Citrus Sinensis ID: 041714

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----
MDGLEGPTSTTAIPAVDSNPPSPRLDPDFSPVGSPEHDIPDVPVPPSDDDHDHDHCEDPIKDHENSSTPAVLTDDLKQRIIKQVEYYFSDENLPTDKYMMNLIRKNKEGFVPISVIASFRKLKRLTRNHAWIVAALRESSLLVVSSNGKKVKRLNPLPVTEVRDPKLFTVLVENLPEDHSVENMQRIFAEAGKIKSICIRDPNVVEESKKKQQI
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHcccccccEEHHHHHccccHHcccccHHHHHHHHHccccEEEEccccEEEccccccccccccccccEEEEEcccccccHHHHHHHHHHcccccEEEEccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccEcHHHEEcHHHHHHHHHcHHHHHHHHHcccEEEEcccccEEEEcccccccccccccccEEEEEcccccccHHHHHHHHHccccEEEEEEEcccccccccccccc
mdglegptsttaipavdsnppsprldpdfspvgspehdipdvpvppsdddhdhdhcedpikdhensstpavltdDLKQRIIKQVEYyfsdenlptdkYMMNLIRKNKEGFVPISVIASFRKLKRLTRNHAWIVAALRESSLLVvssngkkvkrlnplpvtevrdpkLFTVLVEnlpedhsvENMQRIFAEAGKIKsicirdpnvveeskkkqqi
mdglegptsttaipavdsnppspRLDPDFSPVGSPEHDIPDVPVPPSDDDHDHDHCEdpikdhensstpavltdDLKQRIIKQVeyyfsdenlptDKYMMNLIRKNKEGFVPISVIASFRKLKRLTRNHAWIVAALressllvvssngkkvkrlnplpvtevrdpkLFTVLVEnlpedhsvENMQRIFAEAGkiksicirdpnvveeskkkqqi
MDGLEGPTSTTAIPAVDSNPPSPRLDPDFSPVGSPEhdipdvpvppsdddhdhdhCEDPIKDHENSSTPAVLTDDLKQRIIKQVEYYFSDENLPTDKYMMNLIRKNKEGFVPISVIASFRKLKRLTRNHAWIVAALRESSLLVVSSNGKKVKRLNPLPVTEVRDPKLFTVLVENLPEDHSVENMQRIFAEAGKIKSICIRDPNVVEESKKKQQI
***********************************************************************LTDDLKQRIIKQVEYYFSDENLPTDKYMMNLIRKNKEGFVPISVIASFRKLKRLTRNHAWIVAALRESSLLVVSSNGKKVKRLNPLPVTEVRDPKLFTVLVENLPEDHSVENMQRIFAEAGKIKSICIRD*************
*****************************************************************************QRIIKQVEYYFSDENLPTDKYMMNLIRKNKEGFVPISVIASFRKLKRLTRNHAWIVAALRESSLLVVSSNGKKVKRLNPLPVTEVRDPKLFTVLVENLPEDHSVENMQRIFAEAGKIKSIC****************
**********TAIPAVDSNPPSPRLDPDFSPVGSPEHDIPDVPVP********DHCEDPIKDHENSSTPAVLTDDLKQRIIKQVEYYFSDENLPTDKYMMNLIRKNKEGFVPISVIASFRKLKRLTRNHAWIVAALRESSLLVVSSNGKKVKRLNPLPVTEVRDPKLFTVLVENLPEDHSVENMQRIFAEAGKIKSICIRDPNV**********
**********************************************************************VLTDDLKQRIIKQVEYYFSDENLPTDKYMMNLIRKNKEGFVPISVIASFRKLKRLTRNHAWIVAALRESSLLVVSSNGKKVKRLNPLPVTEVRDPKLFTVLVENLPEDHSVENMQRIFAEAGKIKSICIRDPN***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGLEGPTSTTAIPAVDSNPPSPRLDPDFSPVGSPEHDIPDVPVPPSDDDHDHDHCEDPIKDHENSSTPAVLTDDLKQRIIKQVEYYFSDENLPTDKYMMNLIRKNKEGFVPISVIASFRKLKRLTRNHAWIVAALRESSLLVVSSNGKKVKRLNPLPVTEVRDPKLFTVLVENLPEDHSVENMQRIFAEAGKIKSICIRDPNVVEESKKKQQI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query214 2.2.26 [Sep-21-2011]
Q05CL8 570 La-related protein 7 OS=M yes no 0.556 0.208 0.358 3e-15
P33399275 La protein homolog OS=Sac yes no 0.588 0.458 0.372 3e-15
Q5XI01 571 La-related protein 7 OS=R yes no 0.556 0.208 0.35 6e-15
Q4R627 581 La-related protein 7 OS=M N/A no 0.556 0.204 0.35 1e-14
Q4G0J3 582 La-related protein 7 OS=H yes no 0.556 0.204 0.35 1e-14
Q7ZWE3 555 La-related protein 7 OS=D no no 0.668 0.257 0.305 2e-14
Q8BN59 492 La-related protein 6 OS=M no no 0.686 0.298 0.276 2e-14
Q9BRS8 491 La-related protein 6 OS=H no no 0.607 0.264 0.285 3e-14
Q28G87 593 La-related protein 7 OS=X no no 0.658 0.237 0.32 3e-14
P87058298 La protein homolog OS=Sch yes no 0.556 0.399 0.376 2e-12
>sp|Q05CL8|LARP7_MOUSE La-related protein 7 OS=Mus musculus GN=Larp7 PE=1 SV=2 Back     alignment and function desciption
 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/120 (35%), Positives = 74/120 (61%), Gaps = 1/120 (0%)

Query: 80  IIKQVEYYFSDENLPTDKYMMNLIRKNKEGFVPISVIASFRKLKRLTRNHAWIVAALRES 139
           I KQV+++F D NL  DK++   I K+++G+V IS++ SF K+K+LT +   I  AL+ S
Sbjct: 32  IAKQVDFWFGDANLHKDKFLREQIEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALKSS 91

Query: 140 SLLVVSSNGKKVKRLNPLPVTEVRDPKLFTVLVENLPEDHSVENMQRIFAEAGKIKSICI 199
           S++ +   G +++R  PL     +D +  TV VE LP++ +   ++R+F + G +  I I
Sbjct: 92  SVVELDLEGTRIRRKKPLG-ERPKDEEERTVYVELLPKNVTHSWIERVFGKCGNVVYISI 150
Negative transcriptional regulator of polymerase II genes, acting by means of the 7SK RNP system. Within the 7SK RNP complex, the positive transcription elongation factor b (P-TEFb) is sequestered in an inactive form, preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.
Mus musculus (taxid: 10090)
>sp|P33399|LHP1_YEAST La protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LHP1 PE=1 SV=2 Back     alignment and function description
>sp|Q5XI01|LARP7_RAT La-related protein 7 OS=Rattus norvegicus GN=Larp7 PE=1 SV=2 Back     alignment and function description
>sp|Q4R627|LARP7_MACFA La-related protein 7 OS=Macaca fascicularis GN=LARP7 PE=2 SV=1 Back     alignment and function description
>sp|Q4G0J3|LARP7_HUMAN La-related protein 7 OS=Homo sapiens GN=LARP7 PE=1 SV=1 Back     alignment and function description
>sp|Q7ZWE3|LARP7_DANRE La-related protein 7 OS=Danio rerio GN=larp7 PE=2 SV=1 Back     alignment and function description
>sp|Q8BN59|LARP6_MOUSE La-related protein 6 OS=Mus musculus GN=Larp6 PE=1 SV=1 Back     alignment and function description
>sp|Q9BRS8|LARP6_HUMAN La-related protein 6 OS=Homo sapiens GN=LARP6 PE=1 SV=1 Back     alignment and function description
>sp|Q28G87|LARP7_XENTR La-related protein 7 OS=Xenopus tropicalis GN=larp7 PE=2 SV=1 Back     alignment and function description
>sp|P87058|LAH1_SCHPO La protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sla1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
255583557270 lupus la ribonucleoprotein, putative [Ri 0.962 0.762 0.618 2e-65
449433581 388 PREDICTED: la protein homolog [Cucumis s 0.953 0.525 0.580 5e-61
359483861 342 PREDICTED: la-related protein 6-like [Vi 0.799 0.5 0.606 1e-55
145358920 340 RNA-binding protein [Arabidopsis thalian 0.957 0.602 0.526 5e-54
145334751 340 RNA-binding protein [Arabidopsis thalian 0.957 0.602 0.526 6e-54
30694922 422 RNA-binding protein [Arabidopsis thalian 0.957 0.485 0.526 8e-54
10177706 411 unnamed protein product [Arabidopsis tha 0.957 0.498 0.526 9e-54
297794633 432 predicted protein [Arabidopsis lyrata su 0.845 0.418 0.565 4e-52
359806823 405 uncharacterized protein LOC100807619 [Gl 0.696 0.367 0.668 5e-52
356549093 400 PREDICTED: uncharacterized protein LOC10 0.686 0.367 0.666 6e-52
>gi|255583557|ref|XP_002532535.1| lupus la ribonucleoprotein, putative [Ricinus communis] gi|223527747|gb|EEF29851.1| lupus la ribonucleoprotein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 136/220 (61%), Positives = 165/220 (75%), Gaps = 14/220 (6%)

Query: 1   MDGLEGPTSTTAIPAVDSNPPSPRLDPDFSPVGSPE---HDIPDVPVPPSDDDHDHDHCE 57
           M+G  GP + T +      P SP  D D +PVGSP+   HD  DV   PSD+DH HDH E
Sbjct: 1   MEGEVGPNADTFL-----GPSSPPHDSDVTPVGSPDDTLHD--DVHALPSDEDHGHDHEE 53

Query: 58  DPIKDHE----NSSTPAVLTDDLKQRIIKQVEYYFSDENLPTDKYMMNLIRKNKEGFVPI 113
           D   +H+        PA  T+ LK +I+KQVEYYFSDENLPTDK+M+ LI+KNKEGFVPI
Sbjct: 54  DADVEHDLDQDQHPGPADRTEVLKAKIVKQVEYYFSDENLPTDKHMIGLIKKNKEGFVPI 113

Query: 114 SVIASFRKLKRLTRNHAWIVAALRESSLLVVSSNGKKVKRLNPLPVTEVRDPKLFTVLVE 173
           ++ ASFRK+K+LTR+H+ IVAALRESS LVVSS+GKKVKRL+P PV  ++DPKL TVLVE
Sbjct: 114 TIFASFRKMKKLTRDHSVIVAALRESSFLVVSSDGKKVKRLHPFPVAAIKDPKLCTVLVE 173

Query: 174 NLPEDHSVENMQRIFAEAGKIKSICIRDPNVVEESKKKQQ 213
           NLPEDHSVEN++RIF EAGKIK I IRDP+ +EESKK  +
Sbjct: 174 NLPEDHSVENIRRIFGEAGKIKHISIRDPHAMEESKKGSK 213

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449433581|ref|XP_004134576.1| PREDICTED: la protein homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|359483861|ref|XP_002276730.2| PREDICTED: la-related protein 6-like [Vitis vinifera] gi|297740679|emb|CBI30861.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|145358920|ref|NP_568660.3| RNA-binding protein [Arabidopsis thaliana] gi|332007975|gb|AED95358.1| RNA-binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|145334751|ref|NP_001078721.1| RNA-binding protein [Arabidopsis thaliana] gi|332007976|gb|AED95359.1| RNA-binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30694922|ref|NP_851141.1| RNA-binding protein [Arabidopsis thaliana] gi|15215748|gb|AAK91419.1| AT5g46250/MPL12_3 [Arabidopsis thaliana] gi|23308375|gb|AAN18157.1| At5g46250/MPL12_3 [Arabidopsis thaliana] gi|332007974|gb|AED95357.1| RNA-binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|10177706|dbj|BAB11080.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297794633|ref|XP_002865201.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297311036|gb|EFH41460.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|359806823|ref|NP_001241310.1| uncharacterized protein LOC100807619 [Glycine max] gi|255636971|gb|ACU18818.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356549093|ref|XP_003542932.1| PREDICTED: uncharacterized protein LOC100788145 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
TAIR|locus:2170478 422 LARP6a "La related protein 6a" 0.710 0.360 0.651 5.2e-49
TAIR|locus:2089508 455 LARP6c "La related protein 6c" 0.714 0.336 0.431 6.4e-28
TAIR|locus:2051734 545 LARP6b "AT2G43970" [Arabidopsi 0.588 0.231 0.436 6.4e-26
DICTYBASE|DDB_G0281763 354 DDB_G0281763 "Lupus La protein 0.588 0.355 0.379 1.7e-19
UNIPROTKB|F1NJ86233 LARP7 "Uncharacterized protein 0.556 0.510 0.333 1.4e-17
SGD|S000002209275 LHP1 "RNA binding protein requ 0.658 0.512 0.352 4.1e-17
UNIPROTKB|F1NWE6 444 LARP6 "Uncharacterized protein 0.584 0.281 0.338 3.3e-16
UNIPROTKB|D6RFF0 299 LARP7 "La-related protein 7" [ 0.626 0.448 0.328 7.7e-16
UNIPROTKB|E1BVY8173 LOC420093 "Uncharacterized pro 0.387 0.479 0.481 1.6e-15
ZFIN|ZDB-GENE-030131-6896 555 larp7 "La ribonucleoprotein do 0.668 0.257 0.305 1.9e-15
TAIR|locus:2170478 LARP6a "La related protein 6a" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 511 (184.9 bits), Expect = 5.2e-49, P = 5.2e-49
 Identities = 103/158 (65%), Positives = 131/158 (82%)

Query:    57 EDPIKDH-ENS-STPAVLT--DDLKQRIIKQVEYYFSDENLPTDKYMMNLIRKNKEGFVP 112
             ED  +DH EN   T  V+   D+L Q+II+QVEYYFSDENLPTDK+++N +++NK+GFVP
Sbjct:    80 EDRDQDHGENPVETDGVVVPIDELNQKIIRQVEYYFSDENLPTDKFLLNAMKRNKKGFVP 139

Query:   113 ISVIASFRKLKRLTRNHAWIVAALRESSLLVVSSNGKKVKRLNPLPVTEVRDPKLFTVLV 172
             IS IA+F K+K+LTR+HA IV+AL+ESS LVVS++ KKVKRL+PLP  E+RDPK+FTVLV
Sbjct:   140 ISTIATFHKMKKLTRDHALIVSALKESSFLVVSADEKKVKRLSPLP--EIRDPKIFTVLV 197

Query:   173 ENLPEDHSVENMQRIFAEAGKIKSICIRDPNVVEESKK 210
             ENLPEDHS EN++ IF +AG IKS+ I DPN VEES+K
Sbjct:   198 ENLPEDHSNENIREIFGKAGSIKSVSICDPNAVEESEK 235
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006396 "RNA processing" evidence=IEA
GO:0006944 "cellular membrane fusion" evidence=RCA
GO:0048193 "Golgi vesicle transport" evidence=RCA
TAIR|locus:2089508 LARP6c "La related protein 6c" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051734 LARP6b "AT2G43970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0281763 DDB_G0281763 "Lupus La protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJ86 LARP7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
SGD|S000002209 LHP1 "RNA binding protein required for maturation of tRNA and U6 snRNA" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWE6 LARP6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|D6RFF0 LARP7 "La-related protein 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BVY8 LOC420093 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6896 larp7 "La ribonucleoprotein domain family, member 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
cd0803377 cd08033, LARP_6, La RNA-binding domain of La-relat 3e-39
smart0071580 smart00715, LA, Domain in the RNA-binding Lupus La 5e-34
cd0802976 cd08029, LA_like_fungal, La-motif domain of fungal 4e-29
cd0732375 cd07323, LAM, LA motif RNA-binding domain 7e-28
pfam0538359 pfam05383, La, La domain 2e-26
cd0802882 cd08028, LARP_3, La RNA-binding domain of La-relat 3e-21
cd0803090 cd08030, LA_like_plant, La-motif domain of plant p 6e-18
cd0803175 cd08031, LARP_4_5_like, La RNA-binding domain of p 4e-16
cd0803282 cd08032, LARP_7, La RNA-binding domain of La-relat 4e-15
cd0803473 cd08034, LARP_1_2, La RNA-binding domain proteins 9e-15
cd1228893 cd12288, RRM_La_like_plant, RNA recognition motif 2e-12
cd0803873 cd08038, LARP_2, La RNA-binding domain of La-relat 1e-11
cd0803773 cd08037, LARP_1, La RNA-binding domain of La-relat 4e-10
cd0803575 cd08035, LARP_4, La RNA-binding domain of La-relat 3e-08
COG5193 438 COG5193, LHP1, La protein, small RNA-binding pol I 1e-05
cd0803675 cd08036, LARP_5, La RNA-binding domain of La-relat 9e-05
COG5193438 COG5193, LHP1, La protein, small RNA-binding pol I 0.003
>gnl|CDD|153402 cd08033, LARP_6, La RNA-binding domain of La-related protein 6 Back     alignment and domain information 
 Score =  129 bits (327), Expect = 3e-39
 Identities = 47/77 (61%), Positives = 62/77 (80%)

Query: 77  KQRIIKQVEYYFSDENLPTDKYMMNLIRKNKEGFVPISVIASFRKLKRLTRNHAWIVAAL 136
            Q+I+KQVEYYFSDENL  D +++  +R+NKEG+VPI +IASF+K+K LTR+   + AAL
Sbjct: 1   IQKIVKQVEYYFSDENLLKDAFLLKHVRRNKEGYVPIKLIASFKKVKALTRDWRVVAAAL 60

Query: 137 RESSLLVVSSNGKKVKR 153
           R SS LVVS +GKKV+R
Sbjct: 61  RRSSKLVVSEDGKKVRR 77

This domain is found in animal and plant proteins related to the La autoantigen. A variety of La-related proteins (LARPs or La ribonucleoproteins), with differing domain architecture, appear to function as RNA-binding proteins in eukaryotic cellular processes. Length = 77
>gnl|CDD|128955 smart00715, LA, Domain in the RNA-binding Lupus La protein; unknown function Back     alignment and domain information
>gnl|CDD|153398 cd08029, LA_like_fungal, La-motif domain of fungal proteins similar to the La autoantigen Back     alignment and domain information
>gnl|CDD|153396 cd07323, LAM, LA motif RNA-binding domain Back     alignment and domain information
>gnl|CDD|203243 pfam05383, La, La domain Back     alignment and domain information
>gnl|CDD|153397 cd08028, LARP_3, La RNA-binding domain of La-related protein 3 Back     alignment and domain information
>gnl|CDD|153399 cd08030, LA_like_plant, La-motif domain of plant proteins similar to the La autoantigen Back     alignment and domain information
>gnl|CDD|153400 cd08031, LARP_4_5_like, La RNA-binding domain of proteins similar to La-related proteins 4 and 5 Back     alignment and domain information
>gnl|CDD|153401 cd08032, LARP_7, La RNA-binding domain of La-related protein 7 Back     alignment and domain information
>gnl|CDD|153403 cd08034, LARP_1_2, La RNA-binding domain proteins similar to La-related proteins 1 and 2 Back     alignment and domain information
>gnl|CDD|240734 cd12288, RRM_La_like_plant, RNA recognition motif in plant proteins related to the La autoantigen Back     alignment and domain information
>gnl|CDD|153407 cd08038, LARP_2, La RNA-binding domain of La-related protein 2 Back     alignment and domain information
>gnl|CDD|153406 cd08037, LARP_1, La RNA-binding domain of La-related protein 1 Back     alignment and domain information
>gnl|CDD|153404 cd08035, LARP_4, La RNA-binding domain of La-related protein 4 Back     alignment and domain information
>gnl|CDD|227520 COG5193, LHP1, La protein, small RNA-binding pol III transcript stabilizing protein and related La-motif-containing proteins involved in translation [Posttranslational modification, protein turnover, chaperones / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|153405 cd08036, LARP_5, La RNA-binding domain of La-related protein 5 Back     alignment and domain information
>gnl|CDD|227520 COG5193, LHP1, La protein, small RNA-binding pol III transcript stabilizing protein and related La-motif-containing proteins involved in translation [Posttranslational modification, protein turnover, chaperones / Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 214
KOG1855 484 consensus Predicted RNA-binding protein [General f 100.0
cd0803282 LARP_7 La RNA-binding domain of La-related protein 100.0
cd0803377 LARP_6 La RNA-binding domain of La-related protein 100.0
cd0803575 LARP_4 La RNA-binding domain of La-related protein 99.98
cd0803675 LARP_5 La RNA-binding domain of La-related protein 99.97
smart0071580 LA Domain in the RNA-binding Lupus La protein; unk 99.97
cd0802976 LA_like_fungal La-motif domain of fungal proteins 99.97
cd0802882 LARP_3 La RNA-binding domain of La-related protein 99.97
cd0803175 LARP_4_5_like La RNA-binding domain of proteins si 99.97
cd0803090 LA_like_plant La-motif domain of plant proteins si 99.97
cd0803773 LARP_1 La RNA-binding domain of La-related protein 99.96
cd0803873 LARP_2 La RNA-binding domain of La-related protein 99.96
cd0803473 LARP_1_2 La RNA-binding domain proteins similar to 99.96
cd0732375 LAM LA motif RNA-binding domain. This domain is fo 99.96
PF0538361 La: La domain; InterPro: IPR006630 Human Ro ribonu 99.93
KOG4213205 consensus RNA-binding protein La [RNA processing a 99.92
KOG2591 684 consensus c-Mpl binding protein, contains La domai 99.91
COG5193 438 LHP1 La protein, small RNA-binding pol III transcr 99.59
KOG2590448 consensus RNA-binding protein LARP/SRO9 and relate 98.99
COG5193438 LHP1 La protein, small RNA-binding pol III transcr 98.95
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 97.57
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 97.37
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 97.37
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 97.36
smart0036272 RRM_2 RNA recognition motif. 97.3
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 97.04
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 97.03
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 96.94
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 96.72
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 96.66
COG0724 306 RNA-binding proteins (RRM domain) [General functio 96.54
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 96.51
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 96.39
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 96.36
PF09421 989 FRQ: Frequency clock protein; InterPro: IPR018554 96.32
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 96.31
smart0036071 RRM RNA recognition motif. 96.28
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 96.18
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 96.17
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 96.15
KOG0113 335 consensus U1 small nuclear ribonucleoprotein (RRM 96.13
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 96.04
KOG0114124 consensus Predicted RNA-binding protein (RRM super 95.68
KOG0126 219 consensus Predicted RNA-binding protein (RRM super 95.38
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 95.38
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 95.38
KOG0145 360 consensus RNA-binding protein ELAV/HU (RRM superfa 95.13
KOG0122270 consensus Translation initiation factor 3, subunit 94.81
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 94.77
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 94.35
PF01885186 PTS_2-RNA: RNA 2'-phosphotransferase, Tpt1 / KptA 94.33
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 94.13
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 93.69
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 93.53
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 92.73
KOG0148 321 consensus Apoptosis-promoting RNA-binding protein 92.09
KOG0145 360 consensus RNA-binding protein ELAV/HU (RRM superfa 91.76
KOG0121153 consensus Nuclear cap-binding protein complex, sub 90.69
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 90.37
KOG1548 382 consensus Transcription elongation factor TAT-SF1 90.33
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 90.28
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 90.02
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 89.96
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 89.64
KOG2278207 consensus RNA:NAD 2'-phosphotransferase TPT1 [Tran 89.63
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 89.51
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 89.22
PRK00819179 RNA 2'-phosphotransferase; Reviewed 88.57
KOG0533 243 consensus RRM motif-containing protein [RNA proces 88.49
KOG4205 311 consensus RNA-binding protein musashi/mRNA cleavag 88.06
KOG0153 377 consensus Predicted RNA-binding protein (RRM super 87.7
KOG4660 549 consensus Protein Mei2, essential for commitment t 87.29
KOG0148 321 consensus Apoptosis-promoting RNA-binding protein 87.12
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 86.96
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 86.02
KOG0415 479 consensus Predicted peptidyl prolyl cis-trans isom 85.81
KOG4207 256 consensus Predicted splicing factor, SR protein su 85.65
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 83.94
KOG2590 448 consensus RNA-binding protein LARP/SRO9 and relate 83.12
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 82.42
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.6e-38  Score=293.30  Aligned_cols=136  Identities=49%  Similarity=0.808  Sum_probs=130.8

Q ss_pred             CCCCcHHHHHHHHhchhhhcCCCCCCcChHHHHhhhcCCCCceehHHHhchhhhhhhcCCHHHHHHHHhhCCceeeecCC
Q 041714           69 PAVLTDDLKQRIIKQVEYYFSDENLPTDKYMMNLIRKNKEGFVPISVIASFRKLKRLTRNHAWIVAALRESSLLVVSSNG  148 (214)
Q Consensus        69 ~~~~~~~l~~~I~kQvEyYFSd~NL~~D~fL~~~~~~~~eG~VpI~~i~sF~Rmk~lt~d~~~I~~ALk~S~~levsedg  148 (214)
                      .....+++..+|.+||||||||+||.+|.||+++|++|++|||||++|++|+|||+||.|+.+|+.||+.|..|+||+||
T Consensus       133 k~~lsedl~~kIv~QVEyyFSDenL~~d~fLlkhvrrnkeGyVpv~~vaSFKKvK~LTrd~~~va~ALr~S~kL~vseDg  212 (484)
T KOG1855|consen  133 KLILSEDLAAKIVDQVEYYFSDENLLKDAFLLKHVRRNKEGYVPVKLVASFKKVKALTRDWKLVADALRKSSKLEVSEDG  212 (484)
T ss_pred             cccccHHHHHHHHHHhheeeccccccchHHHHHHHhcCCCCceeeehhhhHHHHHHHhhhhHHHHHHHhhcceEEEccCC
Confidence            45677899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceEEecCCCCCCccCCCCcceEEeeCCCCCCCHHHHHHHHhhcCCeeEEEeeCCCc
Q 041714          149 KKVKRLNPLPVTEVRDPKLFTVLVENLPEDHSVENMQRIFAEAGKIKSICIRDPNV  204 (214)
Q Consensus       149 ~~VRR~~plp~~~~~~~~~rTVyv~~~P~d~t~e~L~~~F~~~G~V~~VRmrrp~~  204 (214)
                      +||||..|||+.+.++...|||++++||+|...|.|.+||+.+|.|++|||++|++
T Consensus       213 kKVrRisPlp~~~~eel~srtivaenLP~Dh~~enl~kiFg~~G~IksIRIckPga  268 (484)
T KOG1855|consen  213 KKVRRISPLPEFDEEELPSRTIVAENLPLDHSYENLSKIFGTVGSIKSIRICKPGA  268 (484)
T ss_pred             ceeeecCCCCCccccccccceEEEecCCcchHHHHHHHHhhcccceeeeeecCCCC
Confidence            99999999999877778899999999999999999999999999999999999954

>cd08032 LARP_7 La RNA-binding domain of La-related protein 7 Back     alignment and domain information
>cd08033 LARP_6 La RNA-binding domain of La-related protein 6 Back     alignment and domain information
>cd08035 LARP_4 La RNA-binding domain of La-related protein 4 Back     alignment and domain information
>cd08036 LARP_5 La RNA-binding domain of La-related protein 5 Back     alignment and domain information
>smart00715 LA Domain in the RNA-binding Lupus La protein; unknown function Back     alignment and domain information
>cd08029 LA_like_fungal La-motif domain of fungal proteins similar to the La autoantigen Back     alignment and domain information
>cd08028 LARP_3 La RNA-binding domain of La-related protein 3 Back     alignment and domain information
>cd08031 LARP_4_5_like La RNA-binding domain of proteins similar to La-related proteins 4 and 5 Back     alignment and domain information
>cd08030 LA_like_plant La-motif domain of plant proteins similar to the La autoantigen Back     alignment and domain information
>cd08037 LARP_1 La RNA-binding domain of La-related protein 1 Back     alignment and domain information
>cd08038 LARP_2 La RNA-binding domain of La-related protein 2 Back     alignment and domain information
>cd08034 LARP_1_2 La RNA-binding domain proteins similar to La-related proteins 1 and 2 Back     alignment and domain information
>cd07323 LAM LA motif RNA-binding domain Back     alignment and domain information
>PF05383 La: La domain; InterPro: IPR006630 Human Ro ribonucleoproteins (RNPs) are composed of one of the four small Y RNAs and at least two proteins, Ro60 and La Back     alignment and domain information
>KOG4213 consensus RNA-binding protein La [RNA processing and modification] Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>COG5193 LHP1 La protein, small RNA-binding pol III transcript stabilizing protein and related La-motif-containing proteins involved in translation [Posttranslational modification, protein turnover, chaperones / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2590 consensus RNA-binding protein LARP/SRO9 and related La domain proteins [Posttranslational modification, protein turnover, chaperones; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5193 LHP1 La protein, small RNA-binding pol III transcript stabilizing protein and related La-motif-containing proteins involved in translation [Posttranslational modification, protein turnover, chaperones / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>PF09421 FRQ: Frequency clock protein; InterPro: IPR018554 The frequency clock protein, is the central component of the frq-based circadian negative feedback loop, regulates various aspects of the circadian clock in Neurospora crassa [] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>PF01885 PTS_2-RNA: RNA 2'-phosphotransferase, Tpt1 / KptA family; InterPro: IPR002745 The final step of tRNA splicing in Saccharomyces cerevisiae (Baker's yeast) requires 2'-phosphotransferase (Tpt1) to transfer the 2'-phosphate from ligated tRNA to NAD, producing mature tRNA and ADP ribose-1' '-2' '-cyclic phosphate Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG2278 consensus RNA:NAD 2'-phosphotransferase TPT1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>PRK00819 RNA 2'-phosphotransferase; Reviewed Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG2590 consensus RNA-binding protein LARP/SRO9 and related La domain proteins [Posttranslational modification, protein turnover, chaperones; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
2vod_A193 Crystal Structure Of N-Terminal Domains Of Human La 2e-13
1zh5_A195 Structural Basis For Recognition Of Uuuoh 3'-Termin 2e-12
1yty_A194 Structural Basis For Recognition Of Uuuoh 3'-Termin 2e-12
1s29_A92 La Autoantigen N-Terminal Domain Length = 92 4e-12
1s7a_A103 Nmr Structure Of The La Motif Of Human La Protein L 4e-11
2cqk_A101 Solution Structure Of The La Domain Of C-Mpl Bindin 2e-09
>pdb|2VOD|A Chain A, Crystal Structure Of N-Terminal Domains Of Human La Protein Complexed With Rna Oligomer Auauuuu Length = 193 Back     alignment and structure 
Iteration: 1

 Score = 72.0 bits (175), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 77/132 (58%), Gaps = 8/132 (6%)
Query: 76  LKQRIIKQVEYYFSDENLPTDKYMMNLIRKNKEGFVPISVIASFRKLKRLTRNHAWIVAA 135
           L+ +I  Q+EYYF D NLP DK++   I+ + EG+VP+ ++  F +L RLT +   IV A
Sbjct: 12  LEAKICHQIEYYFGDFNLPRDKFLKEQIKLD-EGWVPLEIMIKFNRLNRLTTDFNVIVEA 70
Query: 136 LRES--SLLVVSSNGKKVKRLNPLPVTEVRDP-----KLFTVLVENLPEDHSVENMQRIF 188
           L +S   L+ +S +  K++R    P+ EV D      K  +V ++  P D ++++++   
Sbjct: 71  LSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWL 130
Query: 189 AEAGKIKSICIR 200
            + G++ +I +R
Sbjct: 131 EDKGQVLNIQMR 142
>pdb|1ZH5|A Chain A, Structural Basis For Recognition Of Uuuoh 3'-Terminii Of Nascent Rna Pol Iii Transcripts By La Autoantigen Length = 195 Back     alignment and structure
>pdb|1YTY|A Chain A, Structural Basis For Recognition Of Uuuoh 3'-Terminii Of Nascent Rna Pol Iii Transcripts By La Autoantigen Length = 194 Back     alignment and structure
>pdb|1S29|A Chain A, La Autoantigen N-Terminal Domain Length = 92 Back     alignment and structure
>pdb|1S7A|A Chain A, Nmr Structure Of The La Motif Of Human La Protein Length = 103 Back     alignment and structure
>pdb|2CQK|A Chain A, Solution Structure Of The La Domain Of C-Mpl Binding Protein Length = 101 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
1s29_A92 LA protein; winged helix-turn-helix, autoantigen, 7e-41
2cqk_A101 C-MPL binding protein; LA domain, structural genom 8e-32
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 3e-29
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
>1s29_A LA protein; winged helix-turn-helix, autoantigen, RNA-binding, RNA binding protein; 1.60A {Trypanosoma brucei} SCOP: a.4.5.46 Length = 92 Back     alignment and structure
 Score =  133 bits (337), Expect = 7e-41
 Identities = 33/91 (36%), Positives = 58/91 (63%)

Query: 68  TPAVLTDDLKQRIIKQVEYYFSDENLPTDKYMMNLIRKNKEGFVPISVIASFRKLKRLTR 127
           +   L+ + KQ++ KQVE+YFSD N+  D ++   + +N EGFV +  + +F+++  +T 
Sbjct: 2   SHMPLSSENKQKLQKQVEFYFSDVNVQRDIFLKGKMAENAEGFVSLETLLTFKRVNSVTT 61

Query: 128 NHAWIVAALRESSLLVVSSNGKKVKRLNPLP 158
           +   +V A+R S  LV+S +G  V+R +PLP
Sbjct: 62  DVKEVVEAIRPSEKLVLSEDGLMVRRRDPLP 92
>2cqk_A C-MPL binding protein; LA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.5.46 Length = 101 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 100.0
1s29_A92 LA protein; winged helix-turn-helix, autoantigen, 100.0
2cqk_A101 C-MPL binding protein; LA domain, structural genom 100.0
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 98.23
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 98.14
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 98.14
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 98.09
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 98.07
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 98.03
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 98.03
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 98.01
2cqd_A116 RNA-binding region containing protein 1; RNA recog 98.0
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 97.99
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 97.97
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 97.97
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 97.96
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 97.95
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 97.95
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 97.95
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 97.94
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 97.93
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 97.93
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 97.92
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 97.92
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 97.92
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 97.91
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 97.91
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 97.9
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 97.89
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 97.89
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 97.89
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 97.89
1x4e_A85 RNA binding motif, single-stranded interacting pro 97.89
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 97.88
2cph_A107 RNA binding motif protein 19; RNA recognition moti 97.88
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 97.88
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 97.88
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 97.87
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 97.87
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 97.87
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 97.87
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 97.87
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 97.86
2div_A99 TRNA selenocysteine associated protein; structural 97.86
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 97.85
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 97.85
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 97.85
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 97.84
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 97.83
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 97.83
2la6_A99 RNA-binding protein FUS; structural genomics, nort 97.83
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 97.82
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 97.82
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 97.82
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 97.81
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 97.81
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 97.81
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 97.81
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 97.81
3p5t_L90 Cleavage and polyadenylation specificity factor S; 97.79
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 97.79
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 97.79
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 97.78
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 97.78
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 97.78
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 97.78
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 97.78
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 97.77
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 97.76
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 97.75
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 97.74
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 97.73
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 97.73
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 97.73
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 97.71
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 97.7
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 97.7
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 97.7
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 97.69
1l3k_A 196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 97.69
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 97.69
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 97.69
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 97.69
1x5o_A114 RNA binding motif, single-stranded interacting pro 97.68
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 97.68
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 97.67
2dis_A109 Unnamed protein product; structural genomics, RRM 97.67
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 97.67
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 97.66
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 97.66
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 97.66
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 97.66
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 97.66
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 97.65
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 97.65
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 97.65
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 97.64
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 97.64
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 97.64
2krb_A81 Eukaryotic translation initiation factor 3 subunit 97.63
2kt5_A124 RNA and export factor-binding protein 2; chaperone 97.63
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 97.63
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 97.63
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 97.63
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 97.62
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 97.61
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 97.61
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 97.61
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 97.6
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 97.6
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 97.58
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 97.58
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 97.58
3n9u_C156 Cleavage and polyadenylation specificity factor S; 97.58
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 97.57
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 97.56
2dnl_A114 Cytoplasmic polyadenylation element binding protei 97.55
2cpj_A99 Non-POU domain-containing octamer-binding protein; 97.55
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 97.55
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 97.55
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 97.54
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 97.53
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 97.52
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 97.5
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 97.49
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 97.49
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 97.46
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 97.45
2i2y_A150 Fusion protein consists of immunoglobin G- binding 97.44
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 97.44
3q2s_C 229 Cleavage and polyadenylation specificity factor S; 97.43
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 97.43
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 97.41
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 97.39
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 97.37
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 97.36
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 97.35
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 97.35
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 97.32
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 97.3
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 97.3
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 97.3
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 97.28
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 97.28
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 96.38
2f3j_A177 RNA and export factor binding protein 2; RRM domai 97.25
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 97.25
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 97.24
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 97.2
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 97.2
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 97.17
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 97.15
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 97.13
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 97.13
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 97.08
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 97.08
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 97.07
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 97.06
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 96.98
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 96.98
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 96.97
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 96.97
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 96.95
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 96.93
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 96.91
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 96.84
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 96.8
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 96.8
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 96.79
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 96.78
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 96.74
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 96.68
1x5p_A97 Negative elongation factor E; structure genomics, 96.65
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 96.64
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 96.61
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 96.58
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 96.57
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 96.55
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 96.52
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 96.52
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 96.43
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 96.4
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 96.38
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 96.35
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 96.24
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 96.24
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 96.05
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 95.97
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 95.6
1fje_B 175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 95.02
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 94.98
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 94.14
2dit_A112 HIV TAT specific factor 1 variant; structural geno 93.82
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 93.44
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 92.07
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 90.42
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 87.0
1wfx_A186 Probable RNA 2'-phosphotransferase; tRNA splicing, 86.78
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 85.29
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
Probab=100.00  E-value=2.3e-36  Score=252.41  Aligned_cols=140  Identities=31%  Similarity=0.572  Sum_probs=121.1

Q ss_pred             CCCcHHHHHHHHhchhhhcCCCCCCcChHHHHhhhcCCCCceehHHHhchhhhhhhcCCHHHHHHHHhhC--CceeeecC
Q 041714           70 AVLTDDLKQRIIKQVEYYFSDENLPTDKYMMNLIRKNKEGFVPISVIASFRKLKRLTRNHAWIVAALRES--SLLVVSSN  147 (214)
Q Consensus        70 ~~~~~~l~~~I~kQvEyYFSd~NL~~D~fL~~~~~~~~eG~VpI~~i~sF~Rmk~lt~d~~~I~~ALk~S--~~levsed  147 (214)
                      ..+.++++.+|++||||||||+||++|+||+++|.++ +|||||++|++|+|||+|+.|.+.|++||+.|  ..|+++++
T Consensus         6 ~~~~~~~~~~i~~q~e~yfs~~nl~~D~fl~~~~~~~-~g~V~l~~i~sF~r~k~l~~d~~~I~~Al~~S~~~~lev~ed   84 (193)
T 2voo_A            6 NEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLD-EGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISED   84 (193)
T ss_dssp             ---CHHHHHHHHHHHHHHTSTTTGGGCHHHHHHHHHT-TTCEEHHHHTTSHHHHHHCCCHHHHHHHHHTCSSCCEEECTT
T ss_pred             cCCcHHHHHHHHHHhheecchhhcccCHHHHHHhccc-CCcEEeHHHhhhhHHHHhcCCHHHHHHHHhhcccceEEEecc
Confidence            3466899999999999999999999999999999766 99999999999999999999999999999999  89999999


Q ss_pred             CceEEecCCCCCCcc-----CCCCcceEEeeCCCCCCCHHHHHHHHhhcCCeeEEEeeCCCccccccccc
Q 041714          148 GKKVKRLNPLPVTEV-----RDPKLFTVLVENLPEDHSVENMQRIFAEAGKIKSICIRDPNVVEESKKKQ  212 (214)
Q Consensus       148 g~~VRR~~plp~~~~-----~~~~~rTVyv~~~P~d~t~e~L~~~F~~~G~V~~VRmrrp~~~~~~~Kgs  212 (214)
                      +.+|||....|.++.     .+...|+|||.+||.+++.++|+++|++||.|..|+|+++..  ..+||.
T Consensus        85 ~~~vrR~~~~p~p~~~~~~~~~~~~~~l~V~nLp~~~t~~~L~~~F~~~G~v~~v~i~~~~~--~~~kG~  152 (193)
T 2voo_A           85 KTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLH--KAFKGS  152 (193)
T ss_dssp             SSEEEECTTSCCCCCCHHHHHHHHHTEEEEECCCTTCCHHHHHHHHTTSCCEEEEEEEECTT--CCEEEE
T ss_pred             cceEEecccCCCcccchhhhhccccCEEEecCCCCcCCHHHHHHHHhcCCCEEEEEEEECCC--CCcccE
Confidence            999999843333222     223468999999999999999999999999999999998753  445663
>1s29_A LA protein; winged helix-turn-helix, autoantigen, RNA-binding, RNA binding protein; 1.60A {Trypanosoma brucei} SCOP: a.4.5.46 Back     alignment and structure
>2cqk_A C-MPL binding protein; LA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.5.46 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>1wfx_A Probable RNA 2'-phosphotransferase; tRNA splicing, NAD, structural GE riken structural genomics/proteomics initiative, RSGI; 2.80A {Aeropyrum pernix} SCOP: d.166.1.5 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 214
d1s29a_92 a.4.5.46 (A:) Lupus La autoantigen N-terminal doma 6e-39
d2cqka188 a.4.5.46 (A:43-130) La-related protein 4 LARP4 {Hu 5e-35
d1zh5a199 a.4.5.46 (A:5-103) Lupus La autoantigen N-terminal 1e-32
>d1s29a_ a.4.5.46 (A:) Lupus La autoantigen N-terminal domain {Trypanosoma brucei [TaxId: 5691]} Length = 92 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: La domain
domain: Lupus La autoantigen N-terminal domain
species: Trypanosoma brucei [TaxId: 5691]

 Score =  127 bits (320), Expect = 6e-39
 Identities = 35/93 (37%), Positives = 59/93 (63%), Gaps = 2/93 (2%)

Query: 66  SSTPAVLTDDLKQRIIKQVEYYFSDENLPTDKYMMNLIRKNKEGFVPISVIASFRKLKRL 125
           S  P  L+ + KQ++ KQVE+YFSD N+  D ++   + +N EGFV +  + +F+++  +
Sbjct: 2   SHMP--LSSENKQKLQKQVEFYFSDVNVQRDIFLKGKMAENAEGFVSLETLLTFKRVNSV 59

Query: 126 TRNHAWIVAALRESSLLVVSSNGKKVKRLNPLP 158
           T +   +V A+R S  LV+S +G  V+R +PLP
Sbjct: 60  TTDVKEVVEAIRPSEKLVLSEDGLMVRRRDPLP 92
>d2cqka1 a.4.5.46 (A:43-130) La-related protein 4 LARP4 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1zh5a1 a.4.5.46 (A:5-103) Lupus La autoantigen N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
d1s29a_92 Lupus La autoantigen N-terminal domain {Trypanosom 100.0
d2cqka188 La-related protein 4 LARP4 {Human (Homo sapiens) [ 99.97
d1zh5a199 Lupus La autoantigen N-terminal domain {Human (Hom 99.97
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 98.37
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 98.26
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 98.25
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.24
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.23
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.2
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 98.18
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 98.16
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 98.13
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 98.13
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.12
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.11
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 98.11
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 98.11
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 98.1
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.1
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.07
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.07
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 98.06
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 98.04
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.04
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 98.03
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.03
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 98.02
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 98.0
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 97.99
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 97.98
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 97.97
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 97.96
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 97.93
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 97.91
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.9
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 97.89
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.89
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 97.82
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 97.81
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 97.75
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 97.75
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 97.73
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.73
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 97.73
d2cpja186 Non-POU domain-containing octamer-binding protein, 97.72
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 97.69
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 97.68
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 97.66
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 97.65
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 97.63
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 97.63
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 97.63
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 97.63
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 97.62
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 97.59
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 97.57
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 97.57
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 97.53
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 97.52
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 97.52
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 97.5
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 97.48
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 97.47
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 97.46
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 97.44
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 97.42
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 97.35
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 97.34
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 97.25
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 97.21
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 97.21
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 97.16
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 97.12
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 97.1
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 96.99
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 96.85
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 96.84
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 96.77
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 96.77
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 96.77
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 96.73
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 96.65
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 96.6
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 96.52
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 96.13
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 94.46
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 93.55
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 92.66
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 91.26
d1wfxa_180 Probable RNA 2'-phosphotransferase KptA {Aeropyrum 89.83
>d1s29a_ a.4.5.46 (A:) Lupus La autoantigen N-terminal domain {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: La domain
domain: Lupus La autoantigen N-terminal domain
species: Trypanosoma brucei [TaxId: 5691]

Probab=100.00  E-value=8.6e-36  Score=224.10  Aligned_cols=87  Identities=38%  Similarity=0.677  Sum_probs=84.2

Q ss_pred             CcHHHHHHHHhchhhhcCCCCCCcChHHHHhhhcCCCCceehHHHhchhhhhhhcCCHHHHHHHHhhCCceeeecCCceE
Q 041714           72 LTDDLKQRIIKQVEYYFSDENLPTDKYMMNLIRKNKEGFVPISVIASFRKLKRLTRNHAWIVAALRESSLLVVSSNGKKV  151 (214)
Q Consensus        72 ~~~~l~~~I~kQvEyYFSd~NL~~D~fL~~~~~~~~eG~VpI~~i~sF~Rmk~lt~d~~~I~~ALk~S~~levsedg~~V  151 (214)
                      .+++..++|++||||||||+||++|+||+++|.++++|||||++|++|||||+|+.|.+.|++||+.|+.|||++||++|
T Consensus         6 ~~~e~~~~I~~QvEfYFSd~NL~~D~fL~~~m~~~~~G~V~i~~i~~F~rmk~lt~d~~~i~~Al~~S~~lev~ed~~~V   85 (92)
T d1s29a_           6 LSSENKQKLQKQVEFYFSDVNVQRDIFLKGKMAENAEGFVSLETLLTFKRVNSVTTDVKEVVEAIRPSEKLVLSEDGLMV   85 (92)
T ss_dssp             CCHHHHHHHHHHHHHHTSHHHHTTCHHHHHHHTTSTTCCEEHHHHTTSHHHHTTCSCHHHHHHHHTTCSSEEECTTSSEE
T ss_pred             CCHHHHHHHHHHHHHHccHhhhccCHHHHHHHhccCCCcEEhHHHhcCcCHHHhcCCHHHHHHHHhhCCeEEEeCCCCEE
Confidence            35778999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EecCCCC
Q 041714          152 KRLNPLP  158 (214)
Q Consensus       152 RR~~plp  158 (214)
                      ||+.|||
T Consensus        86 RRk~plP   92 (92)
T d1s29a_          86 RRRDPLP   92 (92)
T ss_dssp             EESSCCC
T ss_pred             eeCCCCC
Confidence            9999987
>d2cqka1 a.4.5.46 (A:43-130) La-related protein 4 LARP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a1 a.4.5.46 (A:5-103) Lupus La autoantigen N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfxa_ d.166.1.5 (A:) Probable RNA 2'-phosphotransferase KptA {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure