Citrus Sinensis ID: 041841

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MKPTPPHGTTKNTAISIEQCNEQRGLQSAQNLINLEDYYDDDDDLHVLNFLPNDTHFGKRKRPFSICMEPKSTNELFSIEFCSYSYCTDCIVKYVDSKLRESITSIRCPIVPKEVSDRWGNALCEGVINGAEKFYCPFKDCSALLINDGLKNMKESKRPYCKRMFCAQCKVPWHAGMRCEKFRKLNKNEKNSEDMELIKLAEEKKWKRCPHCNYSV
ccccccccccccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHccccccccccccccccccccccccccccEEEcccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHccccEEEccccccccEEEcccccccccEEcccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHccccccccccccc
cccccccccccccEEEEEcccHHHHHcccccEEEccccccccHHHHHHHHHHHHHccccccccccEccccccHHHcccccccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccccccEcccccccHEEEcccccccccccccccccEEEEEccccccccccHHHHHHcccccccccHHHHHHHHHccccccccccEEEc
mkptpphgttkntAISIEQCNEQRGLQSAQNLInledyydddddlhvlnflpndthfgkrkrpfsicmepkstnelfsiefcsysyCTDCIVKYVDSKLREsitsircpivpkevsdrwGNALCEGVINgaekfycpfkdcsALLINDGLknmkeskrpyckrmfcaqckvpwhagmrcekFRKLNKNEKNSEDMELIKLAEEkkwkrcphcnysv
mkptpphgttknTAISIEQCNEQRGLQSAQNLINLEDYYDDDDDLHVLNFLpndthfgkrkrpFSICMEPKSTNELFSIEFCSYSYCTDCIVKYVDSKLREsitsircpivpkevsdrWGNALCEGVINGAEKFYCPFKDCSALLINDGLKNMKESKRPYCKRMFCAQCKVPWHAGMRCEKFrklnkneknsedMELIKlaeekkwkrcphcnysv
MKPTPPHGTTKNTAISIEQCNEQRGLQSAQNLINLEdyydddddLHVLNFLPNDTHFGKRKRPFSICMEPKSTNELFSIEFCSYSYCTDCIVKYVDSKLRESITSIRCPIVPKEVSDRWGNALCEGVINGAEKFYCPFKDCSALLINDGLKNMKESKRPYCKRMFCAQCKVPWHAGMRCEKFRKLNKNEKNSEDMELIKLAEEKKWKRCPHCNYSV
****************************AQNLINLEDYYDDDDDLHVLNFLPNDTHFGKRKRPFSICMEPKSTNELFSIEFCSYSYCTDCIVKYVDSKLRESITSIRCPIVPKEVSDRWGNALCEGVINGAEKFYCPFKDCSALLINDGLKNMKESKRPYCKRMFCAQCKVPWHAGMRCEKFRK********************************
*********************************NLEDYYDDDD*********************SICMEPKSTNELFSIEFCSYSYCTDCIVKYVDSKLRESITSIRCPIVPKEVSDRWGNALCEGVINGAEKFYCPFKDCSALLINDGLKNMKESKRPYCKRMFCAQCKVPWHAGMRCEKFRK*************IKLAEEKKWKRCPHCNYSV
***********NTAISIEQCNEQRGLQSAQNLINLEDYYDDDDDLHVLNFLPNDTHFGKRKRPFSICMEPKSTNELFSIEFCSYSYCTDCIVKYVDSKLRESITSIRCPIVPKEVSDRWGNALCEGVINGAEKFYCPFKDCSALLINDGLKNMKESKRPYCKRMFCAQCKVPWHAGMRCEKFRKLNKNEKNSEDMELIKLAEEKKWKRCPHCNYSV
**********KNTAISIEQCNEQRGLQSAQNLINLEDYYDDDDDLHVLNFLPNDTHFGKRKRPFSICMEPKSTNELFSIEFCSYSYCTDCIVKYVDSKLRESITSIRCPIVPKEVSDRWGNALCEGVINGAEKFYCPFKDCSALLINDGLKNMKESKRPYCKRMFCAQCKVPWHAGMRCEKFRKLNKNEKNSEDMELIKLAEEKKWKRCPHCNYSV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKPTPPHGTTKNTAISIEQCNEQRGLQSAQNLINLEDYYDDDDDLHVLNFLPNDTHFGKRKRPFSICMEPKSTNELFSIEFCSYSYCTDCIVKYVDSKLRESITSIRCPIVPKEVSDRWGNALCEGVINGAEKFYCPFKDCSALLINDGLKNMKESKRPYCKRMFCAQCKVPWHAGMRCEKFRKLNKNEKNSEDMELIKLAEEKKWKRCPHCNYSV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query216 2.2.26 [Sep-21-2011]
Q1L8L6 701 E3 ubiquitin-protein liga yes no 0.675 0.208 0.224 1e-05
A4IIY1292 Probable E3 ubiquitin-pro yes no 0.694 0.513 0.226 2e-05
P50876292 Probable E3 ubiquitin-pro yes no 0.689 0.510 0.242 2e-05
Q925F3292 Probable E3 ubiquitin-pro yes no 0.689 0.510 0.242 8e-05
Q08B84 687 E3 ubiquitin-protein liga N/A no 0.550 0.173 0.227 0.0005
Q6DH94293 Probable E3 ubiquitin-pro no no 0.699 0.515 0.215 0.0009
>sp|Q1L8L6|RN19B_DANRE E3 ubiquitin-protein ligase RNF19B OS=Danio rerio GN=rnf19b PE=3 SV=2 Back     alignment and function desciption
 Score = 50.1 bits (118), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 38/169 (22%), Positives = 63/169 (37%), Gaps = 23/169 (13%)

Query: 66  ICMEPKSTNELFSIEFCSYSYCTDCIVKYVDSKLRESITSIRCPIVPKEVSDRWGNALCE 125
           +C+  +   +L  ++ CS+  C  C+ +Y+  ++ ES   + CP   + ++  W  AL  
Sbjct: 109 LCLVRQPAEQLPELQGCSHRSCLCCLRQYLRIEITESRVQLSCPECAERLAP-WQVALIL 167

Query: 126 GVINGAEKF----------------YCPFKDCSALLINDGLKNMKE--SKRPYCKRMFCA 167
              N  EK+                +CP  DC   +I  G  +      +R  C   FC 
Sbjct: 168 DDPNLMEKYEEFLLRRCLASDPDCRWCPAPDCGFAVIASGCASCPRLVCRREGCGAEFCY 227

Query: 168 QCKVPWHAGMRCEKFRKLN----KNEKNSEDMELIKLAEEKKWKRCPHC 212
            CK  WH    C+  R+      +   N       +       K CP C
Sbjct: 228 HCKQAWHPNQTCDSARQQRALSLRTHSNHSPSYTAEQGHTDDIKPCPRC 276
E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Danio rerio (taxid: 7955)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|A4IIY1|R144A_XENTR Probable E3 ubiquitin-protein ligase RNF144A OS=Xenopus tropicalis GN=rnf144a PE=2 SV=1 Back     alignment and function description
>sp|P50876|R144A_HUMAN Probable E3 ubiquitin-protein ligase RNF144A OS=Homo sapiens GN=RNF144A PE=1 SV=2 Back     alignment and function description
>sp|Q925F3|R144A_MOUSE Probable E3 ubiquitin-protein ligase RNF144A OS=Mus musculus GN=Rnf144a PE=1 SV=1 Back     alignment and function description
>sp|Q08B84|RN19B_XENLA E3 ubiquitin-protein ligase RNF19B OS=Xenopus laevis GN=rnf19b PE=2 SV=2 Back     alignment and function description
>sp|Q6DH94|R1442_DANRE Probable E3 ubiquitin-protein ligase RNF144A-B OS=Danio rerio GN=rnf144ab PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query216
255550303 400 zinc finger protein, putative [Ricinus c 0.990 0.535 0.425 1e-50
356558463 685 PREDICTED: uncharacterized protein LOC10 0.986 0.310 0.428 1e-49
224142755307 predicted protein [Populus trichocarpa] 0.990 0.697 0.424 2e-49
356530471 333 PREDICTED: putative uncharacterized prot 0.981 0.636 0.443 3e-47
297738503 329 unnamed protein product [Vitis vinifera] 0.995 0.653 0.422 1e-46
225444595 358 PREDICTED: probable E3 ubiquitin-protein 0.995 0.600 0.422 1e-46
297820104 322 zinc finger family protein [Arabidopsis 0.990 0.664 0.399 8e-44
356522436292 PREDICTED: probable E3 ubiquitin-protein 0.870 0.643 0.418 1e-41
356522438303 PREDICTED: probable E3 ubiquitin-protein 0.870 0.620 0.418 2e-41
356560194294 PREDICTED: probable E3 ubiquitin-protein 0.819 0.602 0.424 3e-39
>gi|255550303|ref|XP_002516202.1| zinc finger protein, putative [Ricinus communis] gi|223544688|gb|EEF46204.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 117/275 (42%), Positives = 158/275 (57%), Gaps = 61/275 (22%)

Query: 3   PTPPHGTTKNTAISIEQCNEQRGLQ----------SAQN---LINLED---------YYD 40
           P    G    T IS+E  +E+R L           SA N    +N  D         Y D
Sbjct: 100 PISKKGNKNTTEISVESYSEERDLNVAILASLQSTSASNNNKQLNFNDLSQDYRNYCYID 159

Query: 41  DD-DDLHVLNFLP----NDTHFGKRKRPFS-------------------ICMEPKSTNEL 76
           D+ DDL VL+F P    +    GK +  FS                   IC+E K+ +E 
Sbjct: 160 DENDDLRVLDFTPLPATSKKEMGKNRFGFSVTEKGHSSEPNDHPQFVCEICVESKTADES 219

Query: 77  FSIEFCSYSYCTDCIVKYVDSKLRESITSIRCP---------------IVPKEVSDRWGN 121
            +I  C+++YCTDC+ KYV SK++E+IT I CP               I+P+EV DRWGN
Sbjct: 220 LAIRGCTHAYCTDCMAKYVASKIQENITGIYCPVSGCGGLLEPEYCRSILPQEVFDRWGN 279

Query: 122 ALCEGVINGAEKFYCPFKDCSALLINDGLKNMKESKRPYCKRMFCAQCKVPWHAGMRCEK 181
           ALCE +  G++KFYCPFKDCSA+LINDG + ++ES+ P+C+R+FCA CKVPWH+G+ C K
Sbjct: 280 ALCEALNLGSQKFYCPFKDCSAMLINDGGEVIRESECPHCRRLFCAHCKVPWHSGIDCNK 339

Query: 182 FRKLNKNEKNSEDMELIKLAEEKKWKRCPHCNYSV 216
           F+ L+K+E+  ED+ L+KLAE KKW+RCP C   V
Sbjct: 340 FQTLHKDEREKEDIMLMKLAENKKWRRCPICRIYV 374

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356558463|ref|XP_003547526.1| PREDICTED: uncharacterized protein LOC100803898 [Glycine max] Back     alignment and taxonomy information
>gi|224142755|ref|XP_002324718.1| predicted protein [Populus trichocarpa] gi|222866152|gb|EEF03283.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356530471|ref|XP_003533804.1| PREDICTED: putative uncharacterized protein At4g01020, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|297738503|emb|CBI27748.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225444595|ref|XP_002277363.1| PREDICTED: probable E3 ubiquitin-protein ligase RNF144A-B-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297820104|ref|XP_002877935.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297323773|gb|EFH54194.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356522436|ref|XP_003529852.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI3-like [Glycine max] Back     alignment and taxonomy information
>gi|356522438|ref|XP_003529853.1| PREDICTED: probable E3 ubiquitin-protein ligase RNF144A-like [Glycine max] Back     alignment and taxonomy information
>gi|356560194|ref|XP_003548379.1| PREDICTED: probable E3 ubiquitin-protein ligase RNF144A-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query216
TAIR|locus:2084116320 AT3G53690 [Arabidopsis thalian 0.699 0.471 0.461 2e-43
TAIR|locus:2091030303 AT3G14250 [Arabidopsis thalian 0.722 0.514 0.401 8e-37
TAIR|locus:1006230127384 AT2G26135 [Arabidopsis thalian 0.648 0.364 0.299 1.1e-18
TAIR|locus:2143995 655 AT5G60250 [Arabidopsis thalian 0.708 0.233 0.289 8.7e-18
TAIR|locus:2151689444 AT5G37560 [Arabidopsis thalian 0.532 0.259 0.308 5.2e-15
TAIR|locus:2085622222 AT3G45470 [Arabidopsis thalian 0.638 0.621 0.287 3.8e-14
TAIR|locus:2101074346 AT3G43750 [Arabidopsis thalian 0.569 0.355 0.323 4e-14
TAIR|locus:2050100 468 AT2G21420 [Arabidopsis thalian 0.430 0.198 0.353 1.2e-13
TAIR|locus:2040065 373 AT2G25360 [Arabidopsis thalian 0.560 0.324 0.283 1.9e-13
TAIR|locus:2040025 603 AT2G25370 [Arabidopsis thalian 0.694 0.248 0.266 1.9e-13
TAIR|locus:2084116 AT3G53690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 422 (153.6 bits), Expect = 2.0e-43, Sum P(2) = 2.0e-43
 Identities = 77/167 (46%), Positives = 109/167 (65%)

Query:    66 ICMEPKSTNELFSIEFCSYSYCTDCIVKYVDSKLRESITSIRCP---------------I 110
             IC++ KS  E F I  CS+ YC DC+ KY+ +KL+++I SI CP               I
Sbjct:   117 ICVDSKSIIESFRIGGCSHFYCNDCVSKYIAAKLQDNILSIECPVSGCSGRLEPDQCRQI 176

Query:   111 VPKEVSDRWGNALCEGVINGAEKFYCPFKDCSALL-INDGLKNMKESKRPYCKRMFCAQC 169
             +PKEV DRWG+ALCE V+  ++KFYCP+KDCSAL+ + +    MK+S+ P+C RM C +C
Sbjct:   177 LPKEVFDRWGDALCEAVVMRSKKFYCPYKDCSALVFLEESEVKMKDSECPHCHRMVCVEC 236

Query:   170 KVPWHAGMRCEKFRKLNKNEKNSEDMELIKLAEEKKWKRCPHCNYSV 216
                WH  M CE+F+KL  NE+  +D+ L  +A++KKWKRCP C + +
Sbjct:   237 GTQWHPEMTCEEFQKLAANERGRDDILLATMAKQKKWKRCPSCKFYI 283
GO:0005737 "cytoplasm" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2091030 AT3G14250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1006230127 AT2G26135 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143995 AT5G60250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151689 AT5G37560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085622 AT3G45470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101074 AT3G43750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2050100 AT2G21420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040065 AT2G25360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040025 AT2G25370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.XVIII.567.1
hypothetical protein (303 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
smart0064764 smart00647, IBR, In Between Ring fingers 7e-09
pfam0148563 pfam01485, IBR, IBR domain 9e-05
>gnl|CDD|214763 smart00647, IBR, In Between Ring fingers Back     alignment and domain information 
 Score = 50.1 bits (120), Expect = 7e-09
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 1/64 (1%)

Query: 117 DRWGNALCEGVI-NGAEKFYCPFKDCSALLINDGLKNMKESKRPYCKRMFCAQCKVPWHA 175
           +++   L E  + +  +  +CP  DCSA +I    +       P C   FC +CKVPWH+
Sbjct: 1   EKYERLLLESYVESNPDLKWCPAPDCSAAIIVTEEEGCNRVTCPKCGFSFCFRCKVPWHS 60

Query: 176 GMRC 179
            + C
Sbjct: 61  PVSC 64

the domains occurs between pairs og RING fingers. Length = 64
>gnl|CDD|216524 pfam01485, IBR, IBR domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 216
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 99.94
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 99.91
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 99.89
KOG0006446 consensus E3 ubiquitin-protein ligase (Parkin prot 99.64
smart0064764 IBR In Between Ring fingers. the domains occurs be 99.53
PF0148564 IBR: IBR domain; InterPro: IPR002867 Zinc finger ( 99.48
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.43
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.32
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.28
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.25
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.17
PF1463444 zf-RING_5: zinc-RING finger domain 98.16
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.94
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.77
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 97.69
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 97.55
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 97.44
PHA02929238 N1R/p28-like protein; Provisional 97.34
PHA02926242 zinc finger-like protein; Provisional 97.29
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.23
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.23
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 96.53
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 96.38
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 96.35
smart0050463 Ubox Modified RING finger domain. Modified RING fi 96.3
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 96.27
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 96.25
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 96.22
KOG0006446 consensus E3 ubiquitin-protein ligase (Parkin prot 95.84
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 95.83
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 95.78
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 95.44
PF1371937 zinc_ribbon_5: zinc-ribbon domain 94.01
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 93.85
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 93.72
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 93.69
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 93.49
KOG1002 791 consensus Nucleotide excision repair protein RAD16 93.48
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 93.16
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 92.4
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 92.35
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 92.26
PF1371736 zinc_ribbon_4: zinc-ribbon domain 91.92
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 91.83
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 91.67
PF0215035 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I 91.52
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 91.47
smart0066152 RPOL9 RNA polymerase subunit 9. 91.37
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 91.33
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 90.68
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 89.32
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 87.53
KOG0297 391 consensus TNF receptor-associated factor [Signal t 86.95
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 86.59
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 85.61
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 85.43
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 85.42
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 84.99
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 84.69
PHA03096284 p28-like protein; Provisional 84.28
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 83.57
KOG4739233 consensus Uncharacterized protein involved in syna 82.98
KOG2660 331 consensus Locus-specific chromosome binding protei 82.55
COG5152259 Uncharacterized conserved protein, contains RING a 82.31
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 82.06
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 82.0
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 81.79
PRK14714 1337 DNA polymerase II large subunit; Provisional 81.4
KOG4445368 consensus Uncharacterized conserved protein, conta 81.38
KOG2807378 consensus RNA polymerase II transcription initiati 81.12
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 81.08
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 80.63
KOG2906105 consensus RNA polymerase III subunit C11 [Transcri 80.62
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.94  E-value=1.4e-27  Score=209.89  Aligned_cols=152  Identities=34%  Similarity=0.839  Sum_probs=126.1

Q ss_pred             CCCCcccccCCC-CCCceeeCCCCCccchHHHHHHHHHHhhcCCcccccc---------------CCCHHHHHHHHHHHH
Q 041841           61 KRPFSICMEPKS-TNELFSIEFCSYSYCTDCIVKYVDSKLRESITSIRCP---------------IVPKEVSDRWGNALC  124 (216)
Q Consensus        61 ~~~C~IC~~~~~-~~~~~~~~~C~H~fC~~C~~~y~~~~i~~~~~~i~Cp---------------~l~~~~~~~y~~~~~  124 (216)
                      ..+|.||+.+.+ ..+++....|+|.||.+||++|++++..+ ...|+||               +|++.+.+.|.+.+.
T Consensus       146 ~~~C~iC~~e~~~~~~~f~~~~C~H~fC~~C~k~~iev~~~~-~~~~~C~~~~C~~~l~~~~c~~llt~kl~e~~e~~~~  224 (384)
T KOG1812|consen  146 KEECGICFVEDPEAEDMFSVLKCGHRFCKDCVKQHIEVKLLS-GTVIRCPHDGCESRLTLESCRKLLTPKLREMWEQRLK  224 (384)
T ss_pred             cccCccCccccccHhhhHHHhcccchhhhHHhHHHhhhhhcc-CCCccCCCCCCCccCCHHHHhhhcCHHHHHHHHHHHH
Confidence            579999995554 44667678999999999999999999444 4568888               788899999999999


Q ss_pred             HhhhcCCCCcccCcCCCCceeecCCC---CCCCceeCCCCchhccccCCCCCCCCCChHhHHHhcccCCChhHHHHHHHH
Q 041841          125 EGVINGAEKFYCPFKDCSALLINDGL---KNMKESKRPYCKRMFCAQCKVPWHAGMRCEKFRKLNKNEKNSEDMELIKLA  201 (216)
Q Consensus       125 ~~~v~~~~~~~Cp~~~C~~~~~~~~~---~~~~~~~C~~C~~~fC~~C~~~~H~~~~C~~~~~~~~~e~~~~d~~~~~~~  201 (216)
                      +.++...+.+|||+++|...+.....   .......|+.||..||..|+.+||++.+|++|++|..++.  .|..+.+++
T Consensus       225 e~~i~~~~~~ycp~~~C~~l~~~~el~~~~~~~~~~C~~C~~~fCv~C~~~wh~~~sC~eykk~~~~~~--~d~~~~~~l  302 (384)
T KOG1812|consen  225 EEVIPSLDRVYCPYPRCSSLMSKTELSSEVKSKRRPCVKCHELFCVKCKVPWHANLSCEEYKKLNPEEY--VDDITLKYL  302 (384)
T ss_pred             HHhhhhhhcccCCCCCchHhhhhhhhccchhhcccccccCCCceeecCCCcCCCCCCHHHHHHhCCccc--ccHHHHHHH
Confidence            99998777669999999998876653   2344567999999999999999999999999999987532  445667777


Q ss_pred             hcCCceecCCCCccC
Q 041841          202 EEKKWKRCPHCNYSV  216 (216)
Q Consensus       202 ~~~~~k~CP~C~~~I  216 (216)
                      + ++|++||+|+..|
T Consensus       303 a-~~wr~CpkC~~~i  316 (384)
T KOG1812|consen  303 A-KRWRQCPKCKFMI  316 (384)
T ss_pred             H-HhcCcCcccceee
Confidence            6 5999999999876

>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00647 IBR In Between Ring fingers Back     alignment and domain information
>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2 Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14714 DNA polymerase II large subunit; Provisional Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG2906 consensus RNA polymerase III subunit C11 [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 1e-06
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 4e-05
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Length = 86 Back     alignment and structure
 Score = 44.2 bits (104), Expect = 1e-06
 Identities = 23/80 (28%), Positives = 33/80 (41%), Gaps = 8/80 (10%)

Query: 113 KEVSDRWGNALCEGVINGAEKF-YCPFKDCSALLINDGLKNMKESKRPYCKRMFCAQCKV 171
                 +   L EGV+    KF +C    CS   I +  +   E+  P C + FC +CK 
Sbjct: 4   GSSGALFHKKLTEGVLMRDPKFLWCA--QCSFGFIYE--REQLEATCPQCHQTFCVRCKR 59

Query: 172 PW---HAGMRCEKFRKLNKN 188
            W   H G  CE F+   + 
Sbjct: 60  QWEEQHRGRSCEDFQNWKRM 79
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query216
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 99.59
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 99.56
2jmo_A80 Parkin; IBR, E3 ligase, zinc binding domain, RBR; 99.52
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.68
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.64
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.28
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.26
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.17
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.17
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.11
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.11
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.06
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.05
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.04
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.04
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.02
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.01
2ect_A78 Ring finger protein 126; metal binding protein, st 98.01
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.0
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 97.97
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 97.97
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 97.95
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 97.95
2ysl_A73 Tripartite motif-containing protein 31; ring-type 97.93
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.9
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 97.85
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 97.84
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 97.81
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 97.8
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 97.8
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 97.8
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.78
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.78
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.78
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 97.77
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 97.73
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 97.7
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 97.7
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 97.68
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.66
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 97.56
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.56
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.46
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 97.43
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.43
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.36
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.33
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 97.26
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 97.15
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.12
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 96.97
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 96.97
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 96.93
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 96.84
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 96.8
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 96.63
1wd2_A60 Ariadne-1 protein homolog; ring, IBR, triad, zinc 96.55
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 96.55
2ea5_A68 Cell growth regulator with ring finger domain prot 96.53
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 96.5
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 96.4
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 96.28
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 96.04
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 96.02
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 95.95
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 95.88
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 95.71
2f42_A179 STIP1 homology and U-box containing protein 1; cha 95.16
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 95.0
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 94.27
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 94.14
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 93.96
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 90.15
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 90.13
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 87.44
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 87.05
2d8v_A67 Zinc finger FYVE domain-containing protein 19; zfy 82.55
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure
Probab=99.59  E-value=3e-17  Score=114.67  Aligned_cols=73  Identities=29%  Similarity=0.658  Sum_probs=63.4

Q ss_pred             CHHHHHHHHHHHHHhhhcC-CCCcccCcCCCCceeecCCCCCCCceeCCCCchhccccCCCCC---CCCCChHhHHHhcc
Q 041841          112 PKEVSDRWGNALCEGVING-AEKFYCPFKDCSALLINDGLKNMKESKRPYCKRMFCAQCKVPW---HAGMRCEKFRKLNK  187 (216)
Q Consensus       112 ~~~~~~~y~~~~~~~~v~~-~~~~~Cp~~~C~~~~~~~~~~~~~~~~C~~C~~~fC~~C~~~~---H~~~~C~~~~~~~~  187 (216)
                      +++++++|.+++.+.+|.. +.++|||  +|++++..+..  ...+.|+.|++.||+.|+.+|   |.|++|+++++|.+
T Consensus         3 s~~~~e~y~~~l~e~~v~~~~~~~wCP--~C~~~~~~~~~--~~~v~C~~C~~~FC~~C~~~w~~~H~~~sC~~~~~w~~   78 (86)
T 2ct7_A            3 SGSSGALFHKKLTEGVLMRDPKFLWCA--QCSFGFIYERE--QLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKR   78 (86)
T ss_dssp             CCCCCCSSSSCCCCSCCCSCCCEECCS--SSCCCEECCCS--CSCEECTTTCCEECSSSCSBCCTTTTTSCHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHhcCCCEeECc--CCCchheecCC--CCceEeCCCCCccccccCCchhhcCCCCChHHHHHHHH
Confidence            4567889999999999865 5578999  99998877643  566999999999999999999   99999999999987


Q ss_pred             c
Q 041841          188 N  188 (216)
Q Consensus       188 ~  188 (216)
                      +
T Consensus        79 ~   79 (86)
T 2ct7_A           79 M   79 (86)
T ss_dssp             H
T ss_pred             h
Confidence            5
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2d8v_A Zinc finger FYVE domain-containing protein 19; zfyve19, ZF- B_BOX, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.43.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 216
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 0.002
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: UbcM4-interacting protein 4 (KIAA0161)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 33.9 bits (77), Expect = 0.002
 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 65  SICMEPKSTNELFSIEFCSYSYCTDCIVKYVDSKLRES-ITSIRCP 109
            +C+      ++ +I  C   +CT C+ +YV+  ++E   T+I CP
Sbjct: 9   KLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCP 54

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query216
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 99.62
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 99.47
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.13
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.08
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.02
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.99
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 97.93
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.93
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.87
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 97.79
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.54
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 97.4
d2c2la280 STIP1 homology and U box-containing protein 1, STU 97.29
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 97.25
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 97.2
d1wd2a_60 Ariadne-1 protein homolog {Human (Homo sapiens) [T 96.86
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 96.85
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 96.75
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 93.54
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 92.1
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: UbcM4-interacting protein 4 (KIAA0161)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.62  E-value=1.6e-16  Score=110.98  Aligned_cols=70  Identities=24%  Similarity=0.538  Sum_probs=62.0

Q ss_pred             CCCCcccccCCCCCCceeeCCCCCccchHHHHHHHHHHhhcC-Ccccccc-----------------CCCHHHHHHHHHH
Q 041841           61 KRPFSICMEPKSTNELFSIEFCSYSYCTDCIVKYVDSKLRES-ITSIRCP-----------------IVPKEVSDRWGNA  122 (216)
Q Consensus        61 ~~~C~IC~~~~~~~~~~~~~~C~H~fC~~C~~~y~~~~i~~~-~~~i~Cp-----------------~l~~~~~~~y~~~  122 (216)
                      ..+|+||+++++.++++.++.|+|.||.+||+.|++++|++| ..+|+||                 +++++++++|.++
T Consensus         5 ~~~C~IC~~~~~~~~~~~~~~C~H~fC~~Cl~~~~~~~i~~~~~~~i~CP~~~C~~~~~~~~~~i~~ll~~~~~~ky~~~   84 (94)
T d1wima_           5 SSGCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKL   84 (94)
T ss_dssp             BCCCSSSCCCCBGGGEEEETTTTEEEEHHHHHHHHHHHHHHCSCCCEECSCTTCSSCCEECHHHHHHHSCHHHHHHHHHH
T ss_pred             CCcCccCCCcccCCceEEECCCCCEeCCcCHHHHHHHHHhcCCccccCCcCCCCCCCcccCHHHHHHhCCHHHHHHHHHH
Confidence            568999999999889888889999999999999999999986 4678998                 5788999999999


Q ss_pred             HHHhhhcC
Q 041841          123 LCEGVING  130 (216)
Q Consensus       123 ~~~~~v~~  130 (216)
                      .++..+++
T Consensus        85 ~l~~~~~s   92 (94)
T d1wima_          85 QFERSGPS   92 (94)
T ss_dssp             HHHSSCSS
T ss_pred             HHHhcccc
Confidence            88876643
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure