Score = 65.9 bits (159), Expect = 7e-11, Method: Composition-based stats.
Identities = 25/61 (40%), Positives = 42/61 (68%)
Query: 3 PSETEVNQLVDDAEKYTLANHIFWGLWGLISAYVNKIDFNYKEYARQRFQQYWMKKQELL 62
PS E+ +L ++ LA H FWG+WGL+ A+ ++IDF++ EYA R +Y+++K++ L
Sbjct: 285 PSSREIEKLYVHVNQFALAAHFFWGVWGLVQAHYSEIDFDFLEYAITRLNEYYLRKEKFL 344
Query: 63 S 63
S
Sbjct: 345 S 345
Highly specific for ethanolamine phosphorylation. May be a rate-controlling step in phosphatidylethanolamine biosynthesis. Nematostella vectensis (taxid: 45351) EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 8EC: 2
>sp|Q554D8|EKIB_DICDI Probable ethanolamine kinase B OS=Dictyostelium discoideum GN=etnkB PE=3 SV=1
Has a key role in phospholipid biosynthesis. Catalyzes the first step in phosphatidylethanolamine biosynthesis. Phosphorylates ethanolamine, and can also act on choline (in vitro). Has higher activity with ethanolamine. May not significantly contribute to in vivo phosphatidylcholine biosynthesis.
Mus musculus (taxid: 10090)
EC: 2
EC: .
EC: 7
EC: .
EC: 1
EC: .
EC: 8
EC: 2
>sp|Q869T9|EKIA_DICDI Probable ethanolamine kinase A OS=Dictyostelium discoideum GN=etnkA PE=3 SV=1
Has a key role in phospholipid biosynthesis. Catalyzes the first step in phosphatidylethanolamine biosynthesis. Phosphorylates ethanolamine, and can also act on choline (in vitro). Has higher activity with ethanolamine. May not significantly contribute to in vivo phosphatidylcholine biosynthesis.
Has a key role in phospholipid biosynthesis. Catalyzes the first step in phosphatidylethanolamine biosynthesis. Phosphorylates ethanolamine, and can also act on choline (in vitro). Has higher activity with ethanolamine. May not significantly contribute to in vivo phosphatidylcholine biosynthesis.
Has a key role in phospholipid biosynthesis and may contribute to tumor cell growth. Catalyzes the first step in phosphatidylcholine biosynthesis. Contributes to phosphatidylethanolamine biosynthesis. Phosphorylates choline and ethanolamine. Has higher activity with choline.
Score = 53.1 bits (126), Expect = 5e-07, Method: Composition-based stats.
Identities = 22/61 (36%), Positives = 41/61 (67%), Gaps = 1/61 (1%)
Query: 1 KQPSETEVNQLVDDAEKYTLANHIFWGLWGLISAYVNKIDFNYKEYARQRFQQYWMKKQE 60
++ S T+ + L++ ++ LA+H WGLW ++ A ++ I+F Y EYA+ RF Y+ +K++
Sbjct: 392 EEQSATKEDMLLE-VNRFALASHFLWGLWSIVQAKISSIEFGYMEYAQARFDAYFDQKRK 450
Query: 61 L 61
L
Sbjct: 451 L 451
Has a key role in phospholipid biosynthesis and may contribute to tumor cell growth. Catalyzes the first step in phosphatidylcholine biosynthesis. Contributes to phosphatidylethanolamine biosynthesis. Phosphorylates choline and ethanolamine. Has higher activity with choline.
Rattus norvegicus (taxid: 10116)
EC: 2
EC: .
EC: 7
EC: .
EC: 1
EC: .
EC: 8
EC: 2
Close Homologs in the Non-Redundant Database Detected by BLAST
The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC) and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. ChoK plays an important role in cell signaling pathways and the regulation of cell growth. Along with PCho, it is involved in malignant transformation through Ras oncogenes in various human cancers such as breast, lung, colon, prostate, neuroblastoma, and hepatic lymphoma. In mammalian cells, there are three ChoK isoforms (A-1, A-2, and B) which are active in homo or heterodimeric forms. Length = 302
The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC) and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. ChoK plays an important role in cell signaling pathways and the regulation of cell growth. Along with PCho, it is involved in malignant transformation through Ras oncogenes in various human cancer
>COG0510 ycfN Thiamine kinase and related kinases [Coenzyme transport and metabolism]
Members of this family are the ycfN gene product of Escherichia coli, now identified as the salvage enzyme thiamine kinase (thiK), and additional proteobacterial homologs taken to be orthologs with equivalent function.
Crystal Structure Of Choline Kinase From Plasmodium
6e-04
>pdb|3LQ3|A Chain A, Crystal Structure Of Human Choline Kinase Beta In Complex With Phosphorylated Hemicholinium-3 And Adenosine Nucleotide Length = 401
>pdb|3FEG|A Chain A, Crystal Structure Of Human Choline Kinase Beta In Complex With Phosphorylated Hemicholinium-3 And Adenosine Nucleotide Length = 379
