Citrus Sinensis ID: 041880


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MTALESLDLSFNRLHGRIPEQLLGVTALASLNLSYNRLRGRIPRGNQFNTFDNDSYIGNIHLCGEPLTVTCSNDGQPKAPPSASTDHEEDETPSWFDWKMAKLGYASGVVIGLSIGYMVFSIGRPRWLVKMVERDQQKKVRRRRPRHRM
cccccccccccccccccccccccccccccEEcccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccccc
cccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcccccEEEccccccccccccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccEcHccccccc
mtalesldlsfnrlhgripeqlLGVTALASLNLSYNrlrgriprgnqfntfdndsyignihlcgepltvtcsndgqpkappsastdheedetpswfdwKMAKLGYASGVVIGLSIGYMVFSIGRPRWLVKMVERDQQKkvrrrrprhrm
MTALESLDLSFNRLHGRIPEQLLGVTALASLNLSYNRLRGRIPRGNQFNTFDNDSYIGNIHLCGEPLTVTCSNDGQPKAPPSASTDHEEDETPSWFDWKMAKLGYASGVVIGLSIGYMVFSIGRPrwlvkmverdqqkkvrrrrprhrm
MTALESLDLSFNRLHGRIPEQLLGVTALASLNLSYNRLRGRIPRGNQFNTFDNDSYIGNIHLCGEPLTVTCSNDGQPKAPPSASTDHEEDETPSWFDWKMAKLGYASGVVIGLSIGYMVFSIGRPRWLVKMVERDQQKKVrrrrprhrM
********LSFNRLHGRIPEQLLGVTALASLNLSYNRLRGRIPRGNQFNTFDNDSYIGNIHLCGEPLTVTC**********************SWFDWKMAKLGYASGVVIGLSIGYMVFSIGRPRWLVKMV*****************
MTALESLDLSFNRLHGRIPEQLLGVTALASLNLSYNRLRGRIPRGNQFNTFDNDSYIGNIHLCGEPLT**************************WFDWKMAKLGYASGVVIGLSIGYMVFSIGRPRWLVKMVERDQQKKVR*R******
MTALESLDLSFNRLHGRIPEQLLGVTALASLNLSYNRLRGRIPRGNQFNTFDNDSYIGNIHLCGEPLTVTCSN*******************PSWFDWKMAKLGYASGVVIGLSIGYMVFSIGRPRWLVKMVE****************
*TALESLDLSFNRLHGRIPEQLLGVTALASLNLSYNRLRGRIPRGNQFNTFDNDSYIGNIHLCGEPLTVTC**********************SWFDWKMAKLGYASGVVIGLSIGYMVFSIGRPRWLVKMVERDQQKK**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTALESLDLSFNRLHGRIPEQLLGVTALASLNLSYNRLRGRIPRGNQFNTFDNDSYIGNIHLCGEPLTVTCSNDGQPKAPPSASTDHEEDETPSWFDWKMAKLGYASGVVIGLSIGYMVFSIGRPRWLVKMVERDQQKKVRRRRPRHRM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query149 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.912 0.160 0.335 2e-14
Q8LPB4 1021 Phytosulfokine receptor 1 N/A no 0.395 0.057 0.523 4e-12
Q9ZVR7 1008 Phytosulfokine receptor 1 no no 0.429 0.063 0.538 2e-11
Q9FN37 1036 Phytosulfokine receptor 2 no no 0.818 0.117 0.335 2e-10
A7PW81333 Polygalacturonase inhibit no no 0.429 0.192 0.507 2e-10
Q00874372 DNA-damage-repair/tolerat no no 0.469 0.188 0.471 2e-10
Q9C7S5 1095 Tyrosine-sulfated glycope no no 0.469 0.063 0.478 3e-10
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.422 0.050 0.476 6e-10
C0LGF4 591 LRR receptor-like serine/ no no 0.530 0.133 0.387 2e-09
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.516 0.063 0.409 3e-09
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 72/140 (51%), Gaps = 4/140 (2%)

Query: 1   MTALESLDLSFNRLHGRIPEQLLGVTALASLNLSYNRLRGRIPRGNQFNTFDNDSYIGNI 60
           +T LE+LD+S N+L G+IP+ L  ++ L+ +N S+N L+G +PRG QF      S++ N 
Sbjct: 705 LTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVPRGTQFQRQKCSSFLDNP 764

Query: 61  HLCGEPLTVTCSNDGQPKAPPSASTDHEEDETPSWFDWKMAKLGYASGVVIGLSIGYMVF 120
            L G  L   C + G          D  E E  + F+W  A + Y  GV+ GL IG+  +
Sbjct: 765 GLYG--LEDICRDTGALNPTSQLPEDLSEAEE-NMFNWVAAAIAYGPGVLCGLVIGHF-Y 820

Query: 121 SIGRPRWLVKMVERDQQKKV 140
           +     W  +   R Q K +
Sbjct: 821 TSHNHEWFTEKFGRKQHKAL 840




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1 Back     alignment and function description
>sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4 Back     alignment and function description
>sp|Q9FN37|PSKR2_ARATH Phytosulfokine receptor 2 OS=Arabidopsis thaliana GN=PSKR2 PE=2 SV=1 Back     alignment and function description
>sp|A7PW81|PGIP_VITVI Polygalacturonase inhibitor OS=Vitis vinifera GN=pgip PE=1 SV=1 Back     alignment and function description
>sp|Q00874|DR100_ARATH DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2 Back     alignment and function description
>sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1 OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|C0LGF4|FEI1_ARATH LRR receptor-like serine/threonine-protein kinase FEI 1 OS=Arabidopsis thaliana GN=FEI1 PE=1 SV=1 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
224116970 921 predicted protein [Populus trichocarpa] 0.959 0.155 0.557 2e-40
255568090 1014 serine/threonine-protein kinase bri1, pu 0.912 0.134 0.510 9e-36
224111710 1176 predicted protein [Populus trichocarpa] 0.979 0.124 0.509 7e-35
297736159149 unnamed protein product [Vitis vinifera] 0.906 0.906 0.528 3e-34
224152304242 predicted protein [Populus trichocarpa] 0.979 0.603 0.496 3e-33
147826872 751 hypothetical protein VITISV_000530 [Viti 0.906 0.179 0.521 4e-33
296082718 745 unnamed protein product [Vitis vinifera] 0.906 0.181 0.514 1e-32
225462116 1001 PREDICTED: receptor-like protein 12-like 0.906 0.134 0.514 1e-32
224099469 897 predicted protein [Populus trichocarpa] 0.959 0.159 0.493 1e-31
356561450 813 PREDICTED: receptor-like protein 12-like 0.939 0.172 0.510 2e-31
>gi|224116970|ref|XP_002331797.1| predicted protein [Populus trichocarpa] gi|222874493|gb|EEF11624.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  170 bits (430), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/147 (55%), Positives = 107/147 (72%), Gaps = 4/147 (2%)

Query: 1   MTALESLDLSFNRLHGRIPEQLLGVTALASLNLSYNRLRGRIPRGNQFNTFDNDSYIGNI 60
           +TALESLDLS N L G IP QL  +T LA LNLSYN+L G IP G+QF+TF NDSY+GN+
Sbjct: 778 LTALESLDLSSNGLGGGIPSQLTRLTFLAVLNLSYNQLVGPIPHGSQFDTFQNDSYVGNL 837

Query: 61  HLCGEPLTVTCSNDGQPKAPPSASTDHEEDETPSWFDWKMAKLGYASGVVIGLSIGYMVF 120
            LCG PL+V CS D  P+ PP      E+++  S F+WK A +GY  G+VIGLS+GY+VF
Sbjct: 838 RLCGFPLSVKCSGDVAPQPPPF----QEKEDPASLFNWKFAMIGYGCGLVIGLSVGYIVF 893

Query: 121 SIGRPRWLVKMVERDQQKKVRRRRPRH 147
           + G+P+W V+ VE +Q+K +RRR  R+
Sbjct: 894 TTGKPQWFVRKVEVEQKKWLRRRTKRN 920




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255568090|ref|XP_002525021.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223535683|gb|EEF37348.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224111710|ref|XP_002332892.1| predicted protein [Populus trichocarpa] gi|222833737|gb|EEE72214.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297736159|emb|CBI24197.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224152304|ref|XP_002337217.1| predicted protein [Populus trichocarpa] gi|222838492|gb|EEE76857.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147826872|emb|CAN73268.1| hypothetical protein VITISV_000530 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296082718|emb|CBI21723.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225462116|ref|XP_002263233.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224099469|ref|XP_002334479.1| predicted protein [Populus trichocarpa] gi|222872406|gb|EEF09537.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356561450|ref|XP_003548994.1| PREDICTED: receptor-like protein 12-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
TAIR|locus:2046500218 RLP25 "receptor like protein 2 0.885 0.605 0.377 1.2e-19
TAIR|locus:2829370915 RLP40 "receptor like protein 4 0.845 0.137 0.407 1.4e-19
TAIR|locus:2086979890 RLP42 "receptor like protein 4 0.852 0.142 0.412 1.7e-19
TAIR|locus:2046600800 RLP26 "receptor like protein 2 0.906 0.168 0.378 1.8e-19
TAIR|locus:2046397589 RLP22 "receptor like protein 2 0.825 0.208 0.4 2.2e-19
TAIR|locus:2046357890 RLP23 "receptor like protein 2 0.906 0.151 0.368 3.6e-19
TAIR|locus:2087253884 RLP39 "AT3G24900" [Arabidopsis 0.838 0.141 0.396 4.6e-19
TAIR|locus:2046585808 RLP27 "receptor like protein 2 0.879 0.162 0.388 5.1e-19
TAIR|locus:2046515864 RLP24 "receptor like protein 2 0.832 0.143 0.387 7.2e-19
TAIR|locus:2078102875 RLP33 "receptor like protein 3 0.825 0.140 0.403 9.4e-19
TAIR|locus:2046500 RLP25 "receptor like protein 25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 234 (87.4 bits), Expect = 1.2e-19, P = 1.2e-19
 Identities = 51/135 (37%), Positives = 76/135 (56%)

Query:     4 LESLDLSFNRLHGRIPEQLLGVTALASLNLSYNRLRGRIPRGNQFNTFDNDSYIGNIHLC 63
             LESLD+S N L G IP+ L  ++ L  +N+S+N+L+G IP+G Q       S+ GN  LC
Sbjct:    85 LESLDMSRNGLSGTIPQGLKTLSFLGYINVSHNQLKGEIPQGTQITGPPKSSFEGNAGLC 144

Query:    64 GEPLTVTCSNDGQPKAPPSASTDHEEDETPSWFDWKMAKLGYASGVVIGLSIGYMVFSIG 123
             G PL  +C     P    S   D++ED      +WK    GY  GV  GL+I  ++ S  
Sbjct:   145 GLPLEESCFGTKVPPIQQSKKEDNQEDAKV--LNWKAVATGYGPGVFFGLAIAQIIASY- 201

Query:   124 RPRWLVKMVERDQQK 138
             +P WLVK++  ++++
Sbjct:   202 KPEWLVKIIGPNKRR 216




GO:0005886 "plasma membrane" evidence=ISM
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2829370 RLP40 "receptor like protein 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086979 RLP42 "receptor like protein 42" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046600 RLP26 "receptor like protein 26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046397 RLP22 "receptor like protein 22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046357 RLP23 "receptor like protein 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087253 RLP39 "AT3G24900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046585 RLP27 "receptor like protein 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046515 RLP24 "receptor like protein 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pm.C_scaffold_182000003
hypothetical protein (921 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.003
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.004
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
 Score = 60.6 bits (147), Expect = 1e-11
 Identities = 32/79 (40%), Positives = 42/79 (53%), Gaps = 10/79 (12%)

Query: 1   MTALESLDLSFNRLHGRIPEQLLGVTALASLNLSYNRLRGRIP--------RGNQFNTFD 52
           +T+LE LDLS+N  +G IPE L  +T+L  LNL+ N L GR+P            FN  D
Sbjct: 465 ITSLEVLDLSYNSFNGSIPESLGQLTSLRILNLNGNSLSGRVPAALGGRLLHRASFNFTD 524

Query: 53  NDSYIG--NIHLCGEPLTV 69
           N    G   +  CG  L+V
Sbjct: 525 NAGLCGIPGLRACGPHLSV 543


Length = 623

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 149
PLN03150623 hypothetical protein; Provisional 99.35
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.26
PLN03150623 hypothetical protein; Provisional 98.79
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.63
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.4
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.91
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.82
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.48
KOG0472 565 consensus Leucine-rich repeat protein [Function un 96.99
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 96.5
KOG0472565 consensus Leucine-rich repeat protein [Function un 96.27
PLN03210 1153 Resistant to P. syringae 6; Provisional 96.13
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 95.95
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 95.65
KOG0617264 consensus Ras suppressor protein (contains leucine 95.49
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 95.48
PLN03210 1153 Resistant to P. syringae 6; Provisional 95.4
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.33
KOG1259490 consensus Nischarin, modulator of integrin alpha5 95.2
KOG0617264 consensus Ras suppressor protein (contains leucine 94.86
smart0037026 LRR Leucine-rich repeats, outliers. 94.83
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.83
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 94.75
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 94.31
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 93.89
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 93.61
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 93.52
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 93.42
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 93.36
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 93.04
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 92.86
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 92.32
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 91.97
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 91.54
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 91.43
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 90.31
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 90.17
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 90.13
KOG4237498 consensus Extracellular matrix protein slit, conta 90.06
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 90.04
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 89.37
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 89.2
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 88.42
KOG2982 418 consensus Uncharacterized conserved protein [Funct 87.95
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 87.93
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 87.37
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 87.19
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 86.67
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 86.59
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 85.79
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 84.48
KOG1259490 consensus Nischarin, modulator of integrin alpha5 83.95
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
Probab=99.35  E-value=2.5e-12  Score=109.76  Aligned_cols=70  Identities=41%  Similarity=0.612  Sum_probs=45.0

Q ss_pred             CCccEEeCCCCcCceeCCcchhcCCCCCEEEccCCcCCCCCCCCCc--ccCCCccccccccCccCCCCCCCC
Q 041880            2 TALESLDLSFNRLHGRIPEQLLGVTALASLNLSYNRLRGRIPRGNQ--FNTFDNDSYIGNIHLCGEPLTVTC   71 (149)
Q Consensus         2 ~~L~~LdLs~N~L~G~iP~~l~~l~~L~~l~ls~N~l~G~iP~~~~--~~~~~~~~~~gn~~lcg~~~~~~c   71 (149)
                      +.|+.|||++|+|+|.+|..++++++|+.|+|++|+|+|.+|....  +.......+.+|+.+|+.+....|
T Consensus       466 ~~L~~LdLs~N~lsg~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~l~~~~~~~~~l~~~~N~~lc~~p~l~~C  537 (623)
T PLN03150        466 TSLEVLDLSYNSFNGSIPESLGQLTSLRILNLNGNSLSGRVPAALGGRLLHRASFNFTDNAGLCGIPGLRAC  537 (623)
T ss_pred             CCCCEEECCCCCCCCCCchHHhcCCCCCEEECcCCcccccCChHHhhccccCceEEecCCccccCCCCCCCC
Confidence            4566677777777777777777777777777777777777775422  122234557788888876543444



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-09
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-09
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-09
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Iteration: 1

Score = 58.2 bits (139), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 29/64 (45%), Positives = 38/64 (59%) Query: 4 LESLDLSFNRLHGRIPEQLLGVTALASLNLSYNRLRGRIPRGNQFNTFDNDSYIGNIHLC 63 L LDL NR++G +P+ L + L SLN+S+N L G IP+G FD +Y N LC Sbjct: 246 LNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLC 305 Query: 64 GEPL 67 G PL Sbjct: 306 GSPL 309
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-32
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-24
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-07
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-07
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-06
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-04
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 8e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-06
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-04
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-04
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-04
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  119 bits (301), Expect = 2e-32
 Identities = 33/88 (37%), Positives = 44/88 (50%)

Query: 1   MTALESLDLSFNRLHGRIPEQLLGVTALASLNLSYNRLRGRIPRGNQFNTFDNDSYIGNI 60
           +  L  LDLS N+L GRIP+ +  +T L  ++LS N L G IP   QF TF    ++ N 
Sbjct: 679 LRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNP 738

Query: 61  HLCGEPLTVTCSNDGQPKAPPSASTDHE 88
            LCG PL     ++    A    S  H 
Sbjct: 739 GLCGYPLPRCDPSNADGYAHHQRSHHHH 766


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.49
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.87
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 98.53
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.49
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.37
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.36
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.31
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.28
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.23
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.18
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.17
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.17
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.14
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.13
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.11
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.1
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.1
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.02
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.02
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.01
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 97.99
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 97.96
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.94
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.93
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 97.93
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.92
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.91
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.91
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.91
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.9
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 97.89
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.88
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.86
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.86
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 97.84
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 97.84
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 97.83
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 97.8
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 97.8
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.79
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.79
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 97.78
4ezg_A197 Putative uncharacterized protein; internalin-A, le 97.76
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.76
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.75
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.72
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.72
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.72
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 97.72
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 97.72
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 97.71
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.7
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.68
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 97.66
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 97.66
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 97.65
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.65
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.64
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 97.64
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.63
4fmz_A347 Internalin; leucine rich repeat, structural genomi 97.63
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 97.63
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.62
4ezg_A197 Putative uncharacterized protein; internalin-A, le 97.61
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 97.57
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 97.57
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 97.56
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 97.56
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 97.55
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 97.52
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 97.52
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 97.52
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 97.51
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 97.51
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.51
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.49
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 97.48
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.47
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 97.47
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.46
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.44
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 97.43
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 97.43
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.43
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.43
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 97.43
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 97.42
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.41
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 97.39
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.37
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 97.36
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 97.32
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.31
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.3
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 97.3
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 97.29
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.27
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 97.26
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.25
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 97.25
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.24
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 97.24
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.24
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 97.23
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 97.18
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 97.13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 97.04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 97.02
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.0
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 96.98
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 96.94
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 96.9
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 96.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 96.88
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.83
1o6v_A466 Internalin A; bacterial infection, extracellular r 96.82
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 96.79
1o6v_A466 Internalin A; bacterial infection, extracellular r 96.78
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 96.73
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 96.71
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 96.55
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.43
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 96.42
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 96.38
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 96.2
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 96.19
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 96.08
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 96.02
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 95.9
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 95.54
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 95.49
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.84
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 94.74
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 94.7
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 94.52
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 94.32
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 94.17
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 93.76
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 93.35
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 93.34
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 92.18
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 90.7
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 87.81
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 86.05
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 83.94
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 80.76
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=99.49  E-value=2e-14  Score=123.13  Aligned_cols=72  Identities=43%  Similarity=0.759  Sum_probs=66.5

Q ss_pred             CCCccEEeCCCCcCceeCCcchhcCCCCCEEEccCCcCCCCCCCCCcccCCCccccccccCccCCCCCCCCCC
Q 041880            1 MTALESLDLSFNRLHGRIPEQLLGVTALASLNLSYNRLRGRIPRGNQFNTFDNDSYIGNIHLCGEPLTVTCSN   73 (149)
Q Consensus         1 l~~L~~LdLs~N~L~G~iP~~l~~l~~L~~l~ls~N~l~G~iP~~~~~~~~~~~~~~gn~~lcg~~~~~~c~~   73 (149)
                      ++.|+.|||++|+|+|.||..+..++.|++||+++|+|+|+||...+|.++...+|.||++|||.|+. .|..
T Consensus       679 L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~  750 (768)
T 3rgz_A          679 LRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDP  750 (768)
T ss_dssp             CTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCS
T ss_pred             CCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCC
Confidence            46789999999999999999999999999999999999999999999999999999999999999876 7764



>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 149
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.003
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 71.7 bits (174), Expect = 3e-16
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 8   DLSFNRLHGRIPEQLLGVTALASLNLSYNRLRGRIPRGNQFNTFDNDSYIGNIHLCGEPL 67
           DL  NR++G +P+ L  +  L SLN+S+N L G IP+G     FD  +Y  N  LCG PL
Sbjct: 250 DLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPL 309

Query: 68  TVTCS 72
              C+
Sbjct: 310 P-ACT 313


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.38
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 98.19
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.19
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.14
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.13
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.08
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.71
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.63
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.61
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.53
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.49
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.39
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.33
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.29
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.13
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.03
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 96.87
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 96.82
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 96.82
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.69
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 96.67
d2omza2 384 Internalin A {Listeria monocytogenes [TaxId: 1639] 96.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 96.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 96.51
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 96.48
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 96.29
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 96.28
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 96.25
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 95.72
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 94.98
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 94.2
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 93.97
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 92.81
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 92.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 92.31
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 91.72
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 91.17
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 87.14
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 86.31
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 80.84
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.38  E-value=1.6e-13  Score=103.85  Aligned_cols=70  Identities=43%  Similarity=0.783  Sum_probs=63.4

Q ss_pred             CCCccEEeCCCCcCceeCCcchhcCCCCCEEEccCCcCCCCCCCCCcccCCCccccccccCccCCCCCCCC
Q 041880            1 MTALESLDLSFNRLHGRIPEQLLGVTALASLNLSYNRLRGRIPRGNQFNTFDNDSYIGNIHLCGEPLTVTC   71 (149)
Q Consensus         1 l~~L~~LdLs~N~L~G~iP~~l~~l~~L~~l~ls~N~l~G~iP~~~~~~~~~~~~~~gn~~lcg~~~~~~c   71 (149)
                      ++.|+.|||++|+|+|.||.+++++++|++|||++|+|+|+||....+..+....+.||+.+||.|+. .|
T Consensus       243 ~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~~l~g~plp-~c  312 (313)
T d1ogqa_         243 SKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLP-AC  312 (313)
T ss_dssp             CTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSEEESTTSS-CC
T ss_pred             ccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhCCCccccCCCCC-CC
Confidence            36789999999999999999999999999999999999999998777788888889999999998763 44



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure