Citrus Sinensis ID: 041703

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140------
YWVGDSVWSIPPTTNFYNDWSSSHLFRIGDSIVFDFETELYNLMQVTALDYQTCKANNPIKVLNSGPATIVLNEQGVFYYLCNLSNYCDLGQKISIIVHGKNSFPPAPSPAAAPVEPLLTPLFAPSSSPEPSTDGWNVPDSPLPAP
cEEccccccccccccHHHHHcccccEEEccEEEEEEcccccEEEEEcHHHccccccccccccccccccEEEccccccEEEEcccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccEcccccccHHHHHccccEEEccEEEEEEccccccEEEEcHHHHHHccccccccEccccccEEEEcccccEEEEEccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccc
ywvgdsvwsippttnfyndwssshlfrigdsIVFDFETELYNLMQVTAldyqtckannpikvlnsgpativLNEQGVFYYLCNLsnycdlgqkisiivhgknsfppapspaaapveplltplfapssspepstdgwnvpdsplpap
ywvgdsvwsippttnFYNDWSSSHLFRIGDSIVFDFETELYNLMQVTALDYQTCKANNPIKVLNSGPATIVLNEQGVFYYLCNLSNYCDLGQKISIIVHGKNSFPPAPSPAAAPVEPLLTPLFAPSSspepstdgwnvpdsplpap
YWVGDSVWSIPPTTNFYNDWSSSHLFRIGDSIVFDFETELYNLMQVTALDYQTCKANNPIKVLNSGPATIVLNEQGVFYYLCNLSNYCDLGQKISIIVHGKNSFppapspaaapVEPLLTPLFAPSSSPEPSTDGWNVPDSPLPAP
*WVGDSVWSIPPTTNFYNDWSSSHLFRIGDSIVFDFETELYNLMQVTALDYQTCKANNPIKVLNSGPATIVLNEQGVFYYLCNLSNYCDLGQKISIIVHG**********************************************
YWVGDSVWSIPPTTNFYNDWSSSHLFRIGDSIVFDFETELYNLMQVTALDYQTCKANNPIKVLNSGPATIVLNEQGVFYYLCNLSNYCDLGQKISI**************************************************
YWVGDSVWSIPPTTNFYNDWSSSHLFRIGDSIVFDFETELYNLMQVTALDYQTCKANNPIKVLNSGPATIVLNEQGVFYYLCNLSNYCDLGQKISIIVHGKNSFPPAPSPAAAPVEPLLTPLFA**********************
****DSVWSIPPTTNFYNDWSSSHLFRIGDSIVFDFETELYNLMQVTALDYQTCKANNPIKVLNSGPATIVLNEQGVFYYLCNLSNYCDLGQKISIIVHGK*********************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YWVGDSVWSIPPTTNFYNDWSSSHLFRIGDSIVFDFETELYNLMQVTALDYQTCKANNPIKVLNSGPATIVLNEQGVFYYLCNLSNYCDLGQKISIIVHGKNSFPPAPSPAAAPVEPLLTPLFAPSSSPEPSTDGWNVPDSPLPAP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query146 2.2.26 [Sep-21-2011]
P42849115 Umecyanin OS=Armoracia ru N/A no 0.650 0.826 0.378 1e-15
Q07488196 Blue copper protein OS=Ar yes no 0.828 0.617 0.327 3e-15
Q9SK27182 Early nodulin-like protei no no 0.780 0.626 0.316 1e-14
P00302107 Stellacyanin OS=Toxicoden N/A no 0.643 0.878 0.390 7e-14
P80728108 Mavicyanin OS=Cucurbita p N/A no 0.657 0.888 0.354 1e-13
P93328180 Early nodulin-16 OS=Medic N/A no 0.712 0.577 0.289 1e-12
P29602137 Cucumber peeling cupredox N/A no 0.705 0.751 0.339 4e-12
Q5JNJ5237 Early nodulin-like protei no no 0.780 0.481 0.325 2e-11
Q9T076 349 Early nodulin-like protei no no 0.643 0.269 0.305 3e-11
Q41001189 Blue copper protein OS=Pi N/A no 0.650 0.502 0.343 1e-09
>sp|P42849|UMEC_ARMRU Umecyanin OS=Armoracia rusticana PE=1 SV=1 Back     alignment and function desciption
 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 54/95 (56%)

Query: 4   GDSVWSIPPTTNFYNDWSSSHLFRIGDSIVFDFETELYNLMQVTALDYQTCKANNPIKVL 63
           GD  W  P    FY  W++   FR+GD + FDF   ++++  VT   +  CK  NPI  +
Sbjct: 7   GDMEWKRPSDPKFYITWATGKTFRVGDELEFDFAAGMHDVAVVTKDAFDNCKKENPISHM 66

Query: 64  NSGPATIVLNEQGVFYYLCNLSNYCDLGQKISIIV 98
            + P  I+LN  G  YY+C + ++C +GQK+SI V
Sbjct: 67  TTPPVKIMLNTTGPQYYICTVGDHCRVGQKLSINV 101
Not yet known.
Armoracia rusticana (taxid: 3704)
>sp|Q07488|BCB1_ARATH Blue copper protein OS=Arabidopsis thaliana GN=BCB PE=1 SV=2 Back     alignment and function description
>sp|Q9SK27|ENL1_ARATH Early nodulin-like protein 1 OS=Arabidopsis thaliana GN=At2g25060 PE=1 SV=2 Back     alignment and function description
>sp|P00302|STEL_TOXVR Stellacyanin OS=Toxicodendron vernicifluum PE=1 SV=1 Back     alignment and function description
>sp|P80728|MAVI_CUCPE Mavicyanin OS=Cucurbita pepo PE=1 SV=1 Back     alignment and function description
>sp|P93328|NO16_MEDTR Early nodulin-16 OS=Medicago truncatula GN=ENOD16 PE=3 SV=1 Back     alignment and function description
>sp|P29602|CPC_CUCSA Cucumber peeling cupredoxin OS=Cucumis sativus PE=1 SV=3 Back     alignment and function description
>sp|Q5JNJ5|ENL1_ORYSJ Early nodulin-like protein 1 OS=Oryza sativa subsp. japonica GN=ENODL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9T076|ENL2_ARATH Early nodulin-like protein 2 OS=Arabidopsis thaliana GN=At4g27520 PE=1 SV=1 Back     alignment and function description
>sp|Q41001|BCP_PEA Blue copper protein OS=Pisum sativum PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
255546749216 Cucumber peeling cupredoxin, putative [R 0.678 0.458 0.646 2e-33
224110102214 predicted protein [Populus trichocarpa] 0.678 0.462 0.575 1e-28
357442785220 Blue copper protein [Medicago truncatula 0.972 0.645 0.431 1e-25
351726403216 uncharacterized protein LOC100527593 pre 0.883 0.597 0.378 5e-19
319433445200 copper binding protein 5 [Gossypium hirs 0.787 0.575 0.380 9e-19
350535054 332 dicyanin precursor [Solanum lycopersicum 0.815 0.358 0.380 1e-18
116785717202 unknown [Picea sitchensis] 0.650 0.470 0.410 4e-18
449443069221 PREDICTED: blue copper protein-like [Cuc 0.678 0.447 0.38 1e-17
115454359142 Os03g0648500 [Oryza sativa Japonica Grou 0.643 0.661 0.404 3e-17
449509321161 PREDICTED: cucumber peeling cupredoxin-l 0.897 0.813 0.342 5e-17
>gi|255546749|ref|XP_002514433.1| Cucumber peeling cupredoxin, putative [Ricinus communis] gi|223546429|gb|EEF47929.1| Cucumber peeling cupredoxin, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 64/99 (64%), Positives = 83/99 (83%)

Query: 1   YWVGDSVWSIPPTTNFYNDWSSSHLFRIGDSIVFDFETELYNLMQVTALDYQTCKANNPI 60
           Y VGD+VWSIP + NFY++WSSS +F +GDS+VFDFE+EL N++QV   DY+ C  +NP 
Sbjct: 28  YTVGDAVWSIPISANFYSNWSSSIVFYLGDSLVFDFESELSNVIQVPKQDYENCITHNPS 87

Query: 61  KVLNSGPATIVLNEQGVFYYLCNLSNYCDLGQKISIIVH 99
           K+L  GPA IVLNE+GVFYY+CN+SNYCDLGQK++I+VH
Sbjct: 88  KILTVGPAIIVLNEEGVFYYICNISNYCDLGQKLTIVVH 126

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224110102|ref|XP_002315416.1| predicted protein [Populus trichocarpa] gi|222864456|gb|EEF01587.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357442785|ref|XP_003591670.1| Blue copper protein [Medicago truncatula] gi|358346053|ref|XP_003637087.1| Blue copper protein [Medicago truncatula] gi|355480718|gb|AES61921.1| Blue copper protein [Medicago truncatula] gi|355503022|gb|AES84225.1| Blue copper protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|351726403|ref|NP_001238405.1| uncharacterized protein LOC100527593 precursor [Glycine max] gi|255632707|gb|ACU16705.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|319433445|gb|ADV57640.1| copper binding protein 5 [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|350535054|ref|NP_001234429.1| dicyanin precursor [Solanum lycopersicum] gi|7670832|gb|AAF66242.1|AF243180_1 dicyanin [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|116785717|gb|ABK23833.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|449443069|ref|XP_004139303.1| PREDICTED: blue copper protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|115454359|ref|NP_001050780.1| Os03g0648500 [Oryza sativa Japonica Group] gi|53370702|gb|AAU89197.1| phytocyanin -related [Oryza sativa Japonica Group] gi|108710107|gb|ABF97902.1| Plastocyanin-like domain containing protein, expressed [Oryza sativa Japonica Group] gi|113549251|dbj|BAF12694.1| Os03g0648500 [Oryza sativa Japonica Group] gi|125548849|gb|EAY94671.1| hypothetical protein OsI_16450 [Oryza sativa Indica Group] gi|125587288|gb|EAZ27952.1| hypothetical protein OsJ_11912 [Oryza sativa Japonica Group] gi|215765924|dbj|BAG98152.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|449509321|ref|XP_004163554.1| PREDICTED: cucumber peeling cupredoxin-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
TAIR|locus:2118691190 ENODL12 "early nodulin-like pr 0.890 0.684 0.283 2.6e-15
TAIR|locus:2154679 370 ENODL1 "early nodulin-like pro 0.876 0.345 0.277 3.2e-15
TAIR|locus:2149249196 BCB "blue-copper-binding prote 0.938 0.698 0.285 3.3e-15
TAIR|locus:2040164182 ENODL14 "early nodulin-like pr 0.636 0.510 0.322 2.3e-14
TAIR|locus:2052866200 AT2G31050 [Arabidopsis thalian 0.643 0.47 0.340 3.8e-14
TAIR|locus:2151069187 AT5G26330 [Arabidopsis thalian 0.890 0.695 0.306 3.8e-14
TAIR|locus:2137672 349 ENODL2 "early nodulin-like pro 0.643 0.269 0.305 8e-14
TAIR|locus:2061406226 ENODL11 "early nodulin-like pr 0.815 0.526 0.237 1.4e-13
TAIR|locus:2085775203 ENODL9 "early nodulin-like pro 0.945 0.679 0.251 3.4e-13
TAIR|locus:2086899188 ENODL5 "early nodulin-like pro 0.636 0.494 0.275 4.2e-13
TAIR|locus:2118691 ENODL12 "early nodulin-like protein 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 193 (73.0 bits), Expect = 2.6e-15, P = 2.6e-15
 Identities = 38/134 (28%), Positives = 72/134 (53%)

Query:     3 VGDSV--WSIPPT-TNFYNDWSSSHLFRIGDSIVFDFETELYNLMQVTALDYQTCKANNP 59
             VG SV  W +P +  N  N W+ ++ F++GD IV+ ++ ++ +++QVT  DY++C   NP
Sbjct:    30 VGGSVGSWKVPDSPNNTLNHWAENNRFKVGDFIVWKYDMKVDSVLQVTKEDYESCNTANP 89

Query:    60 IKVLNSGPATIVLNEQGVFYYLCNLSNYCDLGQKISIIVHG-KNSFXXXXXXXXXXVEPL 118
             +K  N G   + L++ G ++++      C  G+KI+++V   + S           V P+
Sbjct:    90 LKQYNDGNTKVALDKSGPYFFISGAPGNCAKGEKITLVVLAERKSGGGSSSGDAPKVSPV 149

Query:   119 LTPLFAPSSSPEPS 132
                   P+ +P P+
Sbjct:   150 SPTAQTPAPAPGPA 163
GO:0005507 "copper ion binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
GO:0031225 "anchored to membrane" evidence=TAS
TAIR|locus:2154679 ENODL1 "early nodulin-like protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149249 BCB "blue-copper-binding protein" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040164 ENODL14 "early nodulin-like protein 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2052866 AT2G31050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151069 AT5G26330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137672 ENODL2 "early nodulin-like protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061406 ENODL11 "early nodulin-like protein 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085775 ENODL9 "early nodulin-like protein 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086899 ENODL5 "early nodulin-like protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
pfam0229884 pfam02298, Cu_bind_like, Plastocyanin-like domain 3e-23
PLN03148167 PLN03148, PLN03148, Blue copper-like protein; Prov 1e-10
>gnl|CDD|216965 pfam02298, Cu_bind_like, Plastocyanin-like domain Back     alignment and domain information 
 Score = 86.6 bits (215), Expect = 3e-23
 Identities = 28/85 (32%), Positives = 50/85 (58%), Gaps = 1/85 (1%)

Query: 8  WSIPPTTNFYNDWSSSHLFRIGDSIVFDFETELYNLMQVTALDYQTCKANNPIKVLNSGP 67
          W+  P    Y  W+S   FR+GD++VF+++   +N+++VT  DY++C  + PI+   +G 
Sbjct: 1  WT-VPLNADYTLWASGKTFRVGDTLVFNYDKGFHNVVEVTKADYESCNTSKPIRTYTTGN 59

Query: 68 ATIVLNEQGVFYYLCNLSNYCDLGQ 92
            I L + G  Y++C +  +C  GQ
Sbjct: 60 DIIPLTKPGQHYFICGVPGHCKGGQ 84

This family represents a domain found in flowering plants related to the copper binding protein plastocyanin. Some members of this family may not bind copper due to the lack of key residues. Length = 84
>gnl|CDD|178693 PLN03148, PLN03148, Blue copper-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 146
PLN03148167 Blue copper-like protein; Provisional 100.0
PF0229885 Cu_bind_like: Plastocyanin-like domain; InterPro: 99.98
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 98.52
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 98.27
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 98.12
COG3794128 PetE Plastocyanin [Energy production and conversio 98.12
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 98.09
PRK02710119 plastocyanin; Provisional 97.8
TIGR0265783 amicyanin amicyanin. Members of this family are am 97.24
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 97.15
PF00812145 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a 96.59
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 96.41
KOG3858233 consensus Ephrin, ligand for Eph receptor tyrosine 95.99
COG4454158 Uncharacterized copper-binding protein [Inorganic 95.03
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 94.26
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 93.35
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 92.2
PRK02888635 nitrous-oxide reductase; Validated 90.08
PF00116120 COX2: Cytochrome C oxidase subunit II, periplasmic 88.42
TIGR02376 311 Cu_nitrite_red nitrite reductase, copper-containin 87.16
PF07732117 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01 82.43
MTH00047194 COX2 cytochrome c oxidase subunit II; Provisional 80.88
>PLN03148 Blue copper-like protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.4e-38  Score=243.16  Aligned_cols=96  Identities=29%  Similarity=0.625  Sum_probs=92.0

Q ss_pred             CeecCCC-CCCCCCCCChhhccCCCceeeCCEEEEEecCCCceEEEEccccCCcccCCCCccccCCCCcEEEecccceEE
Q 041703            1 YWVGDSV-WSIPPTTNFYNDWSSSHLFRIGDSIVFDFETELYNLMQVTALDYQTCKANNPIKVLNSGPATIVLNEQGVFY   79 (146)
Q Consensus         1 y~VGg~~-W~~~~~~~~Y~~Wa~~~~f~vGD~L~F~y~~~~HsV~~V~~~~y~~C~~s~~~~~~~~G~~~v~l~~~G~~Y   79 (146)
                      |+|||+. |+.   +.+|++|+++++|++||+|+|+|+.+.|+|+||++++|++|+.++++..+++|+++|+|+++|+||
T Consensus        23 ~~VGd~~GW~~---~~~Y~~WA~~k~F~VGD~LvF~Y~~~~hnV~~V~~~~Y~~C~~~~pi~~~tsG~d~v~L~~~G~~Y   99 (167)
T PLN03148         23 HIVGANKGWNP---GINYTLWANNQTFYVGDLISFRYQKTQYNVFEVNQTGYDNCTTEGAAGNWTSGKDFIPLNKAKRYY   99 (167)
T ss_pred             EEeCCCCCcCC---CCChhHhhcCCCCccCCEEEEEecCCCceEEEEChHHcCcccCCCCcceecCCCcEEEecCCccEE
Confidence            7899999 996   678999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEcCCCCCCCCCCeEEEEeeC
Q 041703           80 YLCNLSNYCDLGQKISIIVHG  100 (146)
Q Consensus        80 FiC~~~~HC~~GmKl~I~V~~  100 (146)
                      |||+ .+||++||||+|+|..
T Consensus       100 FIcg-~ghC~~GmKl~I~V~~  119 (167)
T PLN03148        100 FICG-NGQCFNGMKVTILVHP  119 (167)
T ss_pred             EEcC-CCccccCCEEEEEEcC
Confidence            9999 5899999999999964

>PF02298 Cu_bind_like: Plastocyanin-like domain; InterPro: IPR003245 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>PF00812 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a family of proteins [] that are ligands of class V (EPH-related) receptor protein-tyrosine kinases (see IPR001426 from INTERPRO) Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>KOG3858 consensus Ephrin, ligand for Eph receptor tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF00116 COX2: Cytochrome C oxidase subunit II, periplasmic domain This family corresponds to chains b and o Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>MTH00047 COX2 cytochrome c oxidase subunit II; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
1x9r_A116 Umecyanin From Horse Raddish- Crystal Structure Of 7e-17
1ws7_A109 Crystal Structure Of Mavicyanin From Cucurbita Pepo 8e-15
1jer_A138 Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 3e-13
2cbp_A96 Cucumber Basic Protein, A Blue Copper Protein Lengt 5e-07
1f56_A91 Spinach Plantacyanin Length = 91 4e-06
>pdb|1X9R|A Chain A, Umecyanin From Horse Raddish- Crystal Structure Of The Oxidised Form Length = 116 Back     alignment and structure 
Iteration: 1

 Score = 82.8 bits (203), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 54/95 (56%)
Query: 4   GDSVWSIPPTTNFYNDWSSSHLFRIGDSIVFDFETELYNLMQVTALDYQTCKANNPIKVL 63
           GD  W  P    FY  W++   FR+GD + FDF   ++++  VT   +  CK  NPI  +
Sbjct: 8   GDMEWKRPSDPKFYITWATGKTFRVGDELEFDFAAGMHDVAVVTKDAFDNCKKENPISHM 67
Query: 64  NSGPATIVLNEQGVFYYLCNLSNYCDLGQKISIIV 98
            + P  I+LN  G  YY+C + ++C +GQK+SI V
Sbjct: 68  TTPPVKIMLNTTGPQYYICTVGDHCRVGQKLSINV 102
>pdb|1WS7|A Chain A, Crystal Structure Of Mavicyanin From Cucurbita Pepo Medullosa (Zucchini) Length = 109 Back     alignment and structure
>pdb|1JER|A Chain A, Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 Back     alignment and structure
>pdb|2CBP|A Chain A, Cucumber Basic Protein, A Blue Copper Protein Length = 96 Back     alignment and structure
>pdb|1F56|A Chain A, Spinach Plantacyanin Length = 91 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 3e-35
1jer_A138 Cucumber stellacyanin; electron transport, copper, 4e-31
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 1e-30
2cbp_A96 Cucumber basic protein; electron transport, phytoc 2e-27
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 1e-26
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Length = 116 Back     alignment and structure
 Score =  117 bits (294), Expect = 3e-35
 Identities = 40/113 (35%), Positives = 60/113 (53%), Gaps = 1/113 (0%)

Query: 1   YWVGDSV-WSIPPTTNFYNDWSSSHLFRIGDSIVFDFETELYNLMQVTALDYQTCKANNP 59
           Y VG  + W  P    FY  W++   FR+GD + FDF   ++++  VT   +  CK  NP
Sbjct: 4   YDVGGDMEWKRPSDPKFYITWATGKTFRVGDELEFDFAAGMHDVAVVTKDAFDNCKKENP 63

Query: 60  IKVLNSGPATIVLNEQGVFYYLCNLSNYCDLGQKISIIVHGKNSFPPAPSPAA 112
           I  + + P  I+LN  G  YY+C + ++C +GQK+SI V G        +P A
Sbjct: 64  ISHMTTPPVKIMLNTTGPQYYICTVGDHCRVGQKLSINVVGAGGAGGGATPGA 116
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Length = 138 Back     alignment and structure
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Length = 109 Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Length = 96 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Length = 91 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
1jer_A138 Cucumber stellacyanin; electron transport, copper, 100.0
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 100.0
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 100.0
2cbp_A96 Cucumber basic protein; electron transport, phytoc 100.0
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 100.0
2cal_A154 Rusticyanin; iron respiratory electron transport c 99.15
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 99.13
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 99.06
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 98.85
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 98.81
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 98.8
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 98.8
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 98.77
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 98.76
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 98.75
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 98.71
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 98.7
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 98.69
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 98.64
1byp_A99 Protein (plastocyanin); electron transfer, photosy 98.64
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 98.63
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 98.48
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 98.24
1iko_P178 Ephrin-B2; greek KEY, glycosylation, signaling pro 97.97
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 97.93
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 97.87
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 97.84
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 97.76
3c75_A132 Amicyanin; copper proteins, electron transfer comp 97.68
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 97.65
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 97.63
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 97.25
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 97.24
2vsm_B140 Ephrin-B2; developmental protein, henipavirus, neu 97.22
3d12_B141 Ephrin-B3; beta propeller, protein-receptor comple 97.17
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 97.15
1shx_A138 Ephrin-A5; ephrin signaling, hormone-growth factor 97.11
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 97.09
3czu_B182 Ephrin-A1; ATP-binding, kinase, nucleotide-binding 97.09
2x11_B177 Ephrin-A5; receptor-signaling protein complex, dev 97.0
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 96.87
2wo3_B157 Ephrin-A2; transferase-signaling protein complex, 96.16
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 95.31
3hei_B132 Ephrin-A1; EPH receptor tyrosine kinase, cell memb 94.57
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 94.51
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 94.24
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 94.2
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 94.11
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
Probab=100.00  E-value=8.3e-43  Score=260.91  Aligned_cols=103  Identities=33%  Similarity=0.704  Sum_probs=97.1

Q ss_pred             CeecCCC-CCCCCCCCChhhccCCCceeeCCEEEEEecCCCceEEEE-ccccCCcccCCCCccccCCCCcEEEe-cccce
Q 041703            1 YWVGDSV-WSIPPTTNFYNDWSSSHLFRIGDSIVFDFETELYNLMQV-TALDYQTCKANNPIKVLNSGPATIVL-NEQGV   77 (146)
Q Consensus         1 y~VGg~~-W~~~~~~~~Y~~Wa~~~~f~vGD~L~F~y~~~~HsV~~V-~~~~y~~C~~s~~~~~~~~G~~~v~l-~~~G~   77 (146)
                      |+|||+. |+++++..+|++||++++|+|||+|+|+|..+.|+|+|| ++++|+.|+.++++..+++|+++|+| +++|+
T Consensus         6 ~~VGg~~GW~~~~~~~~Y~~Wa~~~~F~vGD~LvF~y~~~~HsV~~V~~~~~y~~C~~s~p~~~~~~G~~~v~L~~~~G~   85 (138)
T 1jer_A            6 HIVGDNTGWSVPSSPNFYSQWAAGKTFRVGDSLQFNFPANAHNVHEMETKQSFDACNFVNSDNDVERTSPVIERLDELGM   85 (138)
T ss_dssp             EETTGGGCSSCCSSTTHHHHHHHTCCEETTCEEEECCCTTTCCCEEESCHHHHHHTCCTTSCCCCCCCSCEEEECCSSEE
T ss_pred             EEECCcCcCcCCCCccchhhhhcCCcCcCCCEEEEeecCCCceEEEeCchhhcCccCCCCccccccCCCeEEEeccCCcC
Confidence            7899999 999654478999999999999999999999999999999 99999999999999999999999999 99999


Q ss_pred             EEEEcCCCCCCCCCCeEEEEeeCCCC
Q 041703           78 FYYLCNLSNYCDLGQKISIIVHGKNS  103 (146)
Q Consensus        78 ~YFiC~~~~HC~~GmKl~I~V~~~~~  103 (146)
                      +||||++++||++||||+|+|....+
T Consensus        86 ~YFicg~~gHC~~GmKl~I~V~~~~~  111 (138)
T 1jer_A           86 HYFVCTVGTHCSNGQKLSINVVAANA  111 (138)
T ss_dssp             EEEECCSTTTGGGTCEEEEEEECCC-
T ss_pred             EEEEcCCCCccccCCEEEEEEcCCCC
Confidence            99999999999999999999998774
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Back     alignment and structure
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>1iko_P Ephrin-B2; greek KEY, glycosylation, signaling protein; HET: NAG MAN; 1.92A {Mus musculus} SCOP: b.6.1.5 Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>2vsm_B Ephrin-B2; developmental protein, henipavirus, neurogenesis, glycoprotein, paramyxovirus, envelope protein, cell surface receptor, hendra, virion; HET: NAG; 1.80A {Homo sapiens} PDB: 2wo2_B* 2i85_A 3gxu_B 2vsk_B 2hle_B 1kgy_E Back     alignment and structure
>3d12_B Ephrin-B3; beta propeller, protein-receptor complex, envelope protein, glycoprotein, hemagglutinin, hydrolase, membrane, signal-AN transmembrane; HET: NAG BMA MAN BGC LXZ NGA GL0 GLC LXB NGZ GXL; 3.00A {Mus musculus} Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>1shx_A Ephrin-A5; ephrin signaling, hormone-growth factor complex; HET: NAG; 2.10A {Mus musculus} SCOP: b.6.1.5 PDB: 1shw_A* 3mx0_B* Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>3czu_B Ephrin-A1; ATP-binding, kinase, nucleotide-binding, receptor, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG MAN; 2.65A {Homo sapiens} PDB: 3mbw_B* Back     alignment and structure
>2x11_B Ephrin-A5; receptor-signaling protein complex, developmental protein, signaling platform, kinase, transferase, neurogenesis, receptor, cataract; 4.83A {Homo sapiens} Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>2wo3_B Ephrin-A2; transferase-signaling protein complex, EFN, EPHA4, KINA ephrin, complex, membrane, cell surface receptor, tyrosine- kinase, glycoprotein; HET: NAG; 2.35A {Homo sapiens} Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>3hei_B Ephrin-A1; EPH receptor tyrosine kinase, cell membrane, disulfi glycoprotein, GPI-anchor, lipoprotein, membrane, ATP-bindin kinase; 2.00A {Homo sapiens} SCOP: b.6.1.0 Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 146
d2cbpa_96 b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativ 5e-28
d1ws8a_104 b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) 2e-27
d1jera_110 b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativ 9e-26
d1f56a_91 b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia olera 2e-24
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 96 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Plantacyanin
species: Cucumber (Cucumis sativus) [TaxId: 3659]

 Score = 97.2 bits (242), Expect = 5e-28
 Identities = 29/99 (29%), Positives = 45/99 (45%), Gaps = 7/99 (7%)

Query: 1  YWVGDSV-WSIPPTTNFYNDWSSSHLFRIGDSIVFDFETELYNLMQVTALDYQTCKANNP 59
          Y VG S  W+          W     FR GD ++F++   ++N++ V    + TC     
Sbjct: 3  YVVGGSGGWTFN-----TESWPKGKRFRAGDILLFNYNPSMHNVVVVNQGGFSTCNTPAG 57

Query: 60 IKVLNSGPATIVLNEQGVFYYLCNLSNYCDLGQKISIIV 98
           KV  SG   I L + G  Y++CN   +C  G KI++  
Sbjct: 58 AKVYTSGRDQIKLPK-GQSYFICNFPGHCQSGMKIAVNA 95
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Length = 104 Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 110 Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 91 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
d2cbpa_96 Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1ws8a_104 Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663 100.0
d1jera_110 Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1f56a_91 Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 100.0
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 98.88
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 98.85
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 98.83
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 98.77
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 98.76
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 98.75
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 98.74
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 98.74
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 98.71
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 98.69
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 98.68
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 98.62
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.52
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 98.45
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.43
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 98.3
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 97.94
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 97.35
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 97.3
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 97.22
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 97.1
d1shxa1138 Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} 96.92
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 96.53
d1ikop_141 Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 96.3
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 96.27
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 95.92
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 95.18
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 94.75
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 94.35
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 93.95
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 91.43
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 90.1
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 89.57
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 88.41
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 88.12
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 86.92
d1kcwa2146 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 85.19
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Plantacyanin
species: Cucumber (Cucumis sativus) [TaxId: 3659]

Probab=100.00  E-value=1.3e-38  Score=223.49  Aligned_cols=93  Identities=31%  Similarity=0.653  Sum_probs=89.2

Q ss_pred             CeecCCC-CCCCCCCCChhhccCCCceeeCCEEEEEecCCCceEEEEccccCCcccCCCCccccCCCCcEEEecccceEE
Q 041703            1 YWVGDSV-WSIPPTTNFYNDWSSSHLFRIGDSIVFDFETELYNLMQVTALDYQTCKANNPIKVLNSGPATIVLNEQGVFY   79 (146)
Q Consensus         1 y~VGg~~-W~~~~~~~~Y~~Wa~~~~f~vGD~L~F~y~~~~HsV~~V~~~~y~~C~~s~~~~~~~~G~~~v~l~~~G~~Y   79 (146)
                      |+|||+. |++     +|++||++++|++||+|+|+|+++.|+|++|++++|++|+.++++..+++|++.|+|++ |++|
T Consensus         3 y~VGg~~GW~~-----~y~~Wa~~~~F~vGD~LvF~y~~~~h~V~~V~~~~Y~~C~~~~~~~~~~~G~~~v~L~~-G~~Y   76 (96)
T d2cbpa_           3 YVVGGSGGWTF-----NTESWPKGKRFRAGDILLFNYNPSMHNVVVVNQGGFSTCNTPAGAKVYTSGRDQIKLPK-GQSY   76 (96)
T ss_dssp             EETTGGGCSCS-----SCTTTTTTCCBCTTCEEEEECCTTTCCEEEECHHHHHHTCCCTTCEEECSSEEEEECCS-EEEE
T ss_pred             EEcCCCCCCCc-----CHHHHhCCCcEecCCEEEEecCCCCceEEEEChHHcCccCCCCCcccccCCCeEEEeCC-CCCE
Confidence            7899999 987     59999999999999999999999999999999999999999999999999999999986 9999


Q ss_pred             EEcCCCCCCCCCCeEEEEee
Q 041703           80 YLCNLSNYCDLGQKISIIVH   99 (146)
Q Consensus        80 FiC~~~~HC~~GmKl~I~V~   99 (146)
                      |||++++||++||||+|+|+
T Consensus        77 Fic~~~~hC~~G~Kl~V~Vl   96 (96)
T d2cbpa_          77 FICNFPGHCQSGMKIAVNAL   96 (96)
T ss_dssp             EECCSTTTGGGTCEEEEEEC
T ss_pred             EEeCCCCcCcCCCEEEEEEC
Confidence            99999999999999999985
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1shxa1 b.6.1.5 (A:32-170) Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ikop_ b.6.1.5 (P:) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure