Citrus Sinensis ID: 041643


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570------
MAATVTHVASAVVVEEEKSQSLQEELSLPILLADRVIKSAQEAESSKQECAELRKQVERLSQMLRSCVRLATSSQPLYERPIRRVAADVAKNLDRSLTLVRRCKHAGVLRHVFSITTNADFKKVFSLLESSIGDMRWLLTIFDSDEVNLSLPPIASNDPILAWVWSFISTIQMGQIKSRVDAANELASLARDNNRNRKIIVEEGGILPLLKLLKEAASPDAQTAAANALFNIATDQETVRFIVDVLGVPIIVSVLGEAPVKVQVAVANLVARMAELDSIAQEEFVRENVTRSLISLLCMDIALDLPKPESAKTTIHSLVQMKKEMTEKSTNVTNNSDGSSRGGHGQHYNKKDRELETPEVKAKVRIACAEALWKLSKGCLLSLWSAESNAELRRSAFKTNSPAAKAVLDQLLRLIHEESDAMLQTPAIRSIGCLAKTFPAKEKRMIGPLVALLSNRNVDVATEAVIALSKFVSPDNFNRSEHSKAIIEFDGVPPLMRLLKISDRAQVHGLVFLCYLALSAGNSKALEQARALNALEGAARTVLPQHPELRDLFAQAIYHLTLYQAGSHPHRQTYAP
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccHHHHHHHHccccHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccc
cccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHEEEcccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHcccccHccHHHccccHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHcccHHHHHHHHccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccc
MAATVTHVASAVVVEEEKSQSLQEELSLPILLADRVIKSAQEAESSKQECAELRKQVERLSQMLRSCVRLatssqplyerpIRRVAADVAKNLDRSLTLVRRCKHAGVLRHVFSITTNADFKKVFSLLESSIGDMRWLLTIfdsdevnlslppiasndpiLAWVWSFISTIQMGQIKSRVDAANELASLArdnnrnrkiIVEEGGILPLLKLLKEAASPDAQTAAANALFNIATDQETVRFIVDVLGVPIIVSVLGEAPVKVQVAVANLVARMAELDSIAQEEFVRENVTRSLISLLCMDIaldlpkpesaktTIHSLVQMKKEMTEkstnvtnnsdgssrgghgqhynkkdreletpeVKAKVRIACAEALWKLSKGCLLSLWSAESNAELRRSAFKTNSPAAKAVLDQLLRLIHEESdamlqtpairsigclaktfpakekrmigPLVALLSNRNVDVATEAVIALSKfvspdnfnrsehskaiiefdgvpplmRLLKISDRAQVHGLVFLCYLALSAGNSKALEQARALNALEGAartvlpqhpelRDLFAQAIYHLTLyqagshphrqtyap
maatvthvasavvveeeksqslqeelSLPILLADRVIKSAQEAESSKQECAELRKQVERLSQMLRSCVRlatssqplyerpiRRVAADVAKNLDRSLTLVRRCkhagvlrhvfsittnadfKKVFSLLESSIGDMRWLLTIFDSDEVNLSLPPIASNDPILAWVWSFISTIQMGQIKSRVDAANELAslardnnrnrkiIVEEGGILPLLKLLKEAASPDAQTAAANALFNIATDQETVRFIVDVLGVPIIVSVLGEAPVKVQVAVANLVARMAELDSIAQEEFVRENVTRSLISLLCMDIALDLPKPESAKTTIHSLVQMKKEMTEKStnvtnnsdgssrgghgqhynkkdreletpeVKAKVRIACAEALWKLSKGCLLSLWSAESNAELRRSAFKTNSPAAKAVLDQLLRLIHEESDamlqtpaiRSIGCLAKTFPAKEKRMIGPLVALLSNRNVDVATEAVIALskfvspdnfnrSEHSKAIIEFDGVPPLMRLLKISDRAQVHGLVFLCYLALSAGNSKALEQARALNALEGAARTVLPQHPELRDLFAQAIYHLTLYqagshphrqtyap
MaatvthvasavvveeeksqslqeelslPILLADRVIKSAQEAESSKQECAELRKQVERLSQMLRSCVRLATSSQPLYERPIRRVAADVAKNLDRSLTLVRRCKHAGVLRHVFSITTNADFKKVFSLLESSIGDMRWLLTIFDSDEVNLSLPPIASNDPILAWVWSFISTIQMGQIKSRVDAANELASLARDNNRNRKIIVEEGGILPLLKLLKEAASPDAQTAAANALFNIATDQETVRFIVDVLGVPIIVSVLGEAPVKVQVAVANLVARMAELDSIAQEEFVRENVTRSLISLLCMDIALDLPKPESAKTTIHSLVQMKKEMTEKSTNVTNNSDGSSRGGHGQHYNKKDRELETPEVKAKVRIACAEALWKLSKGCLLSLWSAESNAELRRSAFKTNSPAAKAVLDQLLRLIHEESDAMLQTPAIRSIGCLAKTFPAKEKRMIGPLVALLSNRNVDVATEAVIALSKFVSPDNFNRSEHSKAIIEFDGVPPLMRLLKISDRAQVHGLVFLCYLALSAGNSKALEQARALNALEGAARTVLPQHPELRDLFAQAIYHLTLYQAGSHPHRQTYAP
****************************PILLAD*****************************LRSCVRLATSSQPLYERPIRRVAADVAKNLDRSLTLVRRCKHAGVLRHVFSITTNADFKKVFSLLESSIGDMRWLLTIFDSDEVNLSLPPIASNDPILAWVWSFISTIQMGQIKSRVDAANELASLARDNNRNRKIIVEEGGILPLLKLLKEAASPDAQTAAANALFNIATDQETVRFIVDVLGVPIIVSVLGEAPVKVQVAVANLVARMAELDSIAQEEFVRENVTRSLISLLCMDIALDL*******************************************************KAKVRIACAEALWKLSKGCLLSLWSAES***************AKAVLDQLLRLIHEESDAMLQTPAIRSIGCLAKTFPAKEKRMIGPLVALLSNRNVDVATEAVIALSKFVSPDNFNRSEHSKAIIEFDGVPPLMRLLKISDRAQVHGLVFLCYLALSAGNSKALEQARALNALEGAARTVLPQHPELRDLFAQAIYHLTLYQA***********
************************ELSLPILLADRVIKSAQEAESSKQECAELRKQVERLSQMLRSCVRLATSSQPLYERPIRRVAADVAKNLDRS**********GVLRHVFSITTNADFKKVFSLLESSIGDMRWLLTIFDSDEVNLSLPPIASNDPILAWVWSFISTIQMGQIKSRVDAANELASLARDNNRNRKIIVEEGGILPLLKLLKEAASPDAQTAAANALFNIATDQETVRFIVDVLGVPIIVSVLGEAPVKVQVAVANLVARMAELDSIAQEEFVRENVTRSLISLLCMDIALDLPKPESAKTTIHSLVQMKK***********************************EVKAKVRIACAEALWKLSKGCLLSLWSAESNAELRRSAFKTNSPAAKAVLDQLLRLIHEESDAMLQTPAIRSIGCLAKTFPAKEKRMIGPLVALLSNRNVDVATEAVIALSKFVSPDNFNRSEHSKAIIEFDGVPPLMRLLKISDRAQVHGLVFLCYLALSAGNSKALEQARALNALEGAARTVLPQHPELRDLFAQAIYHLTLY*************
MAATVTHVASAVV***********ELSLPILLADRVIK***********CAELRKQVERLSQMLRSCVRLATSSQPLYERPIRRVAADVAKNLDRSLTLVRRCKHAGVLRHVFSITTNADFKKVFSLLESSIGDMRWLLTIFDSDEVNLSLPPIASNDPILAWVWSFISTIQMGQIKSRVDAANELASLARDNNRNRKIIVEEGGILPLLKLLKEAASPDAQTAAANALFNIATDQETVRFIVDVLGVPIIVSVLGEAPVKVQVAVANLVARMAELDSIAQEEFVRENVTRSLISLLCMDIALDLPKPESAKTTIHSLVQMKKEM*******************************TPEVKAKVRIACAEALWKLSKGCLLSLWSAESNAELRRSAFKTNSPAAKAVLDQLLRLIHEESDAMLQTPAIRSIGCLAKTFPAKEKRMIGPLVALLSNRNVDVATEAVIALSKFVSPDNFNRSEHSKAIIEFDGVPPLMRLLKISDRAQVHGLVFLCYLALSAGNSKALEQARALNALEGAARTVLPQHPELRDLFAQAIYHLTLYQAGSHPHRQTYAP
****************EKSQSLQEELSLPILLADRVIKSAQEAESSKQECAELRKQVERLSQMLRSCVRLATSSQPLYERPIRRVAADVAKNLDRSLTLVRRCKHAGVLRHVFSITTNADFKKVFSLLESSIGDMRWLLTIFDSDEVNLSLPPIASNDPILAWVWSFISTIQMGQIKSRVDAANELASLARDNNRNRKIIVEEGGILPLLKLLKEAASPDAQTAAANALFNIATDQETVRFIVDVLGVPIIVSVLGEAPVKVQVAVANLVARMAELDSIAQEEFVRENVTRSLISLLCMDIALDLPKPESAKTTIHSLVQMKKEM***************************RELETPEVKAKVRIACAEALWKLSKGCLLSLWSAESNAELRRSAFKTNSPAAKAVLDQLLRLIHEESDAMLQTPAIRSIGCLAKTFPAKEKRMIGPLVALLSNRNVDVATEAVIALSKFVSPDNFNRSEHSKAIIEFDGVPPLMRLLKISDRAQVHGLVFLCYLALSAGNSKALEQARALNALEGAARTVLPQHPELRDLFAQAIYHLTLYQAGS*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAATVTHVASAVVVEEEKSQSLQEELSLPILLADRxxxxxxxxxxxxxxxxxxxxxxxxxxxxLRSCVRLATSSQPLYERPIRRVAADVAKNLDRSLTLVRRCKHAGVLRHVFSITTNADFKKVFSLLESSIGDMRWLLTIFDSDEVNLSLPPIASNDPILAWVWSFISTIQMGQIKSRVDAANELASLARDNNRNRKIIVEEGGILPLLKLLKEAASPDAQTAAANALFNIATDQETVRFIVDVLGVPIIVSVLGEAPVKVQVAVANLVARMAELDSIAQEEFVRENVTRSLISLLCMDIALDLPKPESAKTTIHSLVQMKKEMTEKSTNVTNNSDGSSRGGHGQHYNKKDRELETPEVKAKVRIACAEALWKLSKGCLLSLWSAESNAELRRSAFKTNSPAAKAVLDQLLRLIHEESDAMLQTPAIRSIGCLAKTFPAKEKRMIGPLVALLSNRNVDVATEAVIALSKFVSPDNFNRSEHSKAIIEFDGVPPLMRLLKISDRAQVHGLVFLCYLALSAGNSKALEQARALNALEGAARTVLPQHPELRDLFAQAIYHLTLYQAGSHPHRQTYAP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query576 2.2.26 [Sep-21-2011]
Q5VRH9611 U-box domain-containing p no no 0.171 0.162 0.34 0.0004
>sp|Q5VRH9|PUB12_ORYSJ U-box domain-containing protein 12 OS=Oryza sativa subsp. japonica GN=PUB12 PE=2 SV=1 Back     alignment and function desciption
 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 51/100 (51%), Gaps = 1/100 (1%)

Query: 156 SNDPILAWVWSFISTIQMGQIKSRVDAANELASLARDNNRNRKIIVEEGGILPLLKLLKE 215
           S+D   A + S ++ ++ G    +  AA E+  LA+ N  NR I + E G +PLL  L  
Sbjct: 317 SSDYDHAGLVSLMNRLRSGNQDEQRAAAGEIRLLAKRNVNNR-ICIAEAGAIPLLVNLLS 375

Query: 216 AASPDAQTAAANALFNIATDQETVRFIVDVLGVPIIVSVL 255
           ++ P  Q  A  AL N++  +     IVD   +P IV VL
Sbjct: 376 SSDPRTQEHAVTALLNLSIHENNKASIVDSHAIPKIVEVL 415




Possesses E3 ubiquitin-protein ligase in vitro.
Oryza sativa subsp. japonica (taxid: 39947)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query576
224135917596 predicted protein [Populus trichocarpa] 0.958 0.926 0.646 0.0
255540541602 hypothetical protein RCOM_1509330 [Ricin 0.960 0.918 0.617 0.0
147818488617 hypothetical protein VITISV_023591 [Viti 0.968 0.904 0.585 0.0
225456918606 PREDICTED: uncharacterized protein LOC10 0.968 0.920 0.594 0.0
356513731602 PREDICTED: uncharacterized protein LOC10 0.928 0.888 0.575 0.0
297733721 1372 unnamed protein product [Vitis vinifera] 0.956 0.401 0.581 0.0
356562688601 PREDICTED: uncharacterized protein LOC10 0.949 0.910 0.572 1e-178
449487839615 PREDICTED: uncharacterized LOC101205472 0.949 0.889 0.537 1e-175
449469721642 PREDICTED: uncharacterized protein LOC10 0.947 0.850 0.538 1e-175
357485695656 hypothetical protein MTR_5g033190 [Medic 0.946 0.830 0.521 1e-173
>gi|224135917|ref|XP_002322193.1| predicted protein [Populus trichocarpa] gi|222869189|gb|EEF06320.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/592 (64%), Positives = 469/592 (79%), Gaps = 40/592 (6%)

Query: 22  LQEELSLPILLADRVIKSAQEAESSKQECAELRKQVERLSQMLRSCVRLATSSQPLYERP 81
           + +ELSLPILLADRVIKSAQEAES +Q+C++L KQV+RLSQMLRS VRLA S   LY+RP
Sbjct: 8   ISKELSLPILLADRVIKSAQEAESLRQDCSDLAKQVDRLSQMLRSAVRLAVSIPSLYDRP 67

Query: 82  IRRVAADVAKNLDRSLTLVRRCK-HAGVLRHVFSITTNADFKKVFSLLESSIGDMRWLLT 140
           +RR+A+D+ +NLDR+LTLVR+CK H+GVLR VFSITT ADF+KV +LLESSIGDM+WLL+
Sbjct: 68  LRRIASDITRNLDRALTLVRKCKKHSGVLRQVFSITTTADFRKVSNLLESSIGDMKWLLS 127

Query: 141 IFDSDE-VNLSLPPIASNDPILAWVWSFISTIQMGQIKSRVDAANELASLARDNNRNRKI 199
           +F+SD   +LSLPPIASNDPILAWVWS IS +QMGQ+K RVDAAN+LASLARDN+RN+K+
Sbjct: 128 VFESDGGAHLSLPPIASNDPILAWVWSSISAVQMGQVKDRVDAANQLASLARDNDRNKKM 187

Query: 200 IVEEGGILPLLKLLKEAASPDAQTAAANALFNIATDQETVRFIVDVLGVPIIVSVLGEAP 259
           IVEEGGILPLLKLLKE AS +AQ AAA AL NIA+D+E VR IVD LG+ +IV VLG++ 
Sbjct: 188 IVEEGGILPLLKLLKEGASAEAQIAAATALSNIASDRERVRLIVDALGISMIVGVLGDSQ 247

Query: 260 VKVQVAVANLVARMAELDSIAQEEFVRENVTRSLISLLCMDIALDLPKPESAKTTIHSLV 319
            KVQ++VANLVARMA LD  AQ+EF+R NVTR L+SLL   + L++      KT+I SL+
Sbjct: 248 TKVQISVANLVARMAALDDYAQDEFMRLNVTRPLVSLLSSHLDLEIASNNPVKTSIPSLI 307

Query: 320 QMKKEMTEKSTNVTNNSDGSSRGGHGQHYNKKDRELETPEVKAKVRIACAEALWKLSKG- 378
           +M K++  K  N+  N +  S    G H NK +RE+ETPE++ K++++CAEALWKLS+G 
Sbjct: 308 EMNKKLAYK--NIKANYNSDSSSHGGSHSNK-EREMETPEMQLKLKVSCAEALWKLSRGS 364

Query: 379 ------------------------------CLLSLWS----AESNAELRRSAFKTNSPAA 404
                                         CL+++      AESNA+LRR+AFKTN PAA
Sbjct: 365 VSNSRKITETKGLLCLAKIVEREKGELQFNCLMTIMEITAVAESNADLRRAAFKTNLPAA 424

Query: 405 KAVLDQLLRLIHEESDAMLQTPAIRSIGCLAKTFPAKEKRMIGPLVALLSNRNVDVATEA 464
           KAVLDQLLR+I EESD  LQ PAIRSIGCLA+TFPA+E R++GPLV+ L NRNV+VATEA
Sbjct: 425 KAVLDQLLRVIQEESDPQLQIPAIRSIGCLARTFPARETRIMGPLVSHLGNRNVEVATEA 484

Query: 465 VIALSKFVSPDNFNRSEHSKAIIEFDGVPPLMRLLKISDRAQVHGLVFLCYLALSAGNSK 524
            IAL KF SP+NFN SEHSKAIIEFDGVPPLM+LL+  D++Q+ GLV LCYLAL+AGNSK
Sbjct: 485 AIALGKFASPENFNCSEHSKAIIEFDGVPPLMKLLRSGDQSQLQGLVLLCYLALNAGNSK 544

Query: 525 ALEQARALNALEGAARTVLPQHPELRDLFAQAIYHLTLYQAGSHPHRQTYAP 576
           ALEQARALNALEG AR+VL QHPEL+DLFA+AI+HLTLYQAG+  +RQ+ AP
Sbjct: 545 ALEQARALNALEGTARSVLAQHPELKDLFAKAIHHLTLYQAGAPLNRQSLAP 596




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255540541|ref|XP_002511335.1| hypothetical protein RCOM_1509330 [Ricinus communis] gi|223550450|gb|EEF51937.1| hypothetical protein RCOM_1509330 [Ricinus communis] Back     alignment and taxonomy information
>gi|147818488|emb|CAN76390.1| hypothetical protein VITISV_023591 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225456918|ref|XP_002277976.1| PREDICTED: uncharacterized protein LOC100262114 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356513731|ref|XP_003525564.1| PREDICTED: uncharacterized protein LOC100813824 [Glycine max] Back     alignment and taxonomy information
>gi|297733721|emb|CBI14968.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356562688|ref|XP_003549601.1| PREDICTED: uncharacterized protein LOC100817625 [Glycine max] Back     alignment and taxonomy information
>gi|449487839|ref|XP_004157826.1| PREDICTED: uncharacterized LOC101205472 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449469721|ref|XP_004152567.1| PREDICTED: uncharacterized protein LOC101205472 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357485695|ref|XP_003613135.1| hypothetical protein MTR_5g033190 [Medicago truncatula] gi|355514470|gb|AES96093.1| hypothetical protein MTR_5g033190 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query576
TAIR|locus:2088832615 ARO4 "AT3G26600" [Arabidopsis 0.604 0.565 0.508 5.9e-89
TAIR|locus:2156932651 ARO2 "armadillo repeat only 2" 0.520 0.460 0.398 9.2e-86
TAIR|locus:2116850 664 ARO1 "AT4G34940" [Arabidopsis 0.529 0.459 0.375 5.1e-83
TAIR|locus:2135149 670 ARO3 "armadillo repeat only 3" 0.519 0.446 0.395 1.3e-82
CGD|CAL0000730543 orf19.5682 [Candida albicans ( 0.232 0.246 0.269 4.5e-05
SGD|S000005133542 SRP1 "Karyopherin alpha homolo 0.166 0.177 0.288 7.5e-05
TAIR|locus:2173123 441 IMPA-8 "importin alpha isoform 0.189 0.247 0.294 9.9e-05
UNIPROTKB|Q5VRH9611 PUB12 "U-box domain-containing 0.239 0.225 0.308 0.00021
UNIPROTKB|Q7Z5J8 1434 ANKAR "Ankyrin and armadillo r 0.345 0.138 0.235 0.00024
TAIR|locus:2056529580 AT2G05810 "AT2G05810" [Arabido 0.354 0.351 0.253 0.00024
TAIR|locus:2088832 ARO4 "AT3G26600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 888 (317.7 bits), Expect = 5.9e-89, P = 5.9e-89
 Identities = 186/366 (50%), Positives = 263/366 (71%)

Query:    30 ILLADRVIKSAQEAESSKQECAELRKQVERLSQMLRSCVR-LATSSQPLYERPIRRVAAD 88
             +L A+R+  +  EAES K EC E+ KQV+RL+QMLR+ VR +++SSQ +Y+RPIRRV  D
Sbjct:    16 VLTAERLRVAVDEAESFKTECGEVGKQVDRLAQMLRTLVRFVSSSSQQVYDRPIRRVIVD 75

Query:    89 VAKNLDRSLTLVRRCKHAGVLRHVFSITTNADFKKVFSLLESSIGDMRWLLTIFDSDE-- 146
             V KNL+R   LVR+C+   ++R V +I   ADF+KV +LLESS GD++W+L++FDSD   
Sbjct:    76 VKKNLERGFALVRKCRRHNIIRRVCTIINAADFRKVINLLESSNGDVKWILSVFDSDGDG 135

Query:   147 -----VNLSLPPIASNDPILAWVWSFISTIQMGQIKSRVDAANELASLARDNNRNRKIIV 201
                  + +SLPPIA+NDPIL WVWS +++IQMG++  ++DAAN+L SLA DN+RN+KIIV
Sbjct:   136 SFGGGIVISLPPIATNDPILPWVWSLVASIQMGKLVDKIDAANQLGSLAGDNDRNKKIIV 195

Query:   202 EEGGILPLLKLLKEAASPDAQTAAANALFNIATDQETVRFIVDVLGVPIIVSVLGEAPVK 261
             +EGG+ PLL+LLKE++S + Q AAA AL  +A D++ VR IV+ LGVPIIV VLG++ V+
Sbjct:   196 DEGGVSPLLRLLKESSSAEGQIAAATALGLLACDEDKVRSIVNELGVPIIVQVLGDSSVR 255

Query:   262 VQVAVANLVARMAELDSIAQEEFVRENVTRSLISLLCMDIALDLPKPESAKTTIHSLVQM 321
             VQ+ VA LVARMAE D +AQ+EF R++V + L++LL +D+ +D     S   +IHSLVQM
Sbjct:   256 VQIKVATLVARMAEHDPVAQDEFARQSVIKPLVTLLSLDVFVD-DIHLSKHNSIHSLVQM 314

Query:   322 KKEMTEKSTNVTNNSDGSSR-------GGHGQHYN--KKDRELETPEVKAKVRIACAEAL 372
              KE+ +  ++       SS+       GG G      KK+R+ E PEVK ++++ CAEAL
Sbjct:   315 NKEVEKDPSSKLYRPLKSSKSNVYRDIGGSGSRTGNFKKERDNENPEVKHELKVNCAEAL 374

Query:   373 WKLSKG 378
             W L++G
Sbjct:   375 WMLARG 380


GO:0008150 "biological_process" evidence=ND
GO:0009506 "plasmodesma" evidence=IDA
TAIR|locus:2156932 ARO2 "armadillo repeat only 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116850 ARO1 "AT4G34940" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135149 ARO3 "armadillo repeat only 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0000730 orf19.5682 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
SGD|S000005133 SRP1 "Karyopherin alpha homolog" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
TAIR|locus:2173123 IMPA-8 "importin alpha isoform 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VRH9 PUB12 "U-box domain-containing protein 12" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Z5J8 ANKAR "Ankyrin and armadillo repeat-containing protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2056529 AT2G05810 "AT2G05810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query576
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-10
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 3e-05
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 4e-05
COG5064526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 3e-04
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 6e-04
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 0.002
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
 Score = 57.7 bits (140), Expect = 2e-10
 Identities = 30/110 (27%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 167 FISTIQMGQIKSRVDAANELASLARDNNRNRKIIVEEGGILPLLKLLKEAASPDAQTAAA 226
            +S +       + +AA  L++L+  NN N + +VE GG+  L++LLK     +   AA 
Sbjct: 12  LVSLLSSSDENVQREAAWALSNLSAGNNDNIQAVVEAGGLPALVQLLKS-EDEEVVKAAL 70

Query: 227 NALFNIATDQETVR-FIVDVLGVPIIVSVLGEAPVKVQVAVANLVARMAE 275
            AL N+A   E  +  +++  GVP +V++L  +   +Q      ++ +A 
Sbjct: 71  WALRNLAAGPEDNKLIVLEAGGVPKLVNLLDSSNEDIQKNATGALSNLAS 120


An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model. Length = 120

>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 576
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 100.0
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 100.0
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 100.0
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 100.0
KOG4224550 consensus Armadillo repeat protein VAC8 required f 99.92
KOG4224550 consensus Armadillo repeat protein VAC8 required f 99.92
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 99.86
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.8
PF05804708 KAP: Kinesin-associated protein (KAP) 99.73
PF05804708 KAP: Kinesin-associated protein (KAP) 99.69
KOG1048717 consensus Neural adherens junction protein Plakoph 99.59
KOG1048717 consensus Neural adherens junction protein Plakoph 99.41
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.35
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.28
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.24
PRK09687280 putative lyase; Provisional 99.23
PRK09687280 putative lyase; Provisional 99.22
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.14
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.09
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.05
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 98.93
KOG4500 604 consensus Rho/Rac GTPase guanine nucleotide exchan 98.86
KOG4199461 consensus Uncharacterized conserved protein [Funct 98.84
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 98.8
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 98.74
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 98.73
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 98.61
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 98.59
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 98.58
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 98.55
KOG4646173 consensus Uncharacterized conserved protein, conta 98.41
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 98.32
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.31
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 98.29
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 98.29
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 98.24
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 98.14
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 98.11
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 97.97
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.91
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 97.9
KOG4500604 consensus Rho/Rac GTPase guanine nucleotide exchan 97.88
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.87
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 97.85
TIGR02270410 conserved hypothetical protein. Members are found 97.74
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 97.73
KOG1293678 consensus Proteins containing armadillo/beta-caten 97.72
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 97.69
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.58
KOG1241859 consensus Karyopherin (importin) beta 1 [Nuclear s 97.55
TIGR02270410 conserved hypothetical protein. Members are found 97.47
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 97.47
PTZ00429 746 beta-adaptin; Provisional 97.45
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.43
KOG3678 832 consensus SARM protein (with sterile alpha and arm 97.41
PTZ00429 746 beta-adaptin; Provisional 97.37
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 97.35
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 97.27
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.26
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.21
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 97.2
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 97.18
KOG1293678 consensus Proteins containing armadillo/beta-caten 97.06
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 97.04
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 96.84
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 96.8
PF05536 543 Neurochondrin: Neurochondrin 96.46
KOG4646173 consensus Uncharacterized conserved protein, conta 96.43
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 96.42
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 96.24
KOG17892235 consensus Endocytosis protein RME-8, contains DnaJ 96.11
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 96.01
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 95.86
KOG2973353 consensus Uncharacterized conserved protein [Funct 95.84
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 95.83
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 95.74
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 95.35
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 95.25
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 95.12
COG5215858 KAP95 Karyopherin (importin) beta [Intracellular t 95.09
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 95.07
KOG0213 1172 consensus Splicing factor 3b, subunit 1 [RNA proce 94.75
PF05536543 Neurochondrin: Neurochondrin 94.67
KOG3678 832 consensus SARM protein (with sterile alpha and arm 94.56
COG5181 975 HSH155 U2 snRNP spliceosome subunit [RNA processin 94.19
KOG1824 1233 consensus TATA-binding protein-interacting protein 94.07
KOG1242 569 consensus Protein containing adaptin N-terminal re 93.95
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 93.93
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 93.78
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 93.49
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 93.47
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 93.3
COG5096 757 Vesicle coat complex, various subunits [Intracellu 93.24
PF05004309 IFRD: Interferon-related developmental regulator ( 93.2
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 92.94
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 92.67
KOG2259 823 consensus Uncharacterized conserved protein [Funct 92.58
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 92.17
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 91.96
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 91.44
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 91.43
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 90.65
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 90.33
PF08045257 CDC14: Cell division control protein 14, SIN compo 89.69
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 89.66
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 89.61
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 89.55
COG5369743 Uncharacterized conserved protein [Function unknow 89.37
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 88.8
KOG0567289 consensus HEAT repeat-containing protein [General 88.76
KOG18241233 consensus TATA-binding protein-interacting protein 88.64
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 88.2
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 88.15
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 87.85
KOG2973353 consensus Uncharacterized conserved protein [Funct 87.49
KOG1242569 consensus Protein containing adaptin N-terminal re 87.03
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 86.91
PF05659147 RPW8: Arabidopsis broad-spectrum mildew resistance 86.54
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 85.66
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 85.58
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 84.84
COG5096 757 Vesicle coat complex, various subunits [Intracellu 84.44
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 83.46
PF13251182 DUF4042: Domain of unknown function (DUF4042) 82.67
PF11701157 UNC45-central: Myosin-binding striated muscle asse 81.78
COG5369 743 Uncharacterized conserved protein [Function unknow 81.38
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 81.02
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 80.94
PF08045257 CDC14: Cell division control protein 14, SIN compo 80.8
KOG17892235 consensus Endocytosis protein RME-8, contains DnaJ 80.22
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
Probab=100.00  E-value=1.1e-45  Score=372.08  Aligned_cols=363  Identities=20%  Similarity=0.231  Sum_probs=295.5

Q ss_pred             HHHHHhcCCHHHHHHHHHHHHHHh-hcCcccHHHHHhcCCHHHHHHHHccCCChHHHHHHHHHHHHhhcC-CchHHHHHH
Q 041643          167 FISTIQMGQIKSRVDAANELASLA-RDNNRNRKIIVEEGGILPLLKLLKEAASPDAQTAAANALFNIATD-QETVRFIVD  244 (576)
Q Consensus       167 li~~L~~G~~e~k~~AA~~L~~La-~~~~~~~~~I~~~GgIppLV~LL~~g~~~~~q~~AA~AL~nLa~~-~~~~~~iv~  244 (576)
                      +.+.|.+.+.|++..|......+- +...+..+.++++|.||.+|++|++....-.|++|||||+|+++. +.+++.+|+
T Consensus        76 lt~~l~SdDie~q~qav~kFR~~LS~E~~PPIq~VIdaGvVpRfvefm~~~q~~mlqfEAaWalTNiaSGtt~QTkvVvd  155 (526)
T COG5064          76 LTQQLFSDDIEQQLQAVYKFRKLLSKETSPPIQPVIDAGVVPRFVEFMDEIQRDMLQFEAAWALTNIASGTTQQTKVVVD  155 (526)
T ss_pred             HHHHHhhhHHHHHHHHHHHHHHHhccccCCCchhHHhccccHHHHHHHHhcchhHHHHHHHHHHhhhccCcccceEEEEe
Confidence            367889999999999998876544 444456788889999999999996654378999999999999995 566777889


Q ss_pred             cCCHHHHHHhhcCCChhHHHHHHHHHHHHhcCChHHHHHHHhcCCchhHHHhhccccccCCCcchhhhhHHHHHHhhhcc
Q 041643          245 VLGVPIIVSVLGEAPVKVQVAVANLVARMAELDSIAQEEFVRENVTRSLISLLCMDIALDLPKPESAKTTIHSLVQMKKE  324 (576)
Q Consensus       245 ~Gavp~LV~lL~s~~~~vq~~Aa~aL~~LA~~~~~~r~~i~~~g~I~~LV~LL~~~t~~~~~~~i~~~~si~~~v~~~~~  324 (576)
                      +||||.|+++|.++..+|++++.|||+|+|++++.+|+.+.+.|++.||+.+|.+..         ..   -++++..+|
T Consensus       156 ~~AVPlfiqlL~s~~~~V~eQavWALGNiAGDS~~~RD~vL~~galeplL~ll~ss~---------~~---ismlRn~TW  223 (526)
T COG5064         156 AGAVPLFIQLLSSTEDDVREQAVWALGNIAGDSEGCRDYVLQCGALEPLLGLLLSSA---------IH---ISMLRNATW  223 (526)
T ss_pred             CCchHHHHHHHcCchHHHHHHHHHHhccccCCchhHHHHHHhcCchHHHHHHHHhcc---------ch---HHHHHHhHH
Confidence            999999999999999999999999999999999999999999999999999997531         01   134677777


Q ss_pred             ccccccccCCCCCCCCCCCCCCCCcccccccCCHHHHHHHHHHHHHHHHHhhcCCcccc-hhcccchHHHHhhhccCchh
Q 041643          325 MTEKSTNVTNNSDGSSRGGHGQHYNKKDRELETPEVKAKVRIACAEALWKLSKGCLLSL-WSAESNAELRRSAFKTNSPA  403 (576)
Q Consensus       325 ~~~~~~~~~~~~~~~~~~~~g~~~~~~~~e~~d~~vk~~~k~~Aa~ALw~La~g~~~~I-avae~~~~lrr~a~k~~s~a  403 (576)
                      +-++.|+|+++.|.++..+..+|.+.|.....||+|.    .+|+||+.||++|..+.| +|.+.+              
T Consensus       224 tLSNlcRGknP~P~w~~isqalpiL~KLiys~D~evl----vDA~WAiSYlsDg~~E~i~avld~g--------------  285 (526)
T COG5064         224 TLSNLCRGKNPPPDWSNISQALPILAKLIYSRDPEVL----VDACWAISYLSDGPNEKIQAVLDVG--------------  285 (526)
T ss_pred             HHHHhhCCCCCCCchHHHHHHHHHHHHHHhhcCHHHH----HHHHHHHHHhccCcHHHHHHHHhcC--------------
Confidence            7777888998899887666677777788889999874    789999999999987665 444432              


Q ss_pred             HHHHHHHHHHHhhhcCChhhHHHHHHHHHHHhcCCch-------------------------------------------
Q 041643          404 AKAVLDQLLRLIHEESDAMLQTPAIRSIGCLAKTFPA-------------------------------------------  440 (576)
Q Consensus       404 ~~~vV~~Ll~lL~~~~~~~lq~~a~~aLgnLa~~~~~-------------------------------------------  440 (576)
                         ....|+++|.+++ ..+|+|++|++||+++....                                           
T Consensus       286 ---~~~RLvElLs~~s-a~iqtPalR~vGNIVTG~D~QTqviI~~G~L~a~~~lLs~~ke~irKEaCWTiSNITAGnteq  361 (526)
T COG5064         286 ---IPGRLVELLSHES-AKIQTPALRSVGNIVTGSDDQTQVIINCGALKAFRSLLSSPKENIRKEACWTISNITAGNTEQ  361 (526)
T ss_pred             ---CcHHHHHHhcCcc-ccccCHHHHhhcCeeecCccceehheecccHHHHHHHhcChhhhhhhhhheeecccccCCHHH
Confidence               2345777777654 89999999999999873210                                           


Q ss_pred             ----hhhCcHHHHHHhhcCCCHHHHHHHHHHHHhhcCCCCCCCHHHHHHHHHCCCcHhHHHhhccChh-HHHHHHHHHHH
Q 041643          441 ----KEKRMIGPLVALLSNRNVDVATEAVIALSKFVSPDNFNRSEHSKAIIEFDGVPPLMRLLKISDR-AQVHGLVFLCY  515 (576)
Q Consensus       441 ----~~~~~I~~LV~LL~~~~~~V~~eAa~AL~nla~~~n~~~~~~~~~Iv~~ggi~~Lv~LL~~~d~-vq~~A~~~L~~  515 (576)
                          .+.+.|||||++|.+.+..+++||+||++|..++++. .+++.+++++.|.|+|||.||...+. +-..++.++-|
T Consensus       362 iqavid~nliPpLi~lls~ae~k~kKEACWAisNatsgg~~-~PD~iryLv~qG~IkpLc~~L~~~dNkiiev~LD~~en  440 (526)
T COG5064         362 IQAVIDANLIPPLIHLLSSAEYKIKKEACWAISNATSGGLN-RPDIIRYLVSQGFIKPLCDLLDVVDNKIIEVALDAIEN  440 (526)
T ss_pred             HHHHHhcccchHHHHHHHHHHHHHHHHHHHHHHhhhccccC-CchHHHHHHHccchhHHHHHHhccCccchhhhHHHHHH
Confidence                1234689999999999999999999999999988875 57999999999999999999998776 43334666667


Q ss_pred             HhcccCchHHHHhccch---hh-Hh---hhhcccCCCCCcHHHHHHHHHHHHHhhcC
Q 041643          516 LALSAGNSKALEQARAL---NA-LE---GAARTVLPQHPELRDLFAQAIYHLTLYQA  565 (576)
Q Consensus       516 lal~~~~~~~l~~~~~l---~~-Le---~~~~~~~~q~~~~~~l~~~a~~~l~~y~~  565 (576)
                      + +++|...+...-.-+   .+ .|   |++.++.+|+..++++|.||++|++.||+
T Consensus       441 i-Lk~Ge~d~~~~~~nin~ya~~vE~Aggmd~I~~~Q~s~n~~iy~KAYsIIe~fFg  496 (526)
T COG5064         441 I-LKVGEQDRLRYGKNINIYAVYVEKAGGMDAIHGLQDSVNRTIYDKAYSIIEKFFG  496 (526)
T ss_pred             H-HhhhhHHHHhccCCccHHHHHHHhcccHHHHHHhhhccccHHHHHHHHHHHHHcc
Confidence            7 777877665532222   22 23   88889999999999999999999999996



>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query576
4hxt_A252 Crystal Structure Of Engineered Protein. Northeast 1e-04
>pdb|4HXT|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or329 Length = 252 Back     alignment and structure

Iteration: 1

Score = 45.1 bits (105), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 36/95 (37%), Positives = 53/95 (55%), Gaps = 2/95 (2%) Query: 181 DAANELASLARDNNRNRKIIVEEGGILPLLKLLKEAASPDAQTAAANALFNIATD-QETV 239 +AA LA++A + K IV+ GG+ L+KLL S + Q AA AL NIA+ E + Sbjct: 63 EAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDS-EVQKEAARALANIASGPDEAI 121 Query: 240 RFIVDVLGVPIIVSVLGEAPVKVQVAVANLVARMA 274 + IVD GV ++V +L +VQ A +A +A Sbjct: 122 KAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIA 156

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query576
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 8e-19
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-18
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 4e-18
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 4e-12
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 6e-09
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-08
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 7e-08
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 3e-07
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-18
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-18
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 4e-18
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-12
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 3e-11
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 4e-08
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-07
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 1e-18
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 5e-18
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 5e-17
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 4e-11
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 7e-04
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-18
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 4e-18
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 2e-11
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 5e-08
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 2e-06
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 1e-17
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-11
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 3e-09
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-07
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 6e-06
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 1e-14
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 2e-12
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 2e-10
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 8e-07
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 5e-05
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 3e-13
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-13
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 3e-12
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 1e-07
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 4e-07
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 8e-05
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 8e-12
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 9e-10
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 2e-09
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 2e-09
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 2e-06
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 7e-06
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 9e-05
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 1e-04
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 1e-11
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 2e-09
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 5e-06
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 7e-06
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 1e-04
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 9e-04
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 3e-11
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 4e-11
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 2e-08
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 2e-05
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 3e-05
4db8_A 252 Armadillo-repeat protein; solenoid repeat, de novo 2e-04
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 4e-04
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 3e-10
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 1e-07
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 1e-07
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 3e-07
3nmz_A458 APC variant protein; protein-protein complex, arma 1e-08
3nmz_A458 APC variant protein; protein-protein complex, arma 4e-07
3nmz_A458 APC variant protein; protein-protein complex, arma 5e-07
3nmz_A458 APC variant protein; protein-protein complex, arma 5e-07
3nmz_A458 APC variant protein; protein-protein complex, arma 9e-07
3nmz_A458 APC variant protein; protein-protein complex, arma 2e-05
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 2e-07
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 2e-07
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 2e-05
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 8e-05
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
 Score = 89.2 bits (221), Expect = 8e-19
 Identities = 47/379 (12%), Positives = 117/379 (30%), Gaps = 66/379 (17%)

Query: 167 FISTIQMGQIKSRVDAANELASLARDNNRNRKIIVEEGGILPLLKLLKEAASPDAQTAAA 226
               +          AA  +  L++       I+     +  +++ ++     +     A
Sbjct: 19  LTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTA 78

Query: 227 NALFNIATDQETVRFIVDVLGVPIIVSVLGEAPVKVQVAVANLVARMAELDSIAQEEFVR 286
             L N++  +E +  I    G+P +V +LG     V       +  +      A+     
Sbjct: 79  GTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRL 138

Query: 287 ENVTRSLISLLCMDIALDLPKPESAKTTIHSLVQMKKEMTEKSTNVTNNSDGSSRGGHGQ 346
               + +++LL      ++         +  L    +E                      
Sbjct: 139 AGGLQKMVALLNKT---NVKFLAITTDCLQILAYGNQE---------------------- 173

Query: 347 HYNKKDRELETPEVKAKVRIACAEALWKLSKGCLLSLWSAESNAELRRSA------FKTN 400
                          +K+ I  +          L+++    +  +L  +           
Sbjct: 174 ---------------SKLIILASGGP-----QALVNIMRTYTYEKLLWTTSRVLKVLSVC 213

Query: 401 SPAAKAVLDQ-----LLRLIHEESDAMLQTPAIRSIGCLAKTFPAKEKR--MIGPLVALL 453
           S    A+++      L   + + S  +     + ++  L+     +E    ++G LV LL
Sbjct: 214 SSNKPAIVEAGGMQALGLHLTDPSQRL-VQNCLWTLRNLSDAATKQEGMEGLLGTLVQLL 272

Query: 454 SNRNVDVATEAVIALSKFVSPDNFNRSEHSKAIIEFDGVPPLMRLLKIS---DRAQVHGL 510
            + +++V T A   LS     +  N+      + +  G+  L+R +  +   +      +
Sbjct: 273 GSDDINVVTCAAGILSNLTCNNYKNK----MMVCQVGGIEALVRTVLRAGDREDITEPAI 328

Query: 511 VFLCYLALSAGNSKALEQA 529
             L +L      ++  + A
Sbjct: 329 CALRHLTSRHQEAEMAQNA 347


>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query576
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 100.0
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 100.0
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 100.0
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 100.0
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 100.0
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 100.0
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 100.0
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 99.98
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.97
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.97
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.97
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 99.97
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.97
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 99.96
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.96
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.95
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.95
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.95
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.94
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.94
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.94
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.93
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.93
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.93
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 99.92
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.91
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.91
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.91
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.9
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.9
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.89
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.88
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.88
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.87
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.86
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.84
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.44
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.36
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.35
3grl_A 651 General vesicular transport factor P115; vesicle t 99.35
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.29
3grl_A 651 General vesicular transport factor P115; vesicle t 99.27
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.26
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.26
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.07
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.04
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 99.01
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 98.93
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 98.87
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 98.85
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 98.8
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.77
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 98.67
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 98.63
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 98.47
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 98.39
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 98.32
1qgr_A 876 Protein (importin beta subunit); transport recepto 98.27
1qgr_A 876 Protein (importin beta subunit); transport recepto 98.26
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 98.1
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 97.99
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 97.97
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 97.75
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.67
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 97.64
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.61
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 97.54
2db0_A253 253AA long hypothetical protein; heat repeats, hel 97.41
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 97.28
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 97.27
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 97.26
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 97.07
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 96.97
2db0_A253 253AA long hypothetical protein; heat repeats, hel 96.91
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 96.76
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 96.69
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 96.65
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 96.08
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 95.85
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 95.65
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 94.91
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 94.82
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 90.37
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 88.2
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 88.06
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 85.55
2x1g_F971 Cadmus; transport protein, developmental protein, 83.45
2x19_B 963 Importin-13; nuclear transport, protein transport; 83.05
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 81.67
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
Probab=100.00  E-value=3.7e-41  Score=370.83  Aligned_cols=368  Identities=18%  Similarity=0.209  Sum_probs=280.3

Q ss_pred             HHHHHHHHhcCCHHHHHHHHHHHHHHh-hcCcccHHHHHhcCCHHHHHHHHccCCChHHHHHHHHHHHHhhc-CCchHHH
Q 041643          164 VWSFISTIQMGQIKSRVDAANELASLA-RDNNRNRKIIVEEGGILPLLKLLKEAASPDAQTAAANALFNIAT-DQETVRF  241 (576)
Q Consensus       164 v~~li~~L~~G~~e~k~~AA~~L~~La-~~~~~~~~~I~~~GgIppLV~LL~~g~~~~~q~~AA~AL~nLa~-~~~~~~~  241 (576)
                      +.++|..|++++.+.+..|+..++.|. ....+..+.|++.|+||+||+||++++++..|++|||||+||+. ++++++.
T Consensus        59 i~~~v~~l~s~d~~~q~~a~~~~rklls~e~~ppi~~ii~~G~ip~LV~lL~~~~~~~lq~~Aa~aL~nias~~~e~~~~  138 (510)
T 3ul1_B           59 VEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKA  138 (510)
T ss_dssp             HHHHHHHHTSSCHHHHHHHHHHHHHHHTCSSCCCHHHHHHTTHHHHHHHHTTCTTCHHHHHHHHHHHHHHHTSCHHHHHH
T ss_pred             HHHHHHHhcCCCHHHHHHHHHHHHHHhcCCCCchHHHHHHCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHhcCCHHHHHH
Confidence            566799999999999999999998754 33345578999999999999999866558999999999999987 5688999


Q ss_pred             HHHcCCHHHHHHhhcCCChhHHHHHHHHHHHHhcCChHHHHHHHhcCCchhHHHhhccccccCCCcchhhhhHHHHHHhh
Q 041643          242 IVDVLGVPIIVSVLGEAPVKVQVAVANLVARMAELDSIAQEEFVRENVTRSLISLLCMDIALDLPKPESAKTTIHSLVQM  321 (576)
Q Consensus       242 iv~~Gavp~LV~lL~s~~~~vq~~Aa~aL~~LA~~~~~~r~~i~~~g~I~~LV~LL~~~t~~~~~~~i~~~~si~~~v~~  321 (576)
                      |+++|+||.|+++|++++.+++++|+|+|+|||.+++++|+.+.+.|++++|+.+|.+.........     .+....+.
T Consensus       139 vv~~GaIp~Lv~lL~s~~~~v~e~A~~aL~nLa~d~~~~r~~v~~~G~i~~Ll~lL~~~~~~~~~~~-----~~~~a~~~  213 (510)
T 3ul1_B          139 VVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACG-----YLRNLTWT  213 (510)
T ss_dssp             HHHTTHHHHHHHHTTCSCHHHHHHHHHHHHHHHTTCHHHHHHHHHTTCHHHHHHHTCSSCGGGSCHH-----HHHHHHHH
T ss_pred             HHHCCCHHHHHHHHcCCCHHHHHHHHHHHHHHHhCCHHHHHHHHHcCChHHHHHHHHhccchhhhHH-----HHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999986532111110     11111111


Q ss_pred             hccccccccccCCCCCCCCCCCCCCCCcccccccCCHHHHHHHHHHHHHHHHHhhcCCcccchhcccchHHHHhhhccCc
Q 041643          322 KKEMTEKSTNVTNNSDGSSRGGHGQHYNKKDRELETPEVKAKVRIACAEALWKLSKGCLLSLWSAESNAELRRSAFKTNS  401 (576)
Q Consensus       322 ~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~e~~d~~vk~~~k~~Aa~ALw~La~g~~~~Iavae~~~~lrr~a~k~~s  401 (576)
                      ..+.+.    +....+.+....++++.+.+.....|+++    +..|+|||++|+.++.+++          +...    
T Consensus       214 L~nl~~----~~~~~~~~~~~~~~lp~L~~LL~~~~~~v----~~~A~~aL~~L~~~~~~~~----------~~i~----  271 (510)
T 3ul1_B          214 LSNLCR----NKNPAPPLDAVEQILPTLVRLLHHNDPEV----LADSCWAISYLTDGPNERI----------EMVV----  271 (510)
T ss_dssp             HHHHHC----CCSSCCCHHHHHHHHHHHHHHTTCSCHHH----HHHHHHHHHHHTSSCHHHH----------HHHH----
T ss_pred             HHHHhh----cccchhHHHHHHhHHHHHHHHHhcCCHHH----HHHHHHHHHHHhhchhhhH----------HHHH----
Confidence            111110    00001111000112333323345567765    5789999999998765432          1111    


Q ss_pred             hhHHHHHHHHHHHhhhcCChhhHHHHHHHHHHHhcCCch-----hhhCcHHHHHHhhcCCCHHHHHHHHHHHHhhcCCCC
Q 041643          402 PAAKAVLDQLLRLIHEESDAMLQTPAIRSIGCLAKTFPA-----KEKRMIGPLVALLSNRNVDVATEAVIALSKFVSPDN  476 (576)
Q Consensus       402 ~a~~~vV~~Ll~lL~~~~~~~lq~~a~~aLgnLa~~~~~-----~~~~~I~~LV~LL~~~~~~V~~eAa~AL~nla~~~n  476 (576)
                        ..++++.|+.+|.+.+ +.++.+++++||||+.....     .+.|++++|+.+|++.+..++++|+|+|+|++.+. 
T Consensus       272 --~~g~i~~Lv~lL~~~~-~~v~~~al~aL~nl~~~~~~~~~~i~~~g~l~~L~~LL~~~~~~v~~~A~~aL~nl~a~~-  347 (510)
T 3ul1_B          272 --KKGVVPQLVKLLGATE-LPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGR-  347 (510)
T ss_dssp             --TTTCHHHHHHHHTCSC-HHHHHHHHHHHHHHTTSCHHHHHHHHHTTGGGGCC-CTTCSSHHHHHHHHHHHHHHTTSC-
T ss_pred             --hcccchhhhhhhcCCC-hhhhhHHHHHHHHhhcCCHHHHHHHhhccchHHHHHHhcCCCHHHHHHHHHHHHHHHcCc-
Confidence              1246888999998765 89999999999999865433     24588999999999999999999999999998643 


Q ss_pred             CCCHHHHHHHHHCCCcHhHHHhhccChh-HHHHHHHHHHHHhcccCc--hHHHHhccchhhH------------------
Q 041643          477 FNRSEHSKAIIEFDGVPPLMRLLKISDR-AQVHGLVFLCYLALSAGN--SKALEQARALNAL------------------  535 (576)
Q Consensus       477 ~~~~~~~~~Iv~~ggi~~Lv~LL~~~d~-vq~~A~~~L~~lal~~~~--~~~l~~~~~l~~L------------------  535 (576)
                         .++++.+++.|++++|+++|++++. +|..|+++|++++.+...  ...+.+.|++++|                  
T Consensus       348 ---~~~~~~v~~~g~i~~Lv~lL~~~~~~v~~~Aa~aL~Nl~~~~~~~~~~~L~~~g~i~~L~~LL~~~d~~i~~~~L~a  424 (510)
T 3ul1_B          348 ---QDQIQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDA  424 (510)
T ss_dssp             ---HHHHHHHHHTTHHHHHHHHHHSSCHHHHHHHHHHHHHHHHHCCHHHHHHHHHTTCHHHHHHGGGCSCHHHHHHHHHH
T ss_pred             ---HHHHHHHHhcCCHHHHHHHHcCCCHHHHHHHHHHHHHHHccCCHHHHHHHHHCCCHHHHHHHhcCCCHHHHHHHHHH
Confidence               6899999999999999999999887 999999999999764322  2345555555433                  


Q ss_pred             ---------------------h---hhhcccCCCCCcHHHHHHHHHHHHHhhcC
Q 041643          536 ---------------------E---GAARTVLPQHPELRDLFAQAIYHLTLYQA  565 (576)
Q Consensus       536 ---------------------e---~~~~~~~~q~~~~~~l~~~a~~~l~~y~~  565 (576)
                                           +   |+++++.+|+|+++++|++|..+|+.||+
T Consensus       425 L~nil~~~~~~~~~~~~~~~iee~ggl~~ie~Lq~~~n~~i~~~A~~iie~yf~  478 (510)
T 3ul1_B          425 ISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEKYFS  478 (510)
T ss_dssp             HHHHHHHHHTTTCHHHHHHHHHHTTHHHHHHHGGGCSSHHHHHHHHHHHHHHCC
T ss_pred             HHHHHHHhHhccchHHHHHHHHHcCcHHHHHHHHcCCCHHHHHHHHHHHHHHCC
Confidence                                 1   45677889999999999999999999998



>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 576
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 1e-14
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 6e-05
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 1e-11
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 1e-06
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 2e-06
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 4e-06
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-10
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 4e-10
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-09
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 4e-05
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 0.004
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 3e-09
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 1e-04
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 1e-04
d2vgla_584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 2e-04
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Importin alpha
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 73.7 bits (179), Expect = 1e-14
 Identities = 61/404 (15%), Positives = 129/404 (31%), Gaps = 30/404 (7%)

Query: 153 PIASNDPILAW-VWSFISTIQMGQIKSRVDAANELASLA-RDNNRNRKIIVEEGGILPLL 210
            I SN   + W V   +  I    ++S++ A      L  R+       I+  G I   +
Sbjct: 3   DIGSNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFV 62

Query: 211 KLLKEAASPDAQTAAANALFNIAT-DQETVRFIVDVLGVPIIVSVLGEAPVKVQVAVANL 269
             L +      Q  +A AL NIA+   E  + +VD   +P  +S+L      +       
Sbjct: 63  SFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWA 122

Query: 270 VARMAELDSIAQEEFVRENVTRSLISLLCM-------------------DIALDLPKPES 310
           +  +A   S  ++  ++      L++LL +                   ++  +      
Sbjct: 123 LGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPP 182

Query: 311 AKTTIHSLVQMKKEMTEKSTNVTNNSDGSSRGGHGQHYNKKDRELETPEVKAKVRIACAE 370
                  L  + + +      V  +S  +          + +  ++   V   V++  A 
Sbjct: 183 LDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGAT 242

Query: 371 ALWKLSKGCLLSLWSAESNAELRRSAFKTNS-PAAKAVLDQLLRLIHEESDAMLQTPAIR 429
            L  ++              E  +      +     ++L      I +E+   +      
Sbjct: 243 ELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAG 302

Query: 430 SIGCLAKTFPAKEKRMIGPLVALLSNRNVDVATEAVIALSKFVSPDNFNRSEHSKAIIEF 489
               + +        ++  LV +LS  +     EA  A++ + S       E    ++  
Sbjct: 303 RQDQIQQVVN---HGLVPFLVGVLSKADFKTQKEAAWAITNYTS---GGTVEQIVYLVHC 356

Query: 490 DGVPPLMRLLKISD-RAQVHGLVFLCYLALSAGNSKALEQARAL 532
             + PLM LL   D +     L  +  +  +A      E+   +
Sbjct: 357 GIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIM 400


>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query576
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 100.0
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.97
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.92
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.88
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.78
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.76
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.75
d1b3ua_588 Constant regulatory domain of protein phosphatase 98.63
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 98.59
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 98.49
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 98.46
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.23
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.9
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 97.72
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 97.68
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.67
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 97.63
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 97.57
d2bpta1861 Importin beta {Baker's yeast (Saccharomyces cerevi 97.33
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.3
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 96.99
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 96.92
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 96.88
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 96.52
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 96.48
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 95.49
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 93.86
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 92.33
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 90.94
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Importin alpha
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=3.3e-32  Score=283.97  Aligned_cols=385  Identities=17%  Similarity=0.187  Sum_probs=275.9

Q ss_pred             cchHhHHHHHHHHHHhcCCHHHHHHHHHHHHHHhhcCccc--HHHHHhcCCHHHHHHHHccCCChHHHHHHHHHHHHhhc
Q 041643          157 NDPILAWVWSFISTIQMGQIKSRVDAANELASLARDNNRN--RKIIVEEGGILPLLKLLKEAASPDAQTAAANALFNIAT  234 (576)
Q Consensus       157 ~~~i~~~v~~li~~L~~G~~e~k~~AA~~L~~La~~~~~~--~~~I~~~GgIppLV~LL~~g~~~~~q~~AA~AL~nLa~  234 (576)
                      .+..++.|++++..|++++.+.+.+|+..|+++.+. +.+  ...+++.|+||+|+++|++.++++.|..|+++|.+|+.
T Consensus         8 ~~~~~~~i~~lv~~l~s~~~~~~~~a~~~l~~l~s~-~~~~~~~~i~~~g~i~~Lv~lL~~~~~~~v~~~a~~~L~~la~   86 (434)
T d1q1sc_           8 QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSR-EKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIAS   86 (434)
T ss_dssp             TSSSSCCHHHHHHHHTSSCHHHHHHHHHHHHHHHHS-SSCCCHHHHHHTTCHHHHHHHTTCGGGHHHHHHHHHHHHHHHT
T ss_pred             cchhhhhHHHHHHHHcCCCHHHHHHHHHHHHHHhcC-CCCchHHHHHHCCCHHHHHHHHccCCCHHHHHHHHHHHHHHhc
Confidence            344556688999999999999999999999988764 333  56788999999999999765448899999999999988


Q ss_pred             C-CchHHHHHHcCCHHHHHHhhcCCChhHHHHHHHHHHHHhcCChHHHHHHHhcCCchhHHHhhccccccCCCcchhhhh
Q 041643          235 D-QETVRFIVDVLGVPIIVSVLGEAPVKVQVAVANLVARMAELDSIAQEEFVRENVTRSLISLLCMDIALDLPKPESAKT  313 (576)
Q Consensus       235 ~-~~~~~~iv~~Gavp~LV~lL~s~~~~vq~~Aa~aL~~LA~~~~~~r~~i~~~g~I~~LV~LL~~~t~~~~~~~i~~~~  313 (576)
                      . ++.+..+++.|++|.|+++|++++.++++.++++|+|++.+++++|..+.+.|++++|+.+|...........     
T Consensus        87 ~~~~~~~~i~~~~~i~~l~~~L~~~~~~~~~~a~~~L~nl~~~~~~~~~~i~~~~~~~~l~~~l~~~~~~~~~~~-----  161 (434)
T d1q1sc_          87 GTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACG-----  161 (434)
T ss_dssp             SCHHHHHHHHHTTHHHHHHHHTTCSCHHHHHHHHHHHHHHHTTCHHHHHHHHHTTCHHHHHHHTCSSCGGGSCHH-----
T ss_pred             CChhhhhHhhhccchhhhhhccccCCHHHHHHHHHHHHHHhccchHHHHHHHHhhhhhHHHHHHHhcccccchHH-----
Confidence            5 5678899999999999999999999999999999999999999999999999999999999976532111100     


Q ss_pred             HHHHHHhhhccccccccccCCCCCCCCCCCCCCCCcccccccCCHHHHHHHHHHHHHHHHHhhcCCcccc----------
Q 041643          314 TIHSLVQMKKEMTEKSTNVTNNSDGSSRGGHGQHYNKKDRELETPEVKAKVRIACAEALWKLSKGCLLSL----------  383 (576)
Q Consensus       314 si~~~v~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~e~~d~~vk~~~k~~Aa~ALw~La~g~~~~I----------  383 (576)
                      .+....+.-.....    +....+......+.++.+.......|+++    +..++++|.+|+.++...+          
T Consensus       162 ~~~~~~~~l~~~~~----~~~~~~~~~~~~~~l~~l~~ll~~~~~~~----~~~a~~~l~~l~~~~~~~~~~~~~~~~~~  233 (434)
T d1q1sc_         162 YLRNLTWTLSNLCR----NKNPAPPLDAVEQILPTLVRLLHHNDPEV----LADSCWAISYLTDGPNERIEMVVKKGVVP  233 (434)
T ss_dssp             HHHHHHHHHHHHTC----CCTTCCCHHHHHHHHHHHHHHTTCSCHHH----HHHHHHHHHHHTSSCHHHHHHHHTTTCHH
T ss_pred             HHHHHHHHHHHHhh----cccccchhhhhhhHHHHHHHHHhccccch----hhhHHhhhcccchhhhhhHHHHhhcccch
Confidence            11111111111000    00000000000001111112234456664    4689999999987755441          


Q ss_pred             ----hhcccchHHHHhhhc------cCch-hH-----HHHHHHHHHHhhhcCChhhHHHHHHHHHHHhcCCch-----hh
Q 041643          384 ----WSAESNAELRRSAFK------TNSP-AA-----KAVLDQLLRLIHEESDAMLQTPAIRSIGCLAKTFPA-----KE  442 (576)
Q Consensus       384 ----avae~~~~lrr~a~k------~~s~-a~-----~~vV~~Ll~lL~~~~~~~lq~~a~~aLgnLa~~~~~-----~~  442 (576)
                          .+-..+.+++..++.      .+.+ ..     .++++.|+.++++.+ ++++..++.+|+||+.....     .+
T Consensus       234 ~Lv~ll~~~~~~~~~~al~~l~~l~~~~~~~~~~~~~~~~~~~l~~ll~~~~-~~v~~~a~~~L~~l~~~~~~~~~~i~~  312 (434)
T d1q1sc_         234 QLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPK-TNIQKEATWTMSNITAGRQDQIQQVVN  312 (434)
T ss_dssp             HHHHHHTCSCHHHHHHHHHHHHHHTTSCHHHHHHHHHTTGGGGHHHHTTCSS-HHHHHHHHHHHHHHTTSCHHHHHHHHH
T ss_pred             hcccccccchhhhhhchhhhhhhHHhhhhHHHHHHHhccccchHHHhhcccc-hhhhHHHHHHHhhhccccchhHHHHhh
Confidence                111123334433321      1010 11     234456888887755 88999999999999975543     24


Q ss_pred             hCcHHHHHHhhcCCCHHHHHHHHHHHHhhcCCCCCCCHHHHHHHHHCCCcHhHHHhhccChh-HHHHHHHHHHHHhc---
Q 041643          443 KRMIGPLVALLSNRNVDVATEAVIALSKFVSPDNFNRSEHSKAIIEFDGVPPLMRLLKISDR-AQVHGLVFLCYLAL---  518 (576)
Q Consensus       443 ~~~I~~LV~LL~~~~~~V~~eAa~AL~nla~~~n~~~~~~~~~Iv~~ggi~~Lv~LL~~~d~-vq~~A~~~L~~lal---  518 (576)
                      .+++|.++++|.+.+.+++.+|+|+|+|++...+   .++...+.+.|++++|+++|...|. ++..++.+|.++..   
T Consensus       313 ~~~i~~li~~l~~~~~~v~~~a~~~l~nl~~~~~---~~~~~~l~~~~~i~~L~~ll~~~d~~~~~~~l~~l~~ll~~~~  389 (434)
T d1q1sc_         313 HGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGT---VEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAE  389 (434)
T ss_dssp             TTCHHHHHHHHHSSCHHHHHHHHHHHHHHHHHSC---HHHHHHHHHTTCHHHHHHHTTSSCHHHHHHHHHHHHHHHHHHH
T ss_pred             hhhHHHHHHHHhccChHHHHHHHHHHHHHHhcCC---HHHHHHHHHCCcHHHHHHHhcCCCHHHHHHHHHHHHHHHHHHH
Confidence            5799999999999999999999999999987553   5788899999999999999998876 77777777766632   


Q ss_pred             ccCch----HHHHhccchhhHhhhhcccCCCCCcHHHHHHHHHHHHHhhcC
Q 041643          519 SAGNS----KALEQARALNALEGAARTVLPQHPELRDLFAQAIYHLTLYQA  565 (576)
Q Consensus       519 ~~~~~----~~l~~~~~l~~Le~~~~~~~~q~~~~~~l~~~a~~~l~~y~~  565 (576)
                      +.++.    ..+.+.|+++.|+.      +|+|++++++..|..+|+.||+
T Consensus       390 ~~~~~~~~~~~~~~~~~~~~i~~------L~~~~n~~i~~~a~~il~~~f~  434 (434)
T d1q1sc_         390 KLGETEKLSIMIEECGGLDKIEA------LQRHENESVYKASLNLIEKYFS  434 (434)
T ss_dssp             TTTCHHHHHHHHHHTTSHHHHHH------HHTCSSHHHHHHHHHHHHHHCC
T ss_pred             hcCCcHHHHHHHHHcCCHHHHHH------HHcCCCHHHHHHHHHHHHHHhC
Confidence            23332    23556677766654      4789999999999999999996



>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure