Citrus Sinensis ID: 041664

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MQLVSNDSHNEDISESEPILPQPDILRRSEESSSSCSSSSSSSSSSEITAVREDCVVSADDLQNLHVDETSYLVNDDQPQCRICLDIGGEDLIAPCHCRGTQKYVHRSCLDHWRSTKEGFAFAHCTECRAMFILRTNCPPDRWWLRLKFQFLVARDHTFIFVIVQLIVALLGVLVYKFYGEELREIFGYEEHPYAFYIMAVLAIILVGVLYGFFIAIICGQRIHERHYHVLAKQELTKEYVVEDREKNKDIPELDPSHVSELRMLGLY
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccEEEcccccccccHHHHHHHHHHHHHccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccEEEccccccccccccccccccHHHHcccc
ccEEEccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHEEEEccccccccccccHHHHHHHHHHccc
mqlvsndshnedisesepilpqpdilrrseesssscsssssssssseitAVREDCVVsaddlqnlhvdetsylvnddqpqcricldiggedliapchcrgtqkyvhrscldhwrstkegfafAHCTECRAMFIlrtncppdrwwLRLKFQFLVARDHTFIFVIVQLIVALLGVLVYKFYGEELREifgyeehpyAFYIMAVLAIILVGVLYGFFIAIICGQRIHERHYHVLAKQELTKEYVVEdreknkdipeldpshvseLRMLGLY
mqlvsndshnedisesepilpqpdILRRSEesssscsssssssssseitAVREDCVVSADDLQNLHVDEtsylvnddqpQCRICLDIGGEDLIAPCHCRGTQKYVHRSCLDHWRSTKEGFAFAHCTECRAMFILRTNCPPDRWWLRLKFQFLVARDHTFIFVIVQLIVALLGVLVYKFYGEELREIFGYEEHPYAFYIMAVLAIILVGVLYGFFIAIICGQRIHERHYHVLAKQELTKEYVVEDreknkdipeldpshvselrmlgly
MQLVSNDSHNEDISESEPILPQPDILRRseesssscsssssssssseITAVREDCVVSADDLQNLHVDETSYLVNDDQPQCRICLDIGGEDLIAPCHCRGTQKYVHRSCLDHWRSTKEGFAFAHCTECRAMFILRTNCPPDRWWLRLKFQFLVARDHTFIFVIVQLIVALLGVLVYKFYGEELREIFGYEEHPYAFYIMAVLAIILVGVLYGFFIAIICGQRIHERHYHVLAKQELTKEYVVEDREKNKDIPELDPSHVSELRMLGLY
**************************************************VREDCVVSADDLQNLHVDETSYLVNDDQPQCRICLDIGGEDLIAPCHCRGTQKYVHRSCLDHWRSTKEGFAFAHCTECRAMFILRTNCPPDRWWLRLKFQFLVARDHTFIFVIVQLIVALLGVLVYKFYGEELREIFGYEEHPYAFYIMAVLAIILVGVLYGFFIAIICGQRIHERHYHVLAKQELTKEYVV**************************
*********************************************************************************RICLDIGGEDLIAPCHCRGTQKYVHRSCLDHWRSTKEGFAFAHCTECRAMFILRTNCPPDRWWLRLKFQFLVARDHTFIFVIVQLIVALLGVLVYKFYGEELREIFGYEEHPYAFYIMAVLAIILVGVLYGFFIAIICGQRIHERHYHVLAKQELTKEYV**********************MLGL*
****************EPILPQPDI************************AVREDCVVSADDLQNLHVDETSYLVNDDQPQCRICLDIGGEDLIAPCHCRGTQKYVHRSCLDHWRSTKEGFAFAHCTECRAMFILRTNCPPDRWWLRLKFQFLVARDHTFIFVIVQLIVALLGVLVYKFYGEELREIFGYEEHPYAFYIMAVLAIILVGVLYGFFIAIICGQRIHERHYHVLAKQELTKEYVVEDREKNKDIPELDPSHVSELRMLGLY
*****************************************************************************QPQCRICLDIGGEDLIAPCHCRGTQKYVHRSCLDHWRSTKEGFAFAHCTECRAMFILRTNCPPDRWWLRLKFQFLVARDHTFIFVIVQLIVALLGVLVYKFYGEELREIFGYEEHPYAFYIMAVLAIILVGVLYGFFIAIICGQRIHERHYHVLAKQELTKEYVVEDREKNKDIPELDPSHVSELRMLGLY
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQLVSNDSHNEDISESEPILPQPDILRRSEESSSSCSSSSSSSSSSEITAVREDCVVSADDLQNLHVDETSYLVNDDQPQCRICLDIGGEDLIAPCHCRGTQKYVHRSCLDHWRSTKEGFAFAHCTECRAMFILRTNCPPDRWWLRLKFQFLVARDHTFIFVIVQLIVALLGVLVYKFYGEELREIFGYEEHPYAFYIMAVLAIILVGVLYGFFIAIICGQRIHERHYHVLAKQELTKEYVVEDREKNKDIPELDPSHVSELRMLGLY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query268 2.2.26 [Sep-21-2011]
Q9DBD2286 E3 ubiquitin-protein liga yes no 0.496 0.465 0.286 6e-09
Q8TCQ1289 E3 ubiquitin-protein liga yes no 0.720 0.667 0.265 1e-08
Q86UD3253 E3 ubiquitin-protein liga no no 0.772 0.818 0.256 4e-08
Q6NZQ8289 E3 ubiquitin-protein liga no no 0.477 0.442 0.303 5e-08
Q5XH39264 E3 ubiquitin-protein liga N/A no 0.608 0.617 0.291 6e-08
Q5XIE5253 E3 ubiquitin-protein liga no no 0.380 0.403 0.330 6e-08
Q5T0T0291 E3 ubiquitin-protein liga no no 0.507 0.467 0.274 9e-08
Q8BRX9218 E3 ubiquitin-protein liga no no 0.380 0.467 0.330 9e-08
Q28IK8264 E3 ubiquitin-protein liga no no 0.496 0.503 0.286 1e-07
A0JN69253 E3 ubiquitin-protein liga yes no 0.380 0.403 0.322 1e-07
>sp|Q9DBD2|MARH8_MOUSE E3 ubiquitin-protein ligase MARCH8 OS=Mus musculus GN=March8 PE=2 SV=1 Back     alignment and function desciption
 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 71/150 (47%), Gaps = 17/150 (11%)

Query: 76  DDQPQCRICLDIGGED--LIAPCHCRGTQKYVHRSCLDHWRSTKEGFAFAHCTECRAMFI 133
            +Q  CRIC   G ++  LI PCHC G+  +VH++CL  W  + +      C  C+  FI
Sbjct: 71  SNQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRC---CELCKYEFI 127

Query: 134 LRTNCPPDRWWLRLKFQFLVARDHTFIFVIVQLIVALLGVLVYKFY------GEELR--E 185
           + T   P R W +L+   + A +   I   V   V  +  +V+  Y       EE++  +
Sbjct: 128 METKLKPLRKWEKLQ---MTASERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQ 184

Query: 186 IFGYEEHPYAFYIMAVLAIILVGVLYGFFI 215
           + G  E P+ +  + V+AI   G L   ++
Sbjct: 185 VTGILEWPF-WTKLVVVAIGFTGGLLFMYV 213
E3 ubiquitin-protein ligase that mediates ubiquitination of CD86 and MHC class II proteins, such as HLA-DR alpha and beta, and promotes their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. May also promote ubiquitination and endocytosis of TFRC and FAS.
Mus musculus (taxid: 10090)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q8TCQ1|MARH1_HUMAN E3 ubiquitin-protein ligase MARCH1 OS=Homo sapiens GN=MARCH1 PE=1 SV=1 Back     alignment and function description
>sp|Q86UD3|MARH3_HUMAN E3 ubiquitin-protein ligase MARCH3 OS=Homo sapiens GN=MARCH3 PE=2 SV=1 Back     alignment and function description
>sp|Q6NZQ8|MARH1_MOUSE E3 ubiquitin-protein ligase MARCH1 OS=Mus musculus GN=March1 PE=1 SV=2 Back     alignment and function description
>sp|Q5XH39|MARH8_XENLA E3 ubiquitin-protein ligase MARCH8 OS=Xenopus laevis GN=march8 PE=2 SV=2 Back     alignment and function description
>sp|Q5XIE5|MARH3_RAT E3 ubiquitin-protein ligase MARCH3 OS=Rattus norvegicus GN=March3 PE=1 SV=1 Back     alignment and function description
>sp|Q5T0T0|MARH8_HUMAN E3 ubiquitin-protein ligase MARCH8 OS=Homo sapiens GN=MARCH8 PE=1 SV=1 Back     alignment and function description
>sp|Q8BRX9|MARH3_MOUSE E3 ubiquitin-protein ligase MARCH3 OS=Mus musculus GN=March3 PE=2 SV=1 Back     alignment and function description
>sp|Q28IK8|MARH8_XENTR E3 ubiquitin-protein ligase MARCH8 OS=Xenopus tropicalis GN=march8 PE=2 SV=1 Back     alignment and function description
>sp|A0JN69|MARH3_BOVIN E3 ubiquitin-protein ligase MARCH3 OS=Bos taurus GN=MARCH3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query268
225443415258 PREDICTED: E3 ubiquitin-protein ligase M 0.962 1.0 0.794 1e-121
255544524256 membrane associated ring finger 1,8, put 0.955 1.0 0.787 1e-117
449453346261 PREDICTED: E3 ubiquitin-protein ligase M 0.970 0.996 0.769 1e-116
224109974259 predicted protein [Populus trichocarpa] 0.966 1.0 0.764 1e-114
224097424259 predicted protein [Populus trichocarpa] 0.962 0.996 0.760 1e-112
358248317257 uncharacterized protein LOC100789593 [Gl 0.955 0.996 0.754 1e-112
363807414273 uncharacterized protein LOC100808123 [Gl 0.962 0.945 0.699 1e-107
115444035272 Os02g0132300 [Oryza sativa Japonica Grou 0.981 0.966 0.640 9e-98
218189993345 hypothetical protein OsI_05734 [Oryza sa 0.861 0.669 0.711 3e-97
242060388272 hypothetical protein SORBIDRAFT_04g00269 0.981 0.966 0.640 3e-97
>gi|225443415|ref|XP_002268835.1| PREDICTED: E3 ubiquitin-protein ligase MARCH1 [Vitis vinifera] gi|297735744|emb|CBI18431.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 213/268 (79%), Positives = 228/268 (85%), Gaps = 10/268 (3%)

Query: 1   MQLVSNDSHNEDISESEPILPQPDILRRSEESSSSCSSSSSSSSSSEITAVREDCVVSAD 60
           MQLVSND   ED SE+EPIL Q +I +R EESS+SC          EI  V  DC +   
Sbjct: 1   MQLVSNDRQTEDGSETEPILCQSNIEQRLEESSTSC----------EIRTVEVDCSIVDG 50

Query: 61  DLQNLHVDETSYLVNDDQPQCRICLDIGGEDLIAPCHCRGTQKYVHRSCLDHWRSTKEGF 120
           DL+NL  DE   LVN DQPQCRICLDIGGEDLIAPCHCRGTQKYVHRSCLD+WRSTKEGF
Sbjct: 51  DLENLDTDENCALVNADQPQCRICLDIGGEDLIAPCHCRGTQKYVHRSCLDNWRSTKEGF 110

Query: 121 AFAHCTECRAMFILRTNCPPDRWWLRLKFQFLVARDHTFIFVIVQLIVALLGVLVYKFYG 180
           AFAHCTECRA+FILR N PPDRWWLRLKFQ LVARDH FIFVIVQLIVA LGVLVYKFYG
Sbjct: 111 AFAHCTECRAVFILRANVPPDRWWLRLKFQLLVARDHAFIFVIVQLIVAFLGVLVYKFYG 170

Query: 181 EELREIFGYEEHPYAFYIMAVLAIILVGVLYGFFIAIICGQRIHERHYHVLAKQELTKEY 240
           EELRE+FGY+EHPY FY MAVLAI+LVG+LYGFFIAIICGQRI+ERHYHVLAKQELTKEY
Sbjct: 171 EELREMFGYDEHPYGFYTMAVLAIVLVGLLYGFFIAIICGQRINERHYHVLAKQELTKEY 230

Query: 241 VVEDREKNKDIPELDPSHVSELRMLGLY 268
           VVEDRE NKD+PELDPSHV+ELRMLGLY
Sbjct: 231 VVEDREVNKDVPELDPSHVTELRMLGLY 258

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255544524|ref|XP_002513323.1| membrane associated ring finger 1,8, putative [Ricinus communis] gi|223547231|gb|EEF48726.1| membrane associated ring finger 1,8, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449453346|ref|XP_004144419.1| PREDICTED: E3 ubiquitin-protein ligase MARCH1-like [Cucumis sativus] gi|449519260|ref|XP_004166653.1| PREDICTED: E3 ubiquitin-protein ligase MARCH1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224109974|ref|XP_002315373.1| predicted protein [Populus trichocarpa] gi|222864413|gb|EEF01544.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224097424|ref|XP_002310928.1| predicted protein [Populus trichocarpa] gi|118483623|gb|ABK93706.1| unknown [Populus trichocarpa] gi|222850748|gb|EEE88295.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|358248317|ref|NP_001240116.1| uncharacterized protein LOC100789593 [Glycine max] gi|255638130|gb|ACU19379.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|363807414|ref|NP_001242639.1| uncharacterized protein LOC100808123 [Glycine max] gi|255639405|gb|ACU19998.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|115444035|ref|NP_001045797.1| Os02g0132300 [Oryza sativa Japonica Group] gi|41052575|dbj|BAD07757.1| zinc finger (C3HC4-type RING finger) protein-like [Oryza sativa Japonica Group] gi|113535328|dbj|BAF07711.1| Os02g0132300 [Oryza sativa Japonica Group] gi|215687191|dbj|BAG91756.1| unnamed protein product [Oryza sativa Japonica Group] gi|215737140|dbj|BAG96069.1| unnamed protein product [Oryza sativa Japonica Group] gi|215741406|dbj|BAG97901.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|218189993|gb|EEC72420.1| hypothetical protein OsI_05734 [Oryza sativa Indica Group] gi|222622114|gb|EEE56246.1| hypothetical protein OsJ_05261 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|242060388|ref|XP_002451483.1| hypothetical protein SORBIDRAFT_04g002690 [Sorghum bicolor] gi|241931314|gb|EES04459.1| hypothetical protein SORBIDRAFT_04g002690 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query268
TAIR|locus:2008056250 AT1G50440 [Arabidopsis thalian 0.820 0.88 0.741 9.3e-91
TAIR|locus:2197434321 AT1G11020 [Arabidopsis thalian 0.600 0.501 0.397 1e-27
UNIPROTKB|F1NR21209 MARCH3 "Uncharacterized protei 0.253 0.325 0.402 1.8e-09
ZFIN|ZDB-GENE-080204-8282 march8 "membrane-associated ri 0.511 0.485 0.302 2.2e-09
UNIPROTKB|F1NAM1185 MARCH3 "Uncharacterized protei 0.231 0.335 0.393 3.2e-09
UNIPROTKB|B9EJE7138 MARCH3 "Membrane-associated ri 0.231 0.449 0.393 3.2e-09
MGI|MGI:1919029286 March8 "membrane-associated ri 0.503 0.472 0.309 3.3e-09
RGD|1309339286 March8 "membrane-associated ri 0.503 0.472 0.309 3.3e-09
MGI|MGI:2443667218 March3 "membrane-associated ri 0.253 0.311 0.402 3.7e-09
RGD|1305148285 March1 "membrane-associated ri 0.503 0.473 0.306 5.7e-09
TAIR|locus:2008056 AT1G50440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 905 (323.6 bits), Expect = 9.3e-91, P = 9.3e-91
 Identities = 166/224 (74%), Positives = 192/224 (85%)

Query:    48 ITAVREDCVVS---ADDLQNLHVDETSYLVNDDQPQCRICLDIGGEDLIAPCHCRGTQKY 104
             + A R D VV      ++     DET+ LV+ DQPQCRICLD+GGEDLIAPC+C+GTQK+
Sbjct:    28 VAAERGDRVVEEGQVSEIAETDDDETTLLVSGDQPQCRICLDVGGEDLIAPCNCKGTQKH 87

Query:   105 VHRSCLDHWRSTKEGFAFAHCTECRAMFILRTNCPPDRWWLRLKFQFLVARDHTFIFVIV 164
             VHRSCLD+WRSTKEGFAF+HCTECRA F LR N P DRWWLRL+FQ LVARDH FIF+ V
Sbjct:    88 VHRSCLDNWRSTKEGFAFSHCTECRAFFKLRANVPADRWWLRLRFQLLVARDHAFIFISV 147

Query:   165 QLIVALLGVLVYKFYGEELREIFGYEEHPYAFYIMAVLAIILVGVLYGFFIAIICGQRIH 224
             Q+IVA LG+LVYKFYGEELRE+FGYEEHPY FY +AVLAI+LVG+LYGFFIAIICGQ+I+
Sbjct:   148 QMIVAFLGLLVYKFYGEELREMFGYEEHPYGFYTLAVLAIVLVGLLYGFFIAIICGQKIN 207

Query:   225 ERHYHVLAKQELTKEYVVEDREKNKDIPELDPSHVSELRMLGLY 268
             ERHYHVLAKQELTKEY+VEDR+  K++PELD SHV EL+MLGLY
Sbjct:   208 ERHYHVLAKQELTKEYIVEDRDC-KNVPELDQSHVMELKMLGLY 250
GO:0005737 "cytoplasm" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
TAIR|locus:2197434 AT1G11020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NR21 MARCH3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080204-8 march8 "membrane-associated ring finger (C3HC4) 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NAM1 MARCH3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|B9EJE7 MARCH3 "Membrane-associated ring finger (C3HC4) 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1919029 March8 "membrane-associated ring finger (C3HC4) 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309339 March8 "membrane-associated ring finger (C3HC4) 8, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2443667 March3 "membrane-associated ring finger (C3HC4) 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305148 March1 "membrane-associated ring finger (C3HC4) 1, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query268
smart0074449 smart00744, RINGv, The RING-variant domain is a C4 2e-12
pfam1290647 pfam12906, RINGv, RING-variant domain 1e-10
COG5183 1175 COG5183, SSM4, Protein involved in mRNA turnover a 2e-08
>gnl|CDD|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information 
 Score = 60.4 bits (147), Expect = 2e-12
 Identities = 19/40 (47%), Positives = 27/40 (67%), Gaps = 2/40 (5%)

Query: 80  QCRICLDIG--GEDLIAPCHCRGTQKYVHRSCLDHWRSTK 117
            CRIC D G  G+ L++PC C+G+ KYVH+ CL+ W +  
Sbjct: 1   ICRICHDEGDEGDPLVSPCRCKGSLKYVHQECLERWINES 40

Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Classical RING domain: C-x (2) -C-x (9-39)-C-x(1-3)-H-x(2-3)-C-x(2)-C-x(4-48) -C-x(2)-C. Length = 49
>gnl|CDD|221845 pfam12906, RINGv, RING-variant domain Back     alignment and domain information
>gnl|CDD|227510 COG5183, SSM4, Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 268
KOG3053293 consensus Uncharacterized conserved protein [Funct 99.94
PHA02825162 LAP/PHD finger-like protein; Provisional 99.84
PHA02862156 5L protein; Provisional 99.83
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 99.61
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 99.56
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 99.55
KOG1609323 consensus Protein involved in mRNA turnover and st 99.39
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 97.33
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 97.24
PHA02929238 N1R/p28-like protein; Provisional 96.92
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 96.77
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 96.51
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 96.39
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 96.34
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 96.28
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 96.11
cd0016245 RING RING-finger (Really Interesting New Gene) dom 95.97
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 95.97
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 95.63
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 95.5
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 95.13
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 94.94
PHA02926242 zinc finger-like protein; Provisional 94.86
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 94.71
KOG149384 consensus Anaphase-promoting complex (APC), subuni 94.01
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 93.99
smart0050463 Ubox Modified RING finger domain. Modified RING fi 93.42
PF11460104 DUF3007: Protein of unknown function (DUF3007); In 93.25
COG52191525 Uncharacterized conserved protein, contains RING Z 92.45
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 91.37
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 91.13
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 91.05
PF15050133 SCIMP: SCIMP protein 90.48
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 90.02
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 88.93
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 88.67
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 88.1
PLN02189 1040 cellulose synthase 85.9
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 82.41
KOG0825 1134 consensus PHD Zn-finger protein [General function 82.06
PLN02436 1094 cellulose synthase A 81.96
PF10272358 Tmpp129: Putative transmembrane protein precursor; 81.08
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information 
Probab=99.94  E-value=1.4e-28  Score=222.18  Aligned_cols=164  Identities=26%  Similarity=0.529  Sum_probs=119.7

Q ss_pred             CCCCCceEEeccCCCC----ccccccccCCcCcccchhHHHHHHHhcCC---CcccccccCCceeeeeeecCCCchhhhc
Q 041664           75 NDDQPQCRICLDIGGE----DLIAPCHCRGTQKYVHRSCLDHWRSTKEG---FAFAHCTECRAMFILRTNCPPDRWWLRL  147 (268)
Q Consensus        75 ~~~~~~CRIC~~~~~~----~li~PC~CkGs~k~VH~~CL~~Wi~~s~~---~~~~~Ce~Ck~~y~~~~~~~p~~~w~~l  147 (268)
                      ...++.||||+.+++|    .|++||+|+||.||||++||.+|+++|+.   .++..|++|+++|.+..   |..+|...
T Consensus        17 ~e~eR~CWiCF~TdeDn~~a~WV~PCrCRGt~KWVHqsCL~rWiDEK~~~n~~q~V~C~QCqTEYiiv~---P~l~~~~~   93 (293)
T KOG3053|consen   17 QELERCCWICFATDEDNRLAAWVHPCRCRGTTKWVHQSCLSRWIDEKQRGNPLQTVSCPQCQTEYIIVF---PQLGPFDR   93 (293)
T ss_pred             cccceeEEEEeccCcccchhhhcccccccCccHHHHHHHHHHHHhHHhcCCCCceeechhhcchheeec---cccChHHH
Confidence            3468999999998654    49999999999999999999999999853   47899999999999863   44444432


Q ss_pred             cceeeeeccchhhHHHHHH-HHHHHHHHHHH---hhhH-HHHHHhccCC------chhHHHHHHHHHHHHHHHHHHHHHH
Q 041664          148 KFQFLVARDHTFIFVIVQL-IVALLGVLVYK---FYGE-ELREIFGYEE------HPYAFYIMAVLAIILVGVLYGFFIA  216 (268)
Q Consensus       148 ~~~~lv~r~~~~if~~v~~-vv~~ig~~vy~---~yg~-elr~~~G~~~------~p~~f~~l~vL~ii~vgLll~~~i~  216 (268)
                      -.    .+.+..++-+..+ +.+++.+.+||   .||+ ++.|+.|++.      ..++.+++++||.|||||++|+||+
T Consensus        94 ~L----e~~d~~i~r~cp~l~~g~~v~~iYWsAVtyGA~T~lQv~G~~~~m~ime~~d~~~lliGlP~ipv~LiL~Rlir  169 (293)
T KOG3053|consen   94 VL----ERLDILIFRLCPFLAAGIFVGSIYWSAVTYGAVTVLQVVGQEHGMQIMESGDPLFLLIGLPSIPVGLILGRLIR  169 (293)
T ss_pred             HH----HHhhhHHhhcChHHHHHHHhheeehhhhhhcceeeeehhhhHHHHHHHhcCCceEEEEcCCcchHHHHHhhhee
Confidence            22    2333445544443 34566666666   5666 7777778752      1123467899999999999999999


Q ss_pred             HH-HhhhhhhhhhHHHh----Hhhccccceeecc
Q 041664          217 II-CGQRIHERHYHVLA----KQELTKEYVVEDR  245 (268)
Q Consensus       217 ~~-~~~r~~~r~y~~l~----k~~l~~e~~~~d~  245 (268)
                      |. +++|.++|.|-+++    --++.+||-+.+.
T Consensus       170 WeD~vLRl~R~~~s~ir~sl~~~~l~re~~~~~~  203 (293)
T KOG3053|consen  170 WEDAVLRLIRRKYSIIRVSLDDYELGREYPASLP  203 (293)
T ss_pred             HHHHHHHHHHHhccccccccccccccccCCCCCC
Confidence            99 99999998887775    2344555555443

>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF11460 DUF3007: Protein of unknown function (DUF3007); InterPro: IPR021562 This is a family of uncharacterised proteins found in bacteria and eukaryotes Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15050 SCIMP: SCIMP protein Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query268
2d8s_A80 Solution Structure Of The Ring Domain Of The Human 7e-04
>pdb|2D8S|A Chain A, Solution Structure Of The Ring Domain Of The Human Cellular Modulator Of Immune Recognition Protein Length = 80 Back     alignment and structure 
Iteration: 1

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 5/67 (7%)
Query: 73  LVNDDQPQCRICLDIGGED--LIAPCHCRGTQKYVHRSCLDHWRSTKEGFAFAHCTECRA 130
           +    Q  CRIC   G ++  LI PCHC G+  +VH++CL  W  + +      C  C+ 
Sbjct: 10  ITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRC---CELCKY 66
Query: 131 MFILRTN 137
            FI+ T 
Sbjct: 67  EFIMETK 73

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query268
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 6e-18
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 1e-16
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
 Score = 74.8 bits (184), Expect = 6e-18
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 3/61 (4%)

Query: 75  NDDQPQCRICLDIGGEDLIAPCHCRGTQKYVHRSCLDHWRSTKEGFAFAHCTECRAMFIL 134
           ++D P C IC +  G +    C C G  + VHRSCL  W +         C  C  ++  
Sbjct: 3   DEDVPVCWICNEELGNERFRACGCTGELENVHRSCLSTWLTISRN---TACQICGVVYNT 59

Query: 135 R 135
           R
Sbjct: 60  R 60
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query268
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 99.75
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.66
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.75
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 97.66
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 97.6
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.59
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 97.58
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 97.55
2ecm_A55 Ring finger and CHY zinc finger domain- containing 97.54
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 97.45
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 97.43
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 97.39
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.36
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 97.36
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 97.35
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 97.33
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 97.32
2ysl_A73 Tripartite motif-containing protein 31; ring-type 97.25
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 97.24
2ect_A78 Ring finger protein 126; metal binding protein, st 97.21
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 97.2
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.17
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 97.16
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 97.15
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.13
2ecw_A85 Tripartite motif-containing protein 30; metal bind 97.07
2ysj_A63 Tripartite motif-containing protein 31; ring-type 97.03
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 96.97
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 96.95
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 96.94
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 96.74
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 96.73
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 96.73
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 96.71
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 96.7
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 96.64
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 96.55
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 96.53
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 96.43
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 96.42
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 96.36
1z6u_A150 NP95-like ring finger protein isoform B; structura 96.3
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 96.28
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 96.14
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 96.11
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 95.99
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 95.92
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 95.7
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 95.42
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 95.34
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 94.96
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 94.71
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 94.36
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 94.27
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 94.21
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 94.18
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 94.1
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 93.13
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 93.13
3nw0_A238 Non-structural maintenance of chromosomes element 93.0
2ea5_A68 Cell growth regulator with ring finger domain prot 92.79
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 92.77
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 91.91
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 91.88
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 91.24
2f42_A179 STIP1 homology and U-box containing protein 1; cha 90.23
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 88.42
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 86.83
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 84.31
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 83.09
1weu_A91 Inhibitor of growth family, member 4; structural g 80.11
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
Probab=99.75  E-value=2.4e-19  Score=129.24  Aligned_cols=57  Identities=33%  Similarity=0.781  Sum_probs=51.7

Q ss_pred             CCCCceEEeccCCCCccccccccCCcCcccchhHHHHHHHhcCCCcccccccCCceeeee
Q 041664           76 DDQPQCRICLDIGGEDLIAPCHCRGTQKYVHRSCLDHWRSTKEGFAFAHCTECRAMFILR  135 (268)
Q Consensus        76 ~~~~~CRIC~~~~~~~li~PC~CkGs~k~VH~~CL~~Wi~~s~~~~~~~Ce~Ck~~y~~~  135 (268)
                      .+++.||||+++++++++.||+|+|+++|||++||++|++.++   ...||+|+++|+++
T Consensus         4 ~~~~~CrIC~~~~~~~l~~PC~C~gs~~~~H~~Cl~~W~~~~~---~~~C~~C~~~~~~r   60 (60)
T 1vyx_A            4 EDVPVCWICNEELGNERFRACGCTGELENVHRSCLSTWLTISR---NTACQICGVVYNTR   60 (60)
T ss_dssp             CSCCEETTTTEECSCCCCCSCCCSSGGGSCCHHHHHHHHHHHT---CSBCTTTCCBCCCC
T ss_pred             CCCCEeEEeecCCCCceecCcCCCCchhhhHHHHHHHHHHhCC---CCccCCCCCeeecC
Confidence            4678999999987778999999999999999999999999886   37999999999873
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 268
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 2e-08
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

 Score = 47.9 bits (113), Expect = 2e-08
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 3/61 (4%)

Query: 75  NDDQPQCRICLDIGGEDLIAPCHCRGTQKYVHRSCLDHWRSTKEGFAFAHCTECRAMFIL 134
           ++D P C IC +  G +    C C G  + VHRSCL  W +         C  C  ++  
Sbjct: 3   DEDVPVCWICNEELGNERFRACGCTGELENVHRSCLSTWLTI---SRNTACQICGVVYNT 59

Query: 135 R 135
           R
Sbjct: 60  R 60

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query268
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.52
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 97.96
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.83
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 97.72
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 97.7
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 97.66
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.59
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 97.32
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.19
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.03
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 96.47
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 95.96
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 94.55
d2c2la280 STIP1 homology and U box-containing protein 1, STU 94.41
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 93.23
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 91.31
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 90.2
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 86.18
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 80.98
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

Probab=99.52  E-value=1.6e-15  Score=106.76  Aligned_cols=58  Identities=33%  Similarity=0.800  Sum_probs=51.9

Q ss_pred             CCCCCceEEeccCCCCccccccccCCcCcccchhHHHHHHHhcCCCcccccccCCceeeee
Q 041664           75 NDDQPQCRICLDIGGEDLIAPCHCRGTQKYVHRSCLDHWRSTKEGFAFAHCTECRAMFILR  135 (268)
Q Consensus        75 ~~~~~~CRIC~~~~~~~li~PC~CkGs~k~VH~~CL~~Wi~~s~~~~~~~Ce~Ck~~y~~~  135 (268)
                      .++.++|+||+++.+++++.||.|+|..+++|+.||++|+..+++   ..||+|+++|+++
T Consensus         3 ded~~~C~IC~~~~~~~~~~~c~c~~c~h~~H~~Cl~~W~~~~~~---~~CP~Cr~~~~~k   60 (60)
T d1vyxa_           3 DEDVPVCWICNEELGNERFRACGCTGELENVHRSCLSTWLTISRN---TACQICGVVYNTR   60 (60)
T ss_dssp             TCSCCEETTTTEECSCCCCCSCCCSSGGGSCCHHHHHHHHHHHTC---SBCTTTCCBCCCC
T ss_pred             CCCCCCCccCCccCCCceeEecccCCCCCEEcHHHHHHHHhhCCC---CCCcccCCeeecC
Confidence            346789999999877889999999999999999999999988763   7999999999863
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure