------------------------------RRLVRKIDYNGNT  111 (363)
Q Consensus        92 ~LH~Aa~------------------------------------------------------------~~lin~~D~~GnT  111 (363)
                      |||+|+.                                                            +..++.+|.+|.|
T Consensus        81 pL~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~in~~d~~g~T  160 (255)
T d1oy3d_          81 ALHLACRVRAHTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHT  160 (255)
T ss_dssp             HHHHHTTTTCHHHHHHHSSSCCSSCCCC-----------------------------------CCCGGGGTTCCCTTSCC
T ss_pred             hhhhhhccCchHHHHHHHhhccchhcccchhhhhHHhhhcccchHHHHHHHhhcchhHHHHHHhhhcCcccccccccCcc
Confidence            9999996                                                            3456789999999


Q ss_pred             HHHHHHhhCcccCcccc--------------CCchhhhHHHHHHHHHhhhhccc-cccccCCCCCCCHHHHHHH-hcHHH
Q 041634          112 ILHMAGIKIKDYGSEKM--------------EGPALLLRDELLWYERVKSVTMA-HFLNHGNNMGFTPEELFAT-ANNEL  175 (363)
Q Consensus       112 ~LHlAa~~~~~~~~~~~--------------~~~al~l~~~l~~~~~V~~~~~~-~~~~~~N~~G~Tp~dl~~~-~~~~l  175 (363)
                      |||+|++.++.++++.+              +.+++...-.....+.++-.+.. ..++.+|++|+||++++.. .+.++
T Consensus       161 pLh~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~TpL~~A~~~~~~~~v~~Ll~~gadin~~d~~g~t~L~~A~~~~~~~i  240 (255)
T d1oy3d_         161 PLHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPNPIL  240 (255)
T ss_dssp             HHHHHHHTTCHHHHHHHHHHTCCTTCCCTTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHTSSCHHH
T ss_pred             cccccccccccccccchhcccccccccccccccccccccccccHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCHHH
Confidence            99999999877654211              22344332222222223222111 1457788888888888654 34443



>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure