Citrus Sinensis ID: 041887

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---

MEIINYQGEELNRYGGLFVHKNPELKIKVVDGSSLAVAVLTNSIPDGTTQVVIRGILTKVAYATAFALCQKGIQVVTLREDEHEKLIRSFGGKSESKNLLVSRSYCQKIWLVGNGLTEEEQSKAERGTMFVPFSQFPPAKKRRKDCTYHLTPAMATPAALENVDSCENWLPRRVMSAWRIGGIVHALEGWNEHECGYTISNVDTVWDAALRHGFVPLTIPTQS

ccccccccHHccccccEEEEEcccccEEEEEcccHHHHHHHccccccccEEEEEcccHHHHHHHHHHHHHccEEEEEEcccHHHHHHHHccccccccEEEEEEEEEcEEEEEcccccHHHHHccccccEEEEccccccccccccccEEcccccccccccccccccccccccccEEEHHHHHHHHHHHccccccccccccccHHHHHHHHHHcccccccccccc

cHHHHccHHHHccccEEEEEcccccEEEEEcccHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHccccHHHHccEEEEEccccEEEEEcccccHHHHHHcccccEEEEccccccHHHHHcccccccccccccccHcccccHHHHHccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccEEccccc

MEIINYQGeelnrygglfvhknpelkikvvdGSSLAVAVLtnsipdgttQVVIRGILTKVAYATAFALCQKGIQVVTLREDEHEKLIrsfggksesknllVSRSYCQKIWLVgnglteeeqskaergtmfvpfsqfppakkrrkdctyhltpamatpaalenvdscenwlpRRVMSAWRIGGIVHalegwnehecgytisnVDTVWDAAlrhgfvpltiptqs

MEIINYQgeelnrygGLFVHKNPELKIKVVDGSSLAVAVltnsipdgttqVVIRGILTKVAYATAFALCQKGIQVVTLREDEHEKLIrsfggksesknllVSRSYCQKIWLVGNGLTEEeqskaergtmfvpfsqfppakkRRKDCTYHLTpamatpaalenVDSCENWLPRRVMSAWRIGGIVHALEGWNEHECGYTISNVDTVWDAALRHGfvpltiptqs

***INYQGEELNRYGGLFVHKNPELKIKVVDGSSLAVAVLTNSIPDGTTQVVIRGILTKVAYATAFALCQKGIQVVTLREDEHEKLIRSFGG****KNLLVSRSYCQKIWLVGNGL**************V*************DCTYHLTPAMATPAALENVDSCENWLPRRVMSAWRIGGIVHALEGWNEHECGYTISNVDTVWDAALRHGFVPLTI****

*E**NYQGEELNRYGGLFVHKNPELKIKVVDGSSLAVAVLTNSIPDGTTQVVIRGILTKVAYATAFALCQKGIQVVT*********************LLVSRSYCQKIWLVGNGLTEEEQSKAERGTMFVPFSQFPPAKKRRKDCTYHLTPAMATPAALENVDSCENWLPRRVMSAWRIGGIVHALEGWNEHECGYTISNVDTVWDAALRHGFVPLTIP***

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		223	2.2.26 [Sep-21-2011]
F4HVX7		627	Protein CER1-like 1 OS=Ar	yes	no	0.914	0.325	0.593	6e-68
F4IR05		613	Protein CER1-like 2 OS=Ar	no	no	0.914	0.332	0.564	6e-66
F4HVY0		625	Protein ECERIFERUM 1 OS=A	no	no	0.950	0.339	0.561	1e-65
Q8H1Z0		632	Protein ECERIFERUM 3 OS=A	no	no	0.910	0.321	0.379	4e-32

>sp\|F4HVX7\|CERL1_ARATH Protein CER1-like 1 OS=Arabidopsis thaliana GN=At1g02190 PE=2 SV=1	Back alignment and function desciption

 Score =  256 bits (655), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 157/214 (73%), Gaps = 10/214 (4%)

Query: 9   EELNRYGGLFVHKNPELKIKVVDGSSLAVAVLTNSIPDGTTQVVIRGILTKVAYATAFAL 68
           EELN  G ++V K P+LKI++VDGSS+A  V+ N+IP   T++V RG LTKVA A  FAL
Sbjct: 414 EELNGSGEMYVQKYPKLKIRLVDGSSMAATVVINNIPKEATEIVFRGNLTKVASAVVFAL 473

Query: 69  CQKGIQVVTLREDEHEKLIRSFGGKSESKNLLVSRS---YCQKIWLVGNGLTEEEQSKAE 125
           CQKG++VV LRE+EH KLI+S       KNL++S S   Y  K+WLVG+G+  EEQ KA+
Sbjct: 474 CQKGVKVVVLREEEHSKLIKS----GVDKNLVLSTSNSYYSPKVWLVGDGIENEEQMKAK 529

Query: 126 RGTMFVPFSQFPPAKKRRKDCTYHLTPAMATPAALENVDSCENWLPRRVMSAWRIGGIVH 185
            GT+FVPFS FPP  K RKDC Y  TPAM  P + +N+DSCENWL RRVMSAW+IGGIVH
Sbjct: 530 EGTLFVPFSHFPP-NKLRKDCFYQSTPAMRVPKSAQNIDSCENWLGRRVMSAWKIGGIVH 588

Query: 186 ALEGWNEHECGYT--ISNVDTVWDAALRHGFVPL 217
           ALEGW EH+CG T  +  +  +W+AALRH F PL
Sbjct: 589 ALEGWEEHDCGNTCNVLRLHAIWEAALRHDFQPL 622

Arabidopsis thaliana (taxid: 3702)

>sp\|F4IR05\|CERL2_ARATH Protein CER1-like 2 OS=Arabidopsis thaliana GN=At2g37700 PE=2 SV=1	Back alignment and function description

>sp\|F4HVY0\|CER1_ARATH Protein ECERIFERUM 1 OS=Arabidopsis thaliana GN=CER1 PE=1 SV=1	Back alignment and function description

>sp\|Q8H1Z0\|CER3_ARATH Protein ECERIFERUM 3 OS=Arabidopsis thaliana GN=CER3 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		223
359489248		619	PREDICTED: protein WAX2-like [Vitis vini	0.955	0.344	0.665	5e-83
224129430		622	predicted protein [Populus trichocarpa]	0.968	0.347	0.658	8e-83
297734707		281	unnamed protein product [Vitis vinifera]	0.955	0.758	0.665	8e-83
449432335		624	PREDICTED: protein ECERIFERUM 1-like [Cu	0.955	0.341	0.669	2e-82
359489254		619	PREDICTED: protein WAX2-like [Vitis vini	0.937	0.337	0.657	3e-81
147814807		392	hypothetical protein VITISV_032726 [Viti	0.937	0.533	0.652	6e-81
359489252		619	PREDICTED: protein WAX2-like [Vitis vini	0.955	0.344	0.651	8e-81
359489250		619	PREDICTED: protein WAX2-like [Vitis vini	0.955	0.344	0.655	9e-81
356523028		625	PREDICTED: protein WAX2-like [Glycine ma	0.946	0.337	0.630	2e-80
147866784		312	hypothetical protein VITISV_026148 [Viti	0.959	0.685	0.632	8e-79

>gi\|359489248\|ref\|XP_002265685.2\| PREDICTED: protein WAX2-like [Vitis vinifera]	Back alignment and taxonomy information

 Score =  312 bits (800), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 143/215 (66%), Positives = 174/215 (80%), Gaps = 2/215 (0%)

Query: 7   QGEELNRYGGLFVHKNPELKIKVVDGSSLAVAVLTNSIPDGTTQVVIRGILTKVAYATAF 66
           QGEELN YG L++H NP+LKIKVVDGSSLAVAV+ NSIP GTTQV+ RG L+KVAY TA 
Sbjct: 407 QGEELNLYGKLYIHLNPKLKIKVVDGSSLAVAVVLNSIPKGTTQVLFRGKLSKVAYFTAI 466

Query: 67  ALCQKGIQVVTLREDEHEKLIRSFGGKSESKNLLVSRSYCQKIWLVGNGLTEEEQSKAER 126
           ALCQKGIQV T RE+EH+K+      K   K L +S++Y  KIWLVG+GLTEEEQ KA +
Sbjct: 467 ALCQKGIQVTTFREEEHKKIKMKLNTKLRDK-LALSKNYAHKIWLVGDGLTEEEQLKAPK 525

Query: 127 GTMFVPFSQFPPAKKRRKDCTYHLTPAMATPAALENVDSCENWLPRRVMSAWRIGGIVHA 186
           GT+F+PFSQFPP K+ RKDC YH TPAM +P + EN+DSCENWLPRR MSAWR+ GI+HA
Sbjct: 526 GTLFIPFSQFPP-KRMRKDCFYHTTPAMMSPTSFENMDSCENWLPRRAMSAWRVAGILHA 584

Query: 187 LEGWNEHECGYTISNVDTVWDAALRHGFVPLTIPT 221
           LEGWN HECG+TI +++ +W+A+ +HGF PL IP+
Sbjct: 585 LEGWNVHECGHTIFDIEKIWEASFQHGFRPLMIPS 619

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224129430\|ref\|XP_002320584.1\| predicted protein [Populus trichocarpa] gi\|222861357\|gb\|EEE98899.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|297734707\|emb\|CBI16758.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449432335\|ref\|XP_004133955.1\| PREDICTED: protein ECERIFERUM 1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|359489254\|ref\|XP_002265189.2\| PREDICTED: protein WAX2-like [Vitis vinifera] gi\|297734711\|emb\|CBI16762.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147814807\|emb\|CAN63491.1\| hypothetical protein VITISV_032726 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359489252\|ref\|XP_002263787.2\| PREDICTED: protein WAX2-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359489250\|ref\|XP_003633900.1\| PREDICTED: protein WAX2-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356523028\|ref\|XP_003530144.1\| PREDICTED: protein WAX2-like [Glycine max]	Back alignment and taxonomy information

>gi\|147866784\|emb\|CAN83072.1\| hypothetical protein VITISV_026148 [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		223
TAIR\|locus:2204813		627	AT1G02190 "AT1G02190" [Arabido	0.914	0.325	0.593	2.3e-64
TAIR\|locus:2040666		613	AT2G37700 "AT2G37700" [Arabido	0.928	0.337	0.558	4.3e-61
UNIPROTKB\|Q109K1		595	LOC_Os10g33250 "CER1 protein,	0.950	0.356	0.518	6.6e-58
UNIPROTKB\|Q7XDI3		621	Os10g0471100 "CER1 protein, pu	0.950	0.341	0.518	6.6e-58
UNIPROTKB\|Q6ETL8		628	P0544B02.10 "Os02g0178800 prot	0.928	0.329	0.394	2.2e-32
TAIR\|locus:2174368		632	CER3 "ECERIFERUM 3" [Arabidops	0.919	0.324	0.369	2.9e-32

TAIR\|locus:2204813 AT1G02190 "AT1G02190" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 656 (236.0 bits), Expect = 2.3e-64, P = 2.3e-64
 Identities = 127/214 (59%), Positives = 157/214 (73%)

Query:     9 EELNRYGGLFVHKNPELKIKVVDGSSLAVAVLTNSIPDGTTQVVIRGILTKVAYATAFAL 68
             EELN  G ++V K P+LKI++VDGSS+A  V+ N+IP   T++V RG LTKVA A  FAL
Sbjct:   414 EELNGSGEMYVQKYPKLKIRLVDGSSMAATVVINNIPKEATEIVFRGNLTKVASAVVFAL 473

Query:    69 CQKGIQVVTLREDEHEKLIRSFGGKSESKNLLVSRS---YCQKIWLVGNGLTEEEQSKAE 125
             CQKG++VV LRE+EH KLI+S       KNL++S S   Y  K+WLVG+G+  EEQ KA+
Sbjct:   474 CQKGVKVVVLREEEHSKLIKS----GVDKNLVLSTSNSYYSPKVWLVGDGIENEEQMKAK 529

Query:   126 RGTMFVPFSQFPPAKKRRKDCTYHLTPAMATPAALENVDSCENWLPRRVMSAWRIGGIVH 185
              GT+FVPFS FPP  K RKDC Y  TPAM  P + +N+DSCENWL RRVMSAW+IGGIVH
Sbjct:   530 EGTLFVPFSHFPP-NKLRKDCFYQSTPAMRVPKSAQNIDSCENWLGRRVMSAWKIGGIVH 588

Query:   186 ALEGWNEHECGYT--ISNVDTVWDAALRHGFVPL 217
             ALEGW EH+CG T  +  +  +W+AALRH F PL
Sbjct:   589 ALEGWEEHDCGNTCNVLRLHAIWEAALRHDFQPL 622

GO:0003824 "catalytic activity" evidence=ISS

GO:0005506 "iron ion binding" evidence=IEA

GO:0006633 "fatty acid biosynthetic process" evidence=IEA

GO:0016491 "oxidoreductase activity" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

TAIR\|locus:2040666 AT2G37700 "AT2G37700" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q109K1 LOC_Os10g33250 "CER1 protein, putative, expressed" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

UNIPROTKB\|Q7XDI3 Os10g0471100 "CER1 protein, putative, expressed" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

UNIPROTKB\|Q6ETL8 P0544B02.10 "Os02g0178800 protein" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

TAIR\|locus:2174368 CER3 "ECERIFERUM 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	estExt_Genewise1_v1.C_LG_XIV4166	fatty aldehyde decarbonylase (EC-4.1.99.5) (622 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		223
PLN02869		620	PLN02869, PLN02869, fatty aldehyde decarbonylase	1e-126
pfam12076		164	pfam12076, Wax2_C, WAX2 C-terminal domain	4e-89

>gnl\|CDD\|166510 PLN02869, PLN02869, fatty aldehyde decarbonylase	Back alignment and domain information

 Score =  369 bits (950), Expect = e-126
 Identities = 145/215 (67%), Positives = 177/215 (82%), Gaps = 1/215 (0%)

Query: 7   QGEELNRYGGLFVHKNPELKIKVVDGSSLAVAVLTNSIPDGTTQVVIRGILTKVAYATAF 66
           QGEELNRYG L++H+NP+LKIKVVDGSSLAVAV+ NSIP GTTQV+ RG L+KVAY  A 
Sbjct: 407 QGEELNRYGELYIHRNPKLKIKVVDGSSLAVAVVLNSIPKGTTQVLFRGNLSKVAYFIAS 466

Query: 67  ALCQKGIQVVTLREDEHEKLIRSFGGKSESKNLLVSRSYCQKIWLVGNGLTEEEQSKAER 126
           ALCQ+GIQV T REDE+EKL +          LL+S++Y +KIWLVG+GLTEEEQ KA +
Sbjct: 467 ALCQRGIQVATFREDEYEKLNKKLPNTECGSKLLLSKNYSEKIWLVGDGLTEEEQKKASK 526

Query: 127 GTMFVPFSQFPPAKKRRKDCTYHLTPAMATPAALENVDSCENWLPRRVMSAWRIGGIVHA 186
           GT+F+PFSQFPP K+ RKDC YH TPAM +P + ENVDSCENWLPRR MSAWR+ GI+HA
Sbjct: 527 GTLFIPFSQFPP-KRLRKDCFYHTTPAMMSPKSFENVDSCENWLPRRAMSAWRVAGILHA 585

Query: 187 LEGWNEHECGYTISNVDTVWDAALRHGFVPLTIPT 221
           LEGWN HECGYT+ +++ +W+A+L+HGF PL IP+
Sbjct: 586 LEGWNVHECGYTMFDIEKIWEASLQHGFRPLLIPS 620

Length = 620

>gnl\|CDD\|192933 pfam12076, Wax2_C, WAX2 C-terminal domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		223
PLN02869		620	fatty aldehyde decarbonylase	100.0
PF12076		164	Wax2_C: WAX2 C-terminal domain; InterPro: IPR02194	100.0
PRK14982		340	acyl-ACP reductase; Provisional	98.79
PRK05867		253	short chain dehydrogenase; Provisional	95.15
PRK06924		251	short chain dehydrogenase; Provisional	95.08
PRK07454		241	short chain dehydrogenase; Provisional	95.08
PF13460		183	NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X	95.07
PRK12825		249	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	94.75
PRK12429		258	3-hydroxybutyrate dehydrogenase; Provisional	94.66
TIGR01963		255	PHB_DH 3-hydroxybutyrate dehydrogenase. This model	94.5
PRK07523		255	gluconate 5-dehydrogenase; Provisional	94.48
cd01078		194	NAD_bind_H4MPT_DH NADP binding domain of methylene	94.46
PRK06482		276	short chain dehydrogenase; Provisional	94.44
PRK07890		258	short chain dehydrogenase; Provisional	94.41
PRK05653		246	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	94.37
PRK05557		248	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	94.34
PRK06949		258	short chain dehydrogenase; Provisional	94.27
PRK07478		254	short chain dehydrogenase; Provisional	94.25
COG4221		246	Short-chain alcohol dehydrogenase of unknown speci	94.15
PRK06124		256	gluconate 5-dehydrogenase; Provisional	94.13
PRK08063		250	enoyl-(acyl carrier protein) reductase; Provisiona	94.07
KOG1014		312	consensus 17 beta-hydroxysteroid dehydrogenase typ	94.02
COG5322		351	Predicted dehydrogenase [General function predicti	94.0
TIGR01832		248	kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod	93.9
PRK12826		251	3-ketoacyl-(acyl-carrier-protein) reductase; Revie	93.83
PRK08265		261	short chain dehydrogenase; Provisional	93.78
PRK06947		248	glucose-1-dehydrogenase; Provisional	93.63
PRK06194		287	hypothetical protein; Provisional	93.62
PRK09186		256	flagellin modification protein A; Provisional	93.52
PRK12481		251	2-deoxy-D-gluconate 3-dehydrogenase; Provisional	93.47
PRK06935		258	2-deoxy-D-gluconate 3-dehydrogenase; Provisional	93.45
PRK09291		257	short chain dehydrogenase; Provisional	93.32
COG0300		265	DltE Short-chain dehydrogenases of various substra	93.28
PRK08643		256	acetoin reductase; Validated	93.23
PRK08085		254	gluconate 5-dehydrogenase; Provisional	93.22
PRK07063		260	short chain dehydrogenase; Provisional	93.22
PRK12939		250	short chain dehydrogenase; Provisional	93.14
PRK07577		234	short chain dehydrogenase; Provisional	93.12
PRK07774		250	short chain dehydrogenase; Provisional	93.07
PRK06196		315	oxidoreductase; Provisional	93.04
PRK08213		259	gluconate 5-dehydrogenase; Provisional	93.02
PRK05854		313	short chain dehydrogenase; Provisional	93.01
PRK06841		255	short chain dehydrogenase; Provisional	93.01
KOG1208		314	consensus Dehydrogenases with different specificit	92.98
PRK05993		277	short chain dehydrogenase; Provisional	92.94
PRK08264		238	short chain dehydrogenase; Validated	92.9
PRK06179		270	short chain dehydrogenase; Provisional	92.82
PRK08340		259	glucose-1-dehydrogenase; Provisional	92.75
PRK07097		265	gluconate 5-dehydrogenase; Provisional	92.69
PLN02780		320	ketoreductase/ oxidoreductase	92.52
PRK07109		334	short chain dehydrogenase; Provisional	92.5
PRK06182		273	short chain dehydrogenase; Validated	92.5
PRK07806		248	short chain dehydrogenase; Provisional	92.46
PRK08177		225	short chain dehydrogenase; Provisional	92.39
PRK12742		237	oxidoreductase; Provisional	92.37
PRK07825		273	short chain dehydrogenase; Provisional	92.33
PRK07062		265	short chain dehydrogenase; Provisional	92.31
PRK05884		223	short chain dehydrogenase; Provisional	92.3
TIGR02415		254	23BDH acetoin reductases. One member of this famil	92.26
TIGR03325		262	BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro	92.22
PLN02662		322	cinnamyl-alcohol dehydrogenase family protein	92.21
PRK05876		275	short chain dehydrogenase; Provisional	92.2
PRK06077		252	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	92.18
PRK06483		236	dihydromonapterin reductase; Provisional	92.17
PRK06180		277	short chain dehydrogenase; Provisional	92.12
PRK08589		272	short chain dehydrogenase; Validated	92.04
PRK12827		249	short chain dehydrogenase; Provisional	92.03
PRK06197		306	short chain dehydrogenase; Provisional	92.02
PRK08993		253	2-deoxy-D-gluconate 3-dehydrogenase; Validated	92.0
PRK12824		245	acetoacetyl-CoA reductase; Provisional	91.97
PRK12823		260	benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat	91.96
PLN02986		322	cinnamyl-alcohol dehydrogenase family protein	91.91
PRK07856		252	short chain dehydrogenase; Provisional	91.9
PRK06398		258	aldose dehydrogenase; Validated	91.9
PRK09135		249	pteridine reductase; Provisional	91.88
PRK12829		264	short chain dehydrogenase; Provisional	91.84
PRK05650		270	short chain dehydrogenase; Provisional	91.77
PF00106		167	adh_short: short chain dehydrogenase alcohol dehyd	91.74
PRK06200		263	2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog	91.66
PRK05717		255	oxidoreductase; Validated	91.66
PRK07102		243	short chain dehydrogenase; Provisional	91.59
CHL00194		317	ycf39 Ycf39; Provisional	91.58
PRK07231		251	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	91.57
PRK08339		263	short chain dehydrogenase; Provisional	91.52
PRK07024		257	short chain dehydrogenase; Provisional	91.51
PRK06523		260	short chain dehydrogenase; Provisional	91.49
PRK05786		238	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	91.43
PRK06500		249	short chain dehydrogenase; Provisional	91.34
PRK05872		296	short chain dehydrogenase; Provisional	91.29
PRK06101		240	short chain dehydrogenase; Provisional	91.21
PRK08017		256	oxidoreductase; Provisional	91.18
PRK08936		261	glucose-1-dehydrogenase; Provisional	91.11
PRK05866		293	short chain dehydrogenase; Provisional	91.07
PRK08226		263	short chain dehydrogenase; Provisional	91.04
TIGR01746		367	Thioester-redct thioester reductase domain. It has	90.96
PRK08277		278	D-mannonate oxidoreductase; Provisional	90.9
PRK08220		252	2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated	90.71
PRK13394		262	3-hydroxybutyrate dehydrogenase; Provisional	90.7
PRK07023		243	short chain dehydrogenase; Provisional	90.69
PRK08267		260	short chain dehydrogenase; Provisional	90.6
PRK07326		237	short chain dehydrogenase; Provisional	90.5
PRK06057		255	short chain dehydrogenase; Provisional	90.45
PRK08251		248	short chain dehydrogenase; Provisional	90.44
PRK12384		259	sorbitol-6-phosphate dehydrogenase; Provisional	90.43
PRK08945		247	putative oxoacyl-(acyl carrier protein) reductase;	90.43
PRK06914		280	short chain dehydrogenase; Provisional	90.43
PRK12937		245	short chain dehydrogenase; Provisional	90.33
PRK07814		263	short chain dehydrogenase; Provisional	90.32
PRK07060		245	short chain dehydrogenase; Provisional	90.31
PRK09134		258	short chain dehydrogenase; Provisional	90.26
PRK06079		252	enoyl-(acyl carrier protein) reductase; Provisiona	90.26
PLN02253		280	xanthoxin dehydrogenase	90.25
TIGR03206		250	benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr	90.21
PRK07677		252	short chain dehydrogenase; Provisional	90.2
PRK06953		222	short chain dehydrogenase; Provisional	90.15
PRK08263		275	short chain dehydrogenase; Provisional	90.12
PRK08862		227	short chain dehydrogenase; Provisional	90.12
PRK07985		294	oxidoreductase; Provisional	90.08
PRK12938		246	acetyacetyl-CoA reductase; Provisional	89.96
PRK08416		260	7-alpha-hydroxysteroid dehydrogenase; Provisional	89.91
PRK07069		251	short chain dehydrogenase; Validated	89.9
PRK09072		263	short chain dehydrogenase; Provisional	89.89
PRK05565		247	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	89.84
PRK06463		255	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	89.82
PRK12745		256	3-ketoacyl-(acyl-carrier-protein) reductase; Provi	89.78
PRK06114		254	short chain dehydrogenase; Provisional	89.73
PRK07067		257	sorbitol dehydrogenase; Provisional	89.68
PRK12936		245	3-ketoacyl-(acyl-carrier-protein) reductase NodG;	89.65
PRK08703		239	short chain dehydrogenase; Provisional	89.65
PRK07074		257	short chain dehydrogenase; Provisional	89.58
PRK07889		256	enoyl-(acyl carrier protein) reductase; Provisiona	89.57
PRK12828		239	short chain dehydrogenase; Provisional	89.55
PRK10538		248	malonic semialdehyde reductase; Provisional	89.54
PRK05875		276	short chain dehydrogenase; Provisional	89.52
PRK07035		252	short chain dehydrogenase; Provisional	89.4
PRK07576		264	short chain dehydrogenase; Provisional	89.38
TIGR01831		239	fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas	89.34
PRK06125		259	short chain dehydrogenase; Provisional	89.29
PRK07453		322	protochlorophyllide oxidoreductase; Validated	89.08
PRK06139		330	short chain dehydrogenase; Provisional	89.08
TIGR03649		285	ergot_EASG ergot alkaloid biosynthesis protein, AF	89.04
PLN03209		576	translocon at the inner envelope of chloroplast su	88.75
PRK06181		263	short chain dehydrogenase; Provisional	88.75
PRK08628		258	short chain dehydrogenase; Provisional	88.71
PRK12746		254	short chain dehydrogenase; Provisional	88.7
PRK05693		274	short chain dehydrogenase; Provisional	88.68
PRK08642		253	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	88.64
PLN00141		251	Tic62-NAD(P)-related group II protein; Provisional	88.6
PRK06484		520	short chain dehydrogenase; Validated	88.35
PRK06138		252	short chain dehydrogenase; Provisional	88.31
PRK06171		266	sorbitol-6-phosphate 2-dehydrogenase; Provisional	88.08
PRK06128		300	oxidoreductase; Provisional	88.04
PRK07666		239	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	88.01
COG1028		251	FabG Dehydrogenases with different specificities (	87.95
PRK12743		256	oxidoreductase; Provisional	87.95
PRK06550		235	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	87.86
PRK08594		257	enoyl-(acyl carrier protein) reductase; Provisiona	87.78
PLN02583		297	cinnamoyl-CoA reductase	87.74
TIGR01830		239	3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re	87.59
PRK07201		657	short chain dehydrogenase; Provisional	87.55
TIGR02685		267	pter_reduc_Leis pteridine reductase. Pteridine red	87.52
PRK12747		252	short chain dehydrogenase; Provisional	87.42
PLN00198		338	anthocyanidin reductase; Provisional	87.33
PRK06113		255	7-alpha-hydroxysteroid dehydrogenase; Validated	87.26
PRK06505		271	enoyl-(acyl carrier protein) reductase; Provisiona	87.07
PRK09242		257	tropinone reductase; Provisional	87.07
PRK12935		247	acetoacetyl-CoA reductase; Provisional	87.05
PRK07832		272	short chain dehydrogenase; Provisional	87.02
PRK12744		257	short chain dehydrogenase; Provisional	86.93
PF00258		143	Flavodoxin_1: Flavodoxin; InterPro: IPR008254 This	86.91
PRK06198		260	short chain dehydrogenase; Provisional	86.9
PRK07533		258	enoyl-(acyl carrier protein) reductase; Provisiona	86.57
PRK08303		305	short chain dehydrogenase; Provisional	86.54
PLN02695		370	GDP-D-mannose-3',5'-epimerase	86.48
PRK07792		306	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	86.23
PRK06172		253	short chain dehydrogenase; Provisional	86.13
PRK07041		230	short chain dehydrogenase; Provisional	86.1
PRK06701		290	short chain dehydrogenase; Provisional	85.94
PRK09009		235	C factor cell-cell signaling protein; Provisional	85.89
TIGR01289		314	LPOR light-dependent protochlorophyllide reductase	85.59
PRK12367		245	short chain dehydrogenase; Provisional	85.47
KOG1205		282	consensus Predicted dehydrogenase [Secondary metab	85.42
PLN02730		303	enoyl-[acyl-carrier-protein] reductase	85.19
PRK08217		253	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	85.15
PRK07370		258	enoyl-(acyl carrier protein) reductase; Validated	85.13
PRK07904		253	short chain dehydrogenase; Provisional	85.1
PRK09730		247	putative NAD(P)-binding oxidoreductase; Provisiona	85.1
PRK07831		262	short chain dehydrogenase; Provisional	85.07
PRK06123		248	short chain dehydrogenase; Provisional	85.01
PRK08159		272	enoyl-(acyl carrier protein) reductase; Provisiona	84.66
COG0451		314	WcaG Nucleoside-diphosphate-sugar epimerases [Cell	84.57
PRK09496		453	trkA potassium transporter peripheral membrane com	84.43
PRK06484		520	short chain dehydrogenase; Validated	84.34
PRK08415		274	enoyl-(acyl carrier protein) reductase; Provisiona	84.23
PRK07424		406	bifunctional sterol desaturase/short chain dehydro	83.97
PRK06300		299	enoyl-(acyl carrier protein) reductase; Provisiona	83.91
PRK06603		260	enoyl-(acyl carrier protein) reductase; Provisiona	83.9
PRK08219		227	short chain dehydrogenase; Provisional	83.89
COG0702		275	Predicted nucleoside-diphosphate-sugar epimerases	83.79
TIGR01829		242	AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy	83.66
PRK08690		261	enoyl-(acyl carrier protein) reductase; Provisiona	83.56
PRK10675		338	UDP-galactose-4-epimerase; Provisional	83.56
PLN02650		351	dihydroflavonol-4-reductase	83.29
TIGR03466		328	HpnA hopanoid-associated sugar epimerase. The sequ	83.27
TIGR01179		328	galE UDP-glucose-4-epimerase. This enzyme intercon	83.21
PRK08278		273	short chain dehydrogenase; Provisional	83.19
PRK07984		262	enoyl-(acyl carrier protein) reductase; Provisiona	83.19
PLN02686		367	cinnamoyl-CoA reductase	83.11
PRK05599		246	hypothetical protein; Provisional	83.06
PLN02214		342	cinnamoyl-CoA reductase	82.79
PRK12548		289	shikimate 5-dehydrogenase; Provisional	82.63
TIGR01500		256	sepiapter_red sepiapterin reductase. This model de	82.52
PLN02896		353	cinnamyl-alcohol dehydrogenase	82.5
PRK06997		260	enoyl-(acyl carrier protein) reductase; Provisiona	82.44
TIGR01181		317	dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This	82.38
PRK05579		399	bifunctional phosphopantothenoylcysteine decarboxy	82.2
PRK06720		169	hypothetical protein; Provisional	82.02
PF05368		233	NmrA: NmrA-like family; InterPro: IPR008030 NmrA i	81.59
PRK12859		256	3-ketoacyl-(acyl-carrier-protein) reductase; Provi	81.46
PLN02657		390	3,8-divinyl protochlorophyllide a 8-vinyl reductas	81.4
PLN02240		352	UDP-glucose 4-epimerase	80.97
PRK07791		286	short chain dehydrogenase; Provisional	80.97
PRK10217		355	dTDP-glucose 4,6-dehydratase; Provisional	80.65
KOG0725		270	consensus Reductases with broad range of substrate	80.32

>PLN02869 fatty aldehyde decarbonylase	Back alignment and domain information

Probab=100.00  E-value=9.1e-110  Score=803.07  Aligned_cols=216  Identities=67%  Similarity=1.170  Sum_probs=211.0

Q ss_pred             cccccccccccceeeEeecCCceEEEecCCceeeeeeeccCCCCCceEEEecccchHHHHHHHHHHhcCcEEEecchhHH
Q 041887            4 INYQGEELNRYGGLFVHKNPELKIKVVDGSSLAVAVLTNSIPDGTTQVVIRGILTKVAYATAFALCQKGIQVVTLREDEH   83 (223)
Q Consensus         4 ~LNq~e~LN~~Gelyv~k~P~LkvrvVdGssLaaAvVlnsIP~gt~qV~L~G~~sKva~aiA~aLC~rgvqV~~~~~~~y   83 (223)
                      +|||||+|||||||||+|||+||||||||||||||||||+||+||+||||||++||||||||+|||+|||||+++++|||
T Consensus       404 ~LNk~~~LN~~G~l~v~k~p~L~vrvv~G~tLtaAvvln~ip~~~~~vfl~G~~sK~~raia~~lc~r~i~~~t~~~~~~  483 (620)
T PLN02869        404 LLNQGEELNRYGELYIHRNPKLKIKVVDGSSLAVAVVLNSIPKGTTQVLFRGNLSKVAYFIASALCQRGIQVATFREDEY  483 (620)
T ss_pred             hcchhhhhcCCceEeeecCCCcceEEEeCCchHHHHHHHhcCCCCceEEEecCccHHHHHHHHHHHhcCCeEeecCHHHH
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999777999999


Q ss_pred             HHHHhhcCCcccccceeeeccceeeEEEecCCCCHHHhhccCCCceeeeccccCCCccCCCCcccccCCcccCCcccccc
Q 041887           84 EKLIRSFGGKSESKNLLVSRSYCQKIWLVGNGLTEEEQSKAERGTMFVPFSQFPPAKKRRKDCTYHLTPAMATPAALENV  163 (223)
Q Consensus        84 ~~lk~~~~~~~~~~~L~~~~~~~~K~WlVGd~l~~~eQ~~ApkGt~FipfsQfPp~~~~RkDC~Y~~tPAM~~P~~~~n~  163 (223)
                      ++||+++|++++|+||+++|+|+||+||||||+|++||+|||+||+||||||||| +++||||||++||||++||++||+
T Consensus       484 ~~~~~~~~~~~~~~~l~~~~~~~~k~w~vg~~~~~~eq~~A~~gt~f~~~~~~p~-~~~R~dC~Y~~~pam~~p~~~~~~  562 (620)
T PLN02869        484 EKLNKKLPNTECGSKLLLSKNYSEKIWLVGDGLTEEEQKKASKGTLFIPFSQFPP-KRLRKDCFYHTTPAMMSPKSFENV  562 (620)
T ss_pred             HHHHHhccchhhhhhEEEeeccCceeEEecCCCCHHHHhhCCCCCeecccccCCc-hhhhccccccCCccccCChhhccc
Confidence            9999999994499999999999999999999999999999999999999999999 789999999999999999999999


Q ss_pred             hhhhcccccccchheeeccceeeccCCCcccccCccCChHHHHHHHHHcCCccccCC
Q 041887          164 DSCENWLPRRVMSAWRIGGIVHALEGWNEHECGYTISNVDTVWDAALRHGFVPLTIP  220 (223)
Q Consensus       164 ~sCEnwlpRrvmsA~r~aGivHaLEgW~~hEcG~~id~id~vW~AAl~HGF~P~~~~  220 (223)
                      |||||||||||||||||||||||||||++||||.++|+||+||+|||+|||+|+++|
T Consensus       563 ~sce~~l~r~v~~a~~~~givh~legw~~he~g~~v~~id~~W~aal~hgf~p~~~~  619 (620)
T PLN02869        563 DSCENWLPRRAMSAWRVAGILHALEGWNVHECGYTMFDIEKIWEASLQHGFRPLLIP  619 (620)
T ss_pred             chhhccccchhhhHhhhcceeeeecCccccccccccccHHHHHHHHHHcCCccCCCC
Confidence            999999999999999999999999999999999778899999999999999999876

>PF12076 Wax2_C: WAX2 C-terminal domain; InterPro: IPR021940 This presumed domain is functionally uncharacterised	Back alignment and domain information

>PRK14982 acyl-ACP reductase; Provisional	Back alignment and domain information

>PRK05867 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06924 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07454 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B	Back alignment and domain information

>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase	Back alignment and domain information

>PRK07523 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase	Back alignment and domain information

>PRK06482 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07890 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated	Back alignment and domain information

>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated	Back alignment and domain information

>PRK06949 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07478 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only]	Back alignment and domain information

>PRK06124 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism]	Back alignment and domain information

>COG5322 Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase	Back alignment and domain information

>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed	Back alignment and domain information

>PRK08265 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06947 glucose-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK06194 hypothetical protein; Provisional	Back alignment and domain information

>PRK09186 flagellin modification protein A; Provisional	Back alignment and domain information

>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional	Back alignment and domain information

>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional	Back alignment and domain information

>PRK09291 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only]	Back alignment and domain information

>PRK08643 acetoin reductase; Validated	Back alignment and domain information

>PRK08085 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK07063 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12939 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07577 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07774 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06196 oxidoreductase; Provisional	Back alignment and domain information

>PRK08213 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK05854 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06841 short chain dehydrogenase; Provisional	Back alignment and domain information

>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PRK05993 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08264 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK06179 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08340 glucose-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK07097 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PLN02780 ketoreductase/ oxidoreductase	Back alignment and domain information

>PRK07109 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06182 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK07806 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08177 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12742 oxidoreductase; Provisional	Back alignment and domain information

>PRK07825 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07062 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05884 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR02415 23BDH acetoin reductases	Back alignment and domain information

>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase	Back alignment and domain information

>PLN02662 cinnamyl-alcohol dehydrogenase family protein	Back alignment and domain information

>PRK05876 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06483 dihydromonapterin reductase; Provisional	Back alignment and domain information

>PRK06180 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08589 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK12827 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06197 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated	Back alignment and domain information

>PRK12824 acetoacetyl-CoA reductase; Provisional	Back alignment and domain information

>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional	Back alignment and domain information

>PLN02986 cinnamyl-alcohol dehydrogenase family protein	Back alignment and domain information

>PRK07856 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06398 aldose dehydrogenase; Validated	Back alignment and domain information

>PRK09135 pteridine reductase; Provisional	Back alignment and domain information

>PRK12829 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05650 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases	Back alignment and domain information

>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional	Back alignment and domain information

>PRK05717 oxidoreductase; Validated	Back alignment and domain information

>PRK07102 short chain dehydrogenase; Provisional	Back alignment and domain information

>CHL00194 ycf39 Ycf39; Provisional	Back alignment and domain information

>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK08339 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07024 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06523 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06500 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05872 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06101 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08017 oxidoreductase; Provisional	Back alignment and domain information

>PRK08936 glucose-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK05866 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08226 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR01746 Thioester-redct thioester reductase domain	Back alignment and domain information

>PRK08277 D-mannonate oxidoreductase; Provisional	Back alignment and domain information

>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated	Back alignment and domain information

>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>PRK07023 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08267 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07326 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06057 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08251 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK06914 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12937 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07814 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07060 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK09134 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PLN02253 xanthoxin dehydrogenase	Back alignment and domain information

>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase	Back alignment and domain information

>PRK07677 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06953 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08263 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08862 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07985 oxidoreductase; Provisional	Back alignment and domain information

>PRK12938 acetyacetyl-CoA reductase; Provisional	Back alignment and domain information

>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional	Back alignment and domain information

>PRK07069 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK09072 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06114 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07067 sorbitol dehydrogenase; Provisional	Back alignment and domain information

>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed	Back alignment and domain information

>PRK08703 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07074 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK12828 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK10538 malonic semialdehyde reductase; Provisional	Back alignment and domain information

>PRK05875 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07035 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07576 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative	Back alignment and domain information

>PRK06125 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07453 protochlorophyllide oxidoreductase; Validated	Back alignment and domain information

>PRK06139 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family	Back alignment and domain information

>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional	Back alignment and domain information

>PRK06181 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08628 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12746 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05693 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PLN00141 Tic62-NAD(P)-related group II protein; Provisional	Back alignment and domain information

>PRK06484 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK06138 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional	Back alignment and domain information

>PRK06128 oxidoreductase; Provisional	Back alignment and domain information

>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]	Back alignment and domain information

>PRK12743 oxidoreductase; Provisional	Back alignment and domain information

>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PLN02583 cinnamoyl-CoA reductase	Back alignment and domain information

>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase	Back alignment and domain information

>PRK07201 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR02685 pter_reduc_Leis pteridine reductase	Back alignment and domain information

>PRK12747 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN00198 anthocyanidin reductase; Provisional	Back alignment and domain information

>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated	Back alignment and domain information

>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK09242 tropinone reductase; Provisional	Back alignment and domain information

>PRK12935 acetoacetyl-CoA reductase; Provisional	Back alignment and domain information

>PRK07832 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12744 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF00258 Flavodoxin_1: Flavodoxin; InterPro: IPR008254 This domain is found in a number of proteins including flavodoxin and nitric-oxide synthase	Back alignment and domain information

>PRK06198 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK08303 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02695 GDP-D-mannose-3',5'-epimerase	Back alignment and domain information

>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06172 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07041 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06701 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK09009 C factor cell-cell signaling protein; Provisional	Back alignment and domain information

>TIGR01289 LPOR light-dependent protochlorophyllide reductase	Back alignment and domain information

>PRK12367 short chain dehydrogenase; Provisional	Back alignment and domain information

>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PLN02730 enoyl-[acyl-carrier-protein] reductase	Back alignment and domain information

>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK07370 enoyl-(acyl carrier protein) reductase; Validated	Back alignment and domain information

>PRK07904 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional	Back alignment and domain information

>PRK07831 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06123 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed	Back alignment and domain information

>PRK06484 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated	Back alignment and domain information

>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK08219 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase	Back alignment and domain information

>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK10675 UDP-galactose-4-epimerase; Provisional	Back alignment and domain information

>PLN02650 dihydroflavonol-4-reductase	Back alignment and domain information

>TIGR03466 HpnA hopanoid-associated sugar epimerase	Back alignment and domain information

>TIGR01179 galE UDP-glucose-4-epimerase	Back alignment and domain information

>PRK08278 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PLN02686 cinnamoyl-CoA reductase	Back alignment and domain information

>PRK05599 hypothetical protein; Provisional	Back alignment and domain information

>PLN02214 cinnamoyl-CoA reductase	Back alignment and domain information

>PRK12548 shikimate 5-dehydrogenase; Provisional	Back alignment and domain information

>TIGR01500 sepiapter_red sepiapterin reductase	Back alignment and domain information

>PLN02896 cinnamyl-alcohol dehydrogenase	Back alignment and domain information

>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase	Back alignment and domain information

>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated	Back alignment and domain information

>PRK06720 hypothetical protein; Provisional	Back alignment and domain information

>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA	Back alignment and domain information

>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase	Back alignment and domain information

>PLN02240 UDP-glucose 4-epimerase	Back alignment and domain information

>PRK07791 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional	Back alignment and domain information

>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		223
3qiv_A		253	Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR	95.32
3f9i_A		249	3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto	95.15
3imf_A		257	Short chain dehydrogenase; structural genomics, in	95.13
4iin_A		271	3-ketoacyl-acyl carrier protein reductase (FABG);	94.98
3h7a_A		252	Short chain dehydrogenase; oxidoreductase, PSI-2,	94.9
3rkr_A		262	Short chain oxidoreductase; rossmann fold; HET: NA	94.89
2cfc_A		250	2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor	94.89
3ppi_A		281	3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de	94.86
3guy_A		230	Short-chain dehydrogenase/reductase SDR; structura	94.86
3awd_A		260	GOX2181, putative polyol dehydrogenase; oxidoreduc	94.85
3lyl_A		247	3-oxoacyl-(acyl-carrier-protein) reductase; alpha	94.83
3i4f_A		264	3-oxoacyl-[acyl-carrier protein] reductase; struct	94.79
3tox_A		280	Short chain dehydrogenase; structural genomics, PS	94.73
3ucx_A		264	Short chain dehydrogenase; ssgcid, seattle structu	94.69
2jah_A		247	Clavulanic acid dehydrogenase; short-chain dehydro	94.68
3l77_A		235	Short-chain alcohol dehydrogenase; oxidoreductase;	94.68
3tjr_A		301	Short chain dehydrogenase; structural genomics, se	94.63
2ae2_A		260	Protein (tropinone reductase-II); oxidoreductase,	94.6
3n74_A		261	3-ketoacyl-(acyl-carrier-protein) reductase; seatt	94.59
1gee_A		261	Glucose 1-dehydrogenase; short-chain dehydrogenase	94.59
3afn_B		258	Carbonyl reductase; alpha/beta/alpha, rossmann-fol	94.58
1zem_A		262	Xylitol dehydrogenase; rossmann fold, dinucleotide	94.53
3gaf_A		256	7-alpha-hydroxysteroid dehydrogenase; seattle stru	94.48
3i1j_A		247	Oxidoreductase, short chain dehydrogenase/reducta;	94.47
2hq1_A		247	Glucose/ribitol dehydrogenase; CTH-1438, structura	94.47
3o26_A		311	Salutaridine reductase; short chain dehydrogenase/	94.46
3v8b_A		283	Putative dehydrogenase, possibly 3-oxoacyl-[acyl-	94.45
3e8x_A		236	Putative NAD-dependent epimerase/dehydratase; stru	94.4
3osu_A		246	3-oxoacyl-[acyl-carrier-protein] reductase; struct	94.39
3sju_A		279	Keto reductase; short-chain dehydrogenase, oxidore	94.39
2c07_A		285	3-oxoacyl-(acyl-carrier protein) reductase; oxidor	94.38
1fmc_A		255	7 alpha-hydroxysteroid dehydrogenase; short-chain	94.37
2uvd_A		246	3-oxoacyl-(acyl-carrier-protein) reductase; beta-k	94.36
4e3z_A		272	Putative oxidoreductase protein; PSI-biology, stru	94.35
3l6e_A		235	Oxidoreductase, short-chain dehydrogenase/reducta;	94.34
1spx_A		278	Short-chain reductase family member (5L265); paral	94.34
3o38_A		266	Short chain dehydrogenase; tuberculosis, ortholog	94.3
3uf0_A		273	Short-chain dehydrogenase/reductase SDR; gluconate	94.3
2bd0_A		244	Sepiapterin reductase; oxidoreductase; HET: NAP BI	94.27
1yb1_A		272	17-beta-hydroxysteroid dehydrogenase type XI; shor	94.24
2wsb_A		254	Galactitol dehydrogenase; oxidoreductase, SDR, ros	94.24
4eso_A		255	Putative oxidoreductase; NADP, structural genomics	94.23
3pgx_A		280	Carveol dehydrogenase; structural genomics, seattl	94.21
3r1i_A		276	Short-chain type dehydrogenase/reductase; structur	94.16
2ehd_A		234	Oxidoreductase, oxidoreductase, short-chain dehydr	94.14
3dii_A		247	Short-chain dehydrogenase/reductase SDR; SCOR, ros	94.14
2qq5_A		260	DHRS1, dehydrogenase/reductase SDR family member 1	94.13
4iiu_A		267	3-oxoacyl-[acyl-carrier protein] reductase; struct	94.12
4dmm_A		269	3-oxoacyl-[acyl-carrier-protein] reductase; rossma	94.08
1ae1_A		273	Tropinone reductase-I; oxidoreductase, tropane alk	94.08
2pd6_A		264	Estradiol 17-beta-dehydrogenase 8; short-chain deh	94.07
3is3_A		270	17BETA-hydroxysteroid dehydrogenase; short chain d	94.06
3sx2_A		278	Putative 3-ketoacyl-(acyl-carrier-protein) reduct;	94.05
3oid_A		258	Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa	94.04
3svt_A		281	Short-chain type dehydrogenase/reductase; ssgcid,	94.0
1xkq_A		280	Short-chain reductase family member (5D234); parra	93.98
3tfo_A		264	Putative 3-oxoacyl-(acyl-carrier-protein) reducta;	93.92
3v2g_A		271	3-oxoacyl-[acyl-carrier-protein] reductase; struct	93.92
2zat_A		260	Dehydrogenase/reductase SDR family member 4; alpha	93.92
4e6p_A		259	Probable sorbitol dehydrogenase (L-iditol 2-dehyd;	93.9
3nyw_A		250	Putative oxidoreductase; fatty acid synthesis,3-ox	93.89
3tsc_A		277	Putative oxidoreductase; structural genomics, seat	93.89
3rih_A		293	Short chain dehydrogenase or reductase; structural	93.89
1xq1_A		266	Putative tropinone reducatse; structural genomics,	93.87
1cyd_A		244	Carbonyl reductase; short-chain dehydrogenase, oxi	93.85
3rd5_A		291	Mypaa.01249.C; ssgcid, structural genomics, seattl	93.83
1iy8_A		267	Levodione reductase; oxidoreductase; HET: NAD; 1.6	93.8
3ksu_A		262	3-oxoacyl-acyl carrier protein reductase; structur	93.8
1ja9_A		274	4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p	93.79
3f1l_A		252	Uncharacterized oxidoreductase YCIK; E. coli, NADP	93.79
2ph3_A		245	3-oxoacyl-[acyl carrier protein] reductase; TTHA04	93.78
3a28_C		258	L-2.3-butanediol dehydrogenase; chiral substrate r	93.77
1zk4_A		251	R-specific alcohol dehydrogenase; short chain redu	93.77
3pxx_A		287	Carveol dehydrogenase; structural genomics, seattl	93.74
3ioy_A		319	Short-chain dehydrogenase/reductase SDR; structura	93.68
3lf2_A		265	Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross	93.67
3op4_A		248	3-oxoacyl-[acyl-carrier protein] reductase; 3-keto	93.67
3ged_A		247	Short-chain dehydrogenase/reductase SDR; SCOR, ros	93.64
1hdc_A		254	3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi	93.62
3grp_A		266	3-oxoacyl-(acyl carrierprotein) reductase; structu	93.62
2nwq_A		272	Probable short-chain dehydrogenase; oxidoreductase	93.62
2b4q_A		276	Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier	93.59
3ai3_A		263	NADPH-sorbose reductase; rossmann-fold, NADPH-depe	93.58
2a4k_A		263	3-oxoacyl-[acyl carrier protein] reductase; reduct	93.54
4egf_A		266	L-xylulose reductase; structural genomics, ssgcid,	93.5
1vl8_A		267	Gluconate 5-dehydrogenase; TM0441, structural geno	93.49
1yde_A		270	Retinal dehydrogenase/reductase 3; oxidoreductase,	93.48
1o5i_A		249	3-oxoacyl-(acyl carrier protein) reductase; TM1169	93.48
4dry_A		281	3-oxoacyl-[acyl-carrier-protein] reductase; struct	93.47
3zv4_A		281	CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox	93.47
1geg_A		256	Acetoin reductase; SDR family, oxidoreductase; HET	93.46
3ak4_A		263	NADH-dependent quinuclidinone reductase; SDR, (R)-	93.46
4dyv_A		272	Short-chain dehydrogenase/reductase SDR; structura	93.45
3ftp_A		270	3-oxoacyl-[acyl-carrier protein] reductase; ssgcid	93.43
1xu9_A		286	Corticosteroid 11-beta-dehydrogenase, isozyme 1; h	93.42
3rwb_A		247	TPLDH, pyridoxal 4-dehydrogenase; short chain dehy	93.42
1uls_A		245	Putative 3-oxoacyl-acyl carrier protein reductase;	93.41
4dqx_A		277	Probable oxidoreductase protein; structural genomi	93.41
3gvc_A		277	Oxidoreductase, probable short-chain type dehydrog	93.37
1nff_A		260	Putative oxidoreductase RV2002; directed evolution	93.36
3pk0_A		262	Short-chain dehydrogenase/reductase SDR; ssgcid, s	93.34
2bgk_A		278	Rhizome secoisolariciresinol dehydrogenase; oxidor	93.31
1hxh_A		253	3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b	93.3
3cxt_A		291	Dehydrogenase with different specificities; rossma	93.3
3m1a_A		281	Putative dehydrogenase; short, PSI, MCSG, structur	93.29
2z1n_A		260	Dehydrogenase; reductase, SDR, oxidoreductase; 1.8	93.28
3ijr_A		291	Oxidoreductase, short chain dehydrogenase/reducta;	93.28
1edo_A		244	Beta-keto acyl carrier protein reductase; nucleoti	93.23
4fn4_A		254	Short chain dehydrogenase; NADH-binding, rossmann	93.23
2rhc_B		277	Actinorhodin polyketide ketoreductase; oxidoreduct	93.22
3d3w_A		244	L-xylulose reductase; uronate cycle, short-chain d	93.22
4da9_A		280	Short-chain dehydrogenase/reductase; structural ge	93.21
3asu_A		248	Short-chain dehydrogenase/reductase SDR; SDR famil	93.17
2pnf_A		248	3-oxoacyl-[acyl-carrier-protein] reductase; short	93.16
4fgs_A		273	Probable dehydrogenase protein; PSI-biology, nysgr	93.13
3h2s_A		224	Putative NADH-flavin reductase; Q03B84, NESG, LCR1	93.12
1xg5_A		279	ARPG836; short chain dehydrogenase, human, SGC, st	93.11
4ibo_A		271	Gluconate dehydrogenase; enzyme function initiativ	93.09
3tzq_B		271	Short-chain type dehydrogenase/reductase; ssgcid,	93.08
3qvo_A		236	NMRA family protein; structural genomics, PSI-biol	93.06
1mxh_A		276	Pteridine reductase 2; SDR topology, protein-subst	93.05
3uve_A		286	Carveol dehydrogenase ((+)-trans-carveol dehydrog;	93.05
3dhn_A		227	NAD-dependent epimerase/dehydratase; reductase, PF	93.03
3t4x_A		267	Oxidoreductase, short chain dehydrogenase/reducta;	93.03
3ctm_A		279	Carbonyl reductase; alcohol dehydrogenase, short-c	92.99
2gdz_A		267	NAD+-dependent 15-hydroxyprostaglandin dehydrogen;	92.99
3ew7_A		221	LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend	92.94
2o23_A		265	HADH2 protein; HSD17B10, schad, ERAB, type II HADH	92.91
3edm_A		259	Short chain dehydrogenase; structural genomics, ox	92.88
1yxm_A		303	Pecra, peroxisomal trans 2-enoyl COA reductase; pe	92.85
1x1t_A		260	D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S	92.85
1w6u_A		302	2,4-dienoyl-COA reductase, mitochondrial precursor	92.85
3u5t_A		267	3-oxoacyl-[acyl-carrier-protein] reductase; struct	92.84
1h5q_A		265	NADP-dependent mannitol dehydrogenase; oxidoreduct	92.82
3orf_A		251	Dihydropteridine reductase; alpha-beta-alpha sandw	92.79
2d1y_A		256	Hypothetical protein TT0321; strucrtural genomics,	92.78
2dkn_A		255	3-alpha-hydroxysteroid dehydrogenase; oxidoreducta	92.75
3ruf_A		351	WBGU; rossmann fold, UDP-hexose 4-epimerase, isome	92.73
3v2h_A		281	D-beta-hydroxybutyrate dehydrogenase; structural g	92.72
1zmt_A		254	Haloalcohol dehalogenase HHEC; halohydrin dehaloge	92.72
3icc_A		255	Putative 3-oxoacyl-(acyl carrier protein) reducta;	92.71
4imr_A		275	3-oxoacyl-(acyl-carrier-protein) reductase; oxidor	92.68
1hdo_A		206	Biliverdin IX beta reductase; foetal metabolism, H	92.65
3gk3_A		269	Acetoacetyl-COA reductase; acetoacetyl-CO reductas	92.64
1uay_A		242	Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid	92.61
1wma_A		276	Carbonyl reductase [NADPH] 1; oxidoreductase; HET:	92.61
3ek2_A		271	Enoyl-(acyl-carrier-protein) reductase (NADH); ssg	92.61
3r6d_A		221	NAD-dependent epimerase/dehydratase; structural ge	92.56
4fc7_A		277	Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman	92.53
2ekp_A		239	2-deoxy-D-gluconate 3-dehydrogenase; structural ge	92.51
1fjh_A		257	3alpha-hydroxysteroid dehydrogenase/carbonyl reduc	92.46
3tpc_A		257	Short chain alcohol dehydrogenase-related dehydro;	92.44
1u7z_A		226	Coenzyme A biosynthesis bifunctional protein coabc	92.31
1xhl_A		297	Short-chain dehydrogenase/reductase family member	92.3
3t7c_A		299	Carveol dehydrogenase; structural genomics, seattl	92.28
1ooe_A		236	Dihydropteridine reductase; structural genomics, P	92.26
4g81_D		255	Putative hexonate dehydrogenase; enzyme function i	92.24
4fs3_A		256	Enoyl-[acyl-carrier-protein] reductase [NADPH] FA;	92.21
2ag5_A		246	DHRS6, dehydrogenase/reductase (SDR family) member	92.21
3vtz_A		269	Glucose 1-dehydrogenase; rossmann fold, oxidoreduc	92.2
3p19_A		266	BFPVVD8, putative blue fluorescent protein; rossma	92.17
1dhr_A		241	Dihydropteridine reductase; oxidoreductase(acting	92.15
3ezl_A		256	Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA	92.12
2gk4_A		232	Conserved hypothetical protein; alpha-beta-alpha s	92.08
3tl3_A		257	Short-chain type dehydrogenase/reductase; ssgcid,	92.04
3oec_A		317	Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO;	91.98
2fwm_X		250	2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e	91.92
2x9g_A		288	PTR1, pteridine reductase; short chain dehydrogena	91.86
3uce_A		223	Dehydrogenase; rossmann fold, oxidoreductase; HET:	91.85
1uzm_A		247	3-oxoacyl-[acyl-carrier protein] reductase; beta-k	91.84
2ew8_A		249	(S)-1-phenylethanol dehydrogenase; transferase; 2.	91.82
1zmo_A		244	Halohydrin dehalogenase; haloalcohol dehalogenase,	91.72
2nm0_A		253	Probable 3-oxacyl-(acyl-carrier-protein) reductas;	91.62
3nrc_A		280	Enoyl-[acyl-carrier-protein] reductase (NADH); ros	91.53
3un1_A		260	Probable oxidoreductase; structural genomics, PSI-	91.53
2q2v_A		255	Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore	91.48
2dtx_A		264	Glucose 1-dehydrogenase related protein; rossmann	91.39
3gem_A		260	Short chain dehydrogenase; structural genomics, AP	91.32
1yo6_A		250	Putative carbonyl reductase sniffer; tyrosine-depe	91.32
3uxy_A		266	Short-chain dehydrogenase/reductase SDR; structura	91.25
3dqp_A		219	Oxidoreductase YLBE; alpha-beta protein., structur	91.24
1y1p_A		342	ARII, aldehyde reductase II; rossmann fold, short	91.18
2ydy_A		315	Methionine adenosyltransferase 2 subunit beta; oxi	91.16
1g0o_A		283	Trihydroxynaphthalene reductase; protein-NADPH-act	91.08
2bka_A		242	CC3, TAT-interacting protein TIP30; NADPH, PEG600,	91.04
3oig_A		266	Enoyl-[acyl-carrier-protein] reductase [NADH]; fat	91.03
3s55_A		281	Putative short-chain dehydrogenase/reductase; stru	90.99
1oaa_A		259	Sepiapterin reductase; tetrahydrobiopterin, oxidor	90.99
2p4h_X		322	Vestitone reductase; NADPH-dependent reductase, is	90.92
3sc4_A		285	Short chain dehydrogenase (A0QTM2 homolog); ssgcid	90.87
3r3s_A		294	Oxidoreductase; structural genomics, csgid, center	90.87
1id1_A		153	Putative potassium channel protein; RCK domain, E.	90.83
4h15_A		261	Short chain alcohol dehydrogenase-related dehydro;	90.8
2pd4_A		275	Enoyl-[acyl-carrier-protein] reductase [NADH]; ant	90.75
3k31_A		296	Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI	90.73
1rpn_A		335	GDP-mannose 4,6-dehydratase; short-chain dehydroge	90.68
3sc6_A		287	DTDP-4-dehydrorhamnose reductase; RFBD, structural	90.61
3qlj_A		322	Short chain dehydrogenase; structural genomics, se	90.52
3e03_A		274	Short chain dehydrogenase; structural genomics, PS	90.49
2h7i_A		269	Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi	90.49
3ko8_A		312	NAD-dependent epimerase/dehydratase; isomerase, UD	90.39
2pk3_A		321	GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor	90.39
1sby_A		254	Alcohol dehydrogenase; ternary complex, NAD, trifl	90.37
2gn4_A		344	FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann	90.33
1gz6_A		319	Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF	90.33
2wyu_A		261	Enoyl-[acyl carrier protein] reductase; oxidoreduc	90.32
1e7w_A		291	Pteridine reductase; dihydrofolate reductase, shor	90.28
3vps_A		321	TUNA, NAD-dependent epimerase/dehydratase; tunicam	90.27
1qsg_A		265	Enoyl-[acyl-carrier-protein] reductase; enoyl redu	90.25
1xq6_A		253	Unknown protein; structural genomics, protein stru	90.23
3llv_A		141	Exopolyphosphatase-related protein; NAD(P)-binding	90.12
1d7o_A		297	Enoyl-[acyl-carrier protein] reductase (NADH) PRE;	90.07
2p91_A		285	Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD	90.03
2qhx_A		328	Pteridine reductase 1; oxidoreductase, short-chain	89.99
2rh8_A		338	Anthocyanidin reductase; flavonoids, rossmann fold	89.89
2z1m_A		345	GDP-D-mannose dehydratase; short-chain dehydrogena	89.75
4b79_A		242	PA4098, probable short-chain dehydrogenase; oxidor	89.74
3u9l_A		324	3-oxoacyl-[acyl-carrier-protein] reductase; struct	89.72
1orr_A		347	CDP-tyvelose-2-epimerase; rossmann fold, short-cha	89.72
1vl0_A		292	DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s	89.67
3rft_A		267	Uronate dehydrogenase; apoenzyme, rossmann fold, N	89.62
3d7l_A		202	LIN1944 protein; APC89317, structural genomics, PS	89.56
3rku_A		287	Oxidoreductase YMR226C; substrate fingerprint, sho	89.51
3e9n_A		245	Putative short-chain dehydrogenase/reductase; stru	89.43
3enk_A		341	UDP-glucose 4-epimerase; seattle structural genomi	89.41
3grk_A		293	Enoyl-(acyl-carrier-protein) reductase (NADH); ssg	89.19
3kvo_A		346	Hydroxysteroid dehydrogenase-like protein 2; HSDL2	89.19
3gdg_A		267	Probable NADP-dependent mannitol dehydrogenase; ro	89.14
4hp8_A		247	2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi	89.12
3ic5_A		118	Putative saccharopine dehydrogenase; structural ge	89.09
1sny_A		267	Sniffer CG10964-PA; alpha and beta protein, rossma	89.09
2wm3_A		299	NMRA-like family domain containing protein 1; unkn	89.01
3m2p_A		311	UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J	88.87
2gas_A		307	Isoflavone reductase; NADPH-dependent reductase, o	88.74
2a35_A		215	Hypothetical protein PA4017; alpha-beta-alpha sand	88.71
2ptg_A		319	Enoyl-acyl carrier reductase; apicomplexa, enoyl (	88.62
2yut_A		207	Putative short-chain oxidoreductase; alpha and bet	88.61
2q1w_A		333	Putative nucleotide sugar epimerase/ dehydratase;	88.61
1qyd_A		313	Pinoresinol-lariciresinol reductase; NADPH-depende	88.41
3kzv_A		254	Uncharacterized oxidoreductase YIR035C; cytoplasmi	88.35
2c20_A		330	UDP-glucose 4-epimerase; carbohydrate metabolism,	88.33
2o2s_A		315	Enoyl-acyl carrier reductase; enoyl reductase, tri	88.31
4id9_A		347	Short-chain dehydrogenase/reductase; putative dehy	88.3
2p5y_A		311	UDP-glucose 4-epimerase; TTHA0591, structural geno	88.24
1n7h_A		381	GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR,	88.18
1qyc_A		308	Phenylcoumaran benzylic ether reductase PT1; NADPH	88.14
3c1o_A		321	Eugenol synthase; phenylpropene, PIP reductase, sh	88.12
1rkx_A		357	CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD;	88.0
2pzm_A		330	Putative nucleotide sugar epimerase/ dehydratase;	87.96
1t2a_A		375	GDP-mannose 4,6 dehydratase; structural genomics c	87.93
1db3_A		372	GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya	87.73
2b69_A		343	UDP-glucuronate decarboxylase 1; UDP-glucoronic ac	87.69
1ek6_A		348	UDP-galactose 4-epimerase; short-chain dehydrogena	87.68
1lu9_A		287	Methylene tetrahydromethanopterin dehydrogenase; a	87.64
2r6j_A		318	Eugenol synthase 1; phenylpropene, PIP reductase,	87.56
1sb8_A		352	WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN	87.25
1udb_A		338	Epimerase, UDP-galactose-4-epimerase; isomerase; H	87.25
3ay3_A		267	NAD-dependent epimerase/dehydratase; glucuronic ac	87.24
2c29_D		337	Dihydroflavonol 4-reductase; flavonoids, short deh	87.2
4gkb_A		258	3-oxoacyl-[acyl-carrier protein] reductase; putati	87.08
2c5a_A		379	GDP-mannose-3', 5'-epimerase; short chain dehydrat	86.69
3s8m_A		422	Enoyl-ACP reductase; rossmann fold, oxidoreductase	86.68
1e6u_A		321	GDP-fucose synthetase; epimerase/reductase, SDR, R	86.68
3zu3_A		405	Putative reductase YPO4104/Y4119/YP_4011; oxidored	86.63
2x4g_A		342	Nucleoside-diphosphate-sugar epimerase; isomerase;	86.5
3oml_A		613	GH14720P, peroxisomal multifunctional enzyme type	86.49
4e4y_A		244	Short chain dehydrogenase family protein; structur	86.46
3sxp_A		362	ADP-L-glycero-D-mannoheptose-6-epimerase; rossman	86.41
4egb_A		346	DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce	86.13
3slg_A		372	PBGP3 protein; structural genomics, seattle struct	85.95
3st7_A		369	Capsular polysaccharide synthesis enzyme CAP5F; ro	85.81
3ius_A		286	Uncharacterized conserved protein; APC63810, silic	85.69
2bll_A		345	Protein YFBG; decarboxylase, short chain dehydroge	85.57
3i6i_A		346	Putative leucoanthocyanidin reductase 1; rossmann	85.34
3lt0_A		329	Enoyl-ACP reductase; triclosan, triclosan variant,	85.2
1lss_A		140	TRK system potassium uptake protein TRKA homolog;	84.7
3e48_A		289	Putative nucleoside-diphosphate-sugar epimerase; a	84.62
1i24_A		404	Sulfolipid biosynthesis protein SQD1; SDR, short-c	84.36
1oc2_A		348	DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos	84.34
2q1s_A		377	Putative nucleotide sugar epimerase/ dehydratase;	84.28
1jtv_A		327	17 beta-hydroxysteroid dehydrogenase type 1; stero	84.22
3nzo_A		399	UDP-N-acetylglucosamine 4,6-dehydratase; structura	84.05
2x6t_A		357	ADP-L-glycero-D-manno-heptose-6-epimerase; isomera	83.92
3fwz_A		140	Inner membrane protein YBAL; TRKA-N domain, E.coli	83.79
2hun_A		336	336AA long hypothetical DTDP-glucose 4,6-dehydrat;	83.52
1eq2_A		310	ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin	83.39
2jl1_A		287	Triphenylmethane reductase; oxidoreductase, biorem	83.39
1gy8_A		397	UDP-galactose 4-epimerase; oxidoreductase; HET: NA	82.99
1xgk_A		352	Nitrogen metabolite repression regulator NMRA; ros	82.74
4b4o_A		298	Epimerase family protein SDR39U1; isomerase; HET:	82.57
2et6_A		604	(3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox	82.46
1n2s_A		299	DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold	82.35
1kew_A		361	RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo	82.24
2hmt_A		144	YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane	82.16
1nvt_A		287	Shikimate 5'-dehydrogenase; structural genomics, P	82.02
2yy7_A		312	L-threonine dehydrogenase; thermolabIle, flavobact	81.82
2zcu_A		286	Uncharacterized oxidoreductase YTFG; alpha-beta sa	81.68
3fni_A		159	Putative diflavin flavoprotein A 3; alpha-beta pro	81.65
4f6c_A		427	AUSA reductase domain protein; thioester reductase	81.52
3oh8_A		516	Nucleoside-diphosphate sugar epimerase (SULA FAMI;	81.47
3gpi_A		286	NAD-dependent epimerase/dehydratase; structural ge	81.17
3u0b_A		454	Oxidoreductase, short chain dehydrogenase/reducta	80.8
3ehe_A		313	UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC,	80.79
2et6_A		604	(3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox	80.53

>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp}	Back alignment and structure

Probab=95.32  E-value=0.042  Score=44.39  Aligned_cols=43  Identities=21%  Similarity=0.281  Sum_probs=34.3

Q ss_pred             CceEEEecccchHHHHHHHHHHhcCcEEEe--cchhHHHHHHhhc
Q 041887           48 TTQVVIRGILTKVAYATAFALCQKGIQVVT--LREDEHEKLIRSF   90 (223)
Q Consensus        48 t~qV~L~G~~sKva~aiA~aLC~rgvqV~~--~~~~~y~~lk~~~   90 (223)
                      -+-|++||.++-+|+++|..|.++|.+|++  .+.+.-+.+..++
T Consensus         9 ~k~vlITGas~giG~~~a~~l~~~G~~V~~~~r~~~~~~~~~~~~   53 (253)
T 3qiv_A            9 NKVGIVTGSGGGIGQAYAEALAREGAAVVVADINAEAAEAVAKQI   53 (253)
T ss_dssp             TCEEEEETTTSHHHHHHHHHHHHTTCEEEEEESCHHHHHHHHHHH
T ss_pred             CCEEEEECCCChHHHHHHHHHHHCCCEEEEEcCCHHHHHHHHHHH
Confidence            467899999999999999999999999998  3444455555443

PyMOL of 3qiv

>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0	Back alignment and structure

>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str}	Back alignment and structure

>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A	Back alignment and structure

>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris}	Back alignment and structure

>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5}	Back alignment and structure

>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus}	Back alignment and structure

>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium}	Back alignment and structure

>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus}	Back alignment and structure

>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans}	Back alignment and structure

>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2	Back alignment and structure

>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0	Back alignment and structure

>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti}	Back alignment and structure

>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0	Back alignment and structure

>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A*	Back alignment and structure

>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A*	Back alignment and structure

>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp}	Back alignment and structure

>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A*	Back alignment and structure

>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus}	Back alignment and structure

>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A*	Back alignment and structure

>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A*	Back alignment and structure

>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2	Back alignment and structure

>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis}	Back alignment and structure

>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0	Back alignment and structure

>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum}	Back alignment and structure

>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0	Back alignment and structure

>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti}	Back alignment and structure

>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans}	Back alignment and structure

>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A*	Back alignment and structure

>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber}	Back alignment and structure

>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2	Back alignment and structure

>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A*	Back alignment and structure

>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis}	Back alignment and structure

>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli}	Back alignment and structure

>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0	Back alignment and structure

>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis}	Back alignment and structure

>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0	Back alignment and structure

>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2	Back alignment and structure

>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A*	Back alignment and structure

>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A	Back alignment and structure

>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0	Back alignment and structure

>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum}	Back alignment and structure

>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus}	Back alignment and structure

>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens}	Back alignment and structure

>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A*	Back alignment and structure

>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A*	Back alignment and structure

>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2	Back alignment and structure

>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens}	Back alignment and structure

>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A	Back alignment and structure

>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp}	Back alignment and structure

>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A*	Back alignment and structure

>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans}	Back alignment and structure

>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti}	Back alignment and structure

>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti}	Back alignment and structure

>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A*	Back alignment and structure

>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A	Back alignment and structure

>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0	Back alignment and structure

>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus}	Back alignment and structure

>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A	Back alignment and structure

>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2	Back alignment and structure

>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis}	Back alignment and structure

>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2	Back alignment and structure

>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1}	Back alignment and structure

>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2	Back alignment and structure

>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A	Back alignment and structure

>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8}	Back alignment and structure

>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum}	Back alignment and structure

>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A	Back alignment and structure

>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0	Back alignment and structure

>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444}	Back alignment and structure

>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A*	Back alignment and structure

>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E	Back alignment and structure

>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A*	Back alignment and structure

>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A*	Back alignment and structure

>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A	Back alignment and structure

>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa}	Back alignment and structure

>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa}	Back alignment and structure

>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A*	Back alignment and structure

>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis}	Back alignment and structure

>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2	Back alignment and structure

>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2	Back alignment and structure

>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti}	Back alignment and structure

>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A*	Back alignment and structure

>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2	Back alignment and structure

>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens}	Back alignment and structure

>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus}	Back alignment and structure

>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei}	Back alignment and structure

>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ...	Back alignment and structure

>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A*	Back alignment and structure

>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli}	Back alignment and structure

>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis}	Back alignment and structure

>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A*	Back alignment and structure

>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0	Back alignment and structure

>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A*	Back alignment and structure

>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2	Back alignment and structure

>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis}	Back alignment and structure

>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix}	Back alignment and structure

>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A*	Back alignment and structure

>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G	Back alignment and structure

>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius}	Back alignment and structure

>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A*	Back alignment and structure

>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A*	Back alignment and structure

>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti}	Back alignment and structure

>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A*	Back alignment and structure

>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A*	Back alignment and structure

>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli}	Back alignment and structure

>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334}	Back alignment and structure

>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum}	Back alignment and structure

>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0	Back alignment and structure

>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A}	Back alignment and structure

>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A*	Back alignment and structure

>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A*	Back alignment and structure

>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis}	Back alignment and structure

>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis}	Back alignment and structure

>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes}	Back alignment and structure

>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A*	Back alignment and structure

>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str}	Back alignment and structure

>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A*	Back alignment and structure

>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A*	Back alignment and structure

>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti}	Back alignment and structure

>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2	Back alignment and structure

>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum}	Back alignment and structure

>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP}	Back alignment and structure

>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A*	Back alignment and structure

>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti}	Back alignment and structure

>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A*	Back alignment and structure

>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str}	Back alignment and structure

>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum}	Back alignment and structure

>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A*	Back alignment and structure

>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B}	Back alignment and structure

>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A*	Back alignment and structure

>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2	Back alignment and structure

>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A*	Back alignment and structure

>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A*	Back alignment and structure

>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A	Back alignment and structure

>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A*	Back alignment and structure

>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti}	Back alignment and structure

>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A*	Back alignment and structure

>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium}	Back alignment and structure

>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp}	Back alignment and structure

>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A	Back alignment and structure

>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium}	Back alignment and structure

>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus}	Back alignment and structure

>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A*	Back alignment and structure

>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0	Back alignment and structure

>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae}	Back alignment and structure

>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans}	Back alignment and structure

>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile}	Back alignment and structure

>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli}	Back alignment and structure

>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ...	Back alignment and structure

>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus}	Back alignment and structure

>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A	Back alignment and structure

>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A*	Back alignment and structure

>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP}	Back alignment and structure

>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor}	Back alignment and structure

>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A*	Back alignment and structure

>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti}	Back alignment and structure

>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A	Back alignment and structure

>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A	Back alignment and structure

>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV}	Back alignment and structure

>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides}	Back alignment and structure

>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp}	Back alignment and structure

>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A	Back alignment and structure

>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A	Back alignment and structure

>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A*	Back alignment and structure

>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A	Back alignment and structure

>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A*	Back alignment and structure

>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0	Back alignment and structure

>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A*	Back alignment and structure

>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa}	Back alignment and structure

>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile}	Back alignment and structure

>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp}	Back alignment and structure

>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9	Back alignment and structure

>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A*	Back alignment and structure

>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A*	Back alignment and structure

>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A*	Back alignment and structure

>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2	Back alignment and structure

>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0	Back alignment and structure

>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium}	Back alignment and structure

>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV}	Back alignment and structure

>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ...	Back alignment and structure

>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A*	Back alignment and structure

>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus}	Back alignment and structure

>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A*	Back alignment and structure

>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A*	Back alignment and structure

>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A*	Back alignment and structure

>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A*	Back alignment and structure

>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A*	Back alignment and structure

>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis}	Back alignment and structure

>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A*	Back alignment and structure

>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A*	Back alignment and structure

>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus}	Back alignment and structure

>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A*	Back alignment and structure

>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus}	Back alignment and structure

>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2	Back alignment and structure

>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A	Back alignment and structure

>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A*	Back alignment and structure

>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1}	Back alignment and structure

>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti}	Back alignment and structure

>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2	Back alignment and structure

>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2	Back alignment and structure

>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A*	Back alignment and structure

>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua}	Back alignment and structure

>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum}	Back alignment and structure

>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0	Back alignment and structure

>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A*	Back alignment and structure

>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens}	Back alignment and structure

>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A	Back alignment and structure

>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens}	Back alignment and structure

>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi}	Back alignment and structure

>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2	Back alignment and structure

>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A	Back alignment and structure

>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus}	Back alignment and structure

>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa}	Back alignment and structure

>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2	Back alignment and structure

>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella}	Back alignment and structure

>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus}	Back alignment and structure

>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica}	Back alignment and structure

>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2	Back alignment and structure

>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae}	Back alignment and structure

>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis}	Back alignment and structure

>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A*	Back alignment and structure

>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A*	Back alignment and structure

>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A*	Back alignment and structure

>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A*	Back alignment and structure

>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2	Back alignment and structure

>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri}	Back alignment and structure

>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A*	Back alignment and structure

>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A*	Back alignment and structure

>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2	Back alignment and structure

>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A*	Back alignment and structure

>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A*	Back alignment and structure

>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A*	Back alignment and structure

>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A*	Back alignment and structure

>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A*	Back alignment and structure

>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A*	Back alignment and structure

>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens}	Back alignment and structure

>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A*	Back alignment and structure

>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A*	Back alignment and structure

>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A*	Back alignment and structure

>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV}	Back alignment and structure

>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A*	Back alignment and structure

>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A*	Back alignment and structure

>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa}	Back alignment and structure

>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster}	Back alignment and structure

>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp}	Back alignment and structure

>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori}	Back alignment and structure

>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis}	Back alignment and structure

>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei}	Back alignment and structure

>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A	Back alignment and structure

>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3}	Back alignment and structure

>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A	Back alignment and structure

>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A*	Back alignment and structure

>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ...	Back alignment and structure

>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9	Back alignment and structure

>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp}	Back alignment and structure

>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A*	Back alignment and structure

>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A*	Back alignment and structure

>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A*	Back alignment and structure

>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ...	Back alignment and structure

>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A*	Back alignment and structure

>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12}	Back alignment and structure

>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii}	Back alignment and structure

>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2	Back alignment and structure

>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D	Back alignment and structure

>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A*	Back alignment and structure

>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A*	Back alignment and structure

>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens}	Back alignment and structure

>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis}	Back alignment and structure

>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A*	Back alignment and structure

>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A*	Back alignment and structure

>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A*	Back alignment and structure

>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5	Back alignment and structure

>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris}	Back alignment and structure

>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A*	Back alignment and structure

>3fni_A Putative diflavin flavoprotein A 3; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.30A {Nostoc SP} PDB: 2klb_A	Back alignment and structure

>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus}	Back alignment and structure

>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum}	Back alignment and structure

>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT}	Back alignment and structure

>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A	Back alignment and structure

>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0	Back alignment and structure

>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		223
d1ae1a_		258	Tropinone reductase {Jimsonweed (Datura stramonium	95.49
d2c07a1		251	beta-keto acyl carrier protein reductase {Malaria	95.43
d1pr9a_		244	Carbonyl reductase {Human (Homo sapiens) [TaxId: 9	95.37
d1g0oa_		272	1,3,8-trihydroxynaphtalene reductase (THNR, naphto	95.31
d1zema1		260	Xylitol dehydrogenase {Gluconobacter oxydans [TaxI	95.16
d1nffa_		244	Putative oxidoreductase Rv2002 {Mycobacterium tube	95.07
d1q7ba_		243	beta-keto acyl carrier protein reductase {Escheric	95.02
d1xkqa_		272	Hypothetical protein R05D8.7 {Caenorhabditis elega	94.98
d1xu9a_		269	11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom	94.97
d1hxha_		253	3beta/17beta hydroxysteroid dehydrogenase {Comamon	94.92
d1hdca_		254	3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre	94.91
d1xq1a_		259	Tropinone reductase {Thale cress (Arabidopsis thal	94.85
d1bdba_		276	Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps	94.81
d1ydea1		250	Retinal dehydrogenase/reductase 3 {Human (Homo sap	94.81
d2a4ka1		241	beta-keto acyl carrier protein reductase {Thermus	94.81
d1xg5a_		257	Putative dehydrogenase ARPG836 (MGC4172) {Human (H	94.79
d1gega_		255	meso-2,3-butanediol dehydrogenase {Klebsiella pneu	94.78
d1hdoa_		205	Biliverdin IX beta reductase {Human (Homo sapiens)	94.65
d1fmca_		255	7-alpha-hydroxysteroid dehydrogenase {Escherichia	94.62
d2q46a1		252	Hypothetical protein At5g02240 (T7H20_290) {Thale	94.58
d2ae2a_		259	Tropinone reductase {Jimsonweed (Datura stramonium	94.54
d1cyda_		242	Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1	94.52
d1e7wa_		284	Dihydropteridin reductase (pteridine reductase) {L	94.52
d2bd0a1		240	Bacterial sepiapterin reductase {Chlorobium tepidu	94.51
d1k2wa_		256	Sorbitol dehydrogenase {Rhodobacter sphaeroides [T	94.51
d1ulsa_		242	beta-keto acyl carrier protein reductase {Thermus	94.48
d2gdza1		254	15-hydroxyprostaglandin dehydrogenase, PGDH {Human	94.48
d2bgka1		268	Rhizome secoisolariciresinol dehydrogenase {Mayapp	94.46
d1zk4a1		251	R-specific alcohol dehydrogenase {Lactobacillus br	94.28
d1o5ia_		234	beta-keto acyl carrier protein reductase {Thermoto	94.15
d1w6ua_		294	2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H	94.15
d1yxma1		297	Peroxisomal trans 2-enoyl CoA reductase {Human (Ho	94.14
d1e5qa1		182	Saccharopine reductase {Rice blast fungus (Magnapo	94.12
d1uaya_		241	Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t	94.11
d1x1ta1		260	D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas	94.01
d1xhla_		274	Hypothetical protein F25D1.5 {Caenorhabditis elega	93.99
d2o23a1		248	Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho	93.96
d1iy8a_		258	Levodione reductase {Corynebacterium aquaticum [Ta	93.9
d1spxa_		264	Glucose dehydrogenase (5l265) {Nematode (Caenorhab	93.84
d1luaa1		191	Methylene-tetrahydromethanopterin dehydrogenase {M	93.79
d1yb1a_		244	17-beta-hydroxysteroid dehydrogenase type XI {Huma	93.55
d2pd4a1		274	Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2	93.53
d1edoa_		244	beta-keto acyl carrier protein reductase {Oil seed	93.51
d1h5qa_		260	Mannitol dehydrogenase {Mushroom (Agaricus bisporu	93.47
d1mxha_		266	Dihydropteridin reductase (pteridine reductase) {T	93.43
d1qyca_		307	Phenylcoumaran benzylic ether reductase {Loblolly	93.33
d1ja9a_		259	1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl	93.29
d1jaya_		212	Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae	93.12
d1uzma1		237	beta-keto acyl carrier protein reductase {Mycobact	93.07
d1vl8a_		251	Gluconate 5-dehydrogenase {Thermotoga maritima [Ta	92.95
d2hmva1		134	Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}	92.86
d1geea_		261	Glucose dehydrogenase {Bacillus megaterium [TaxId:	92.79
d2rhca1		257	beta-keto acyl carrier protein reductase {Streptom	92.73
d1yo6a1		250	Putative carbonyl reductase sniffer {Caenorhabditi	92.62
d1wmaa1		275	Carbonyl reductase/20beta-hydroxysteroid dehydroge	92.55
d1sbya1		254	Drosophila alcohol dehydrogenase {Fly (Drosophila	92.23
d1dhra_		236	Dihydropteridin reductase (pteridine reductase) {R	92.15
d1rpna_		321	GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos	92.06
d1ooea_		235	Dihydropteridin reductase (pteridine reductase) {N	91.74
d2ew8a1		247	(s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb	91.63
d2d1ya1		248	Hypothetical protein TTHA0369 {Thermus thermophilu	91.6
d2ag5a1		245	Dehydrogenase/reductase SDR family member 6, DHRS6	91.47
d1ulua_		256	Enoyl-ACP reductase {Thermus thermophilus [TaxId:	91.09
d1oaaa_		259	Sepiapterin reductase {Mouse (Mus musculus) [TaxId	90.73
d1fjha_		257	3-alpha-hydroxysteroid dehydrogenase {Comamonas te	90.67
d1zmta1		252	Halohydrin dehalogenase HheC {Agrobacterium tumefa	90.66
d2h7ma1		268	Enoyl-ACP reductase {Mycobacterium tuberculosis, T	90.5
d1sb8a_		341	UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo	90.18
d1qsga_		258	Enoyl-ACP reductase {Escherichia coli [TaxId: 562]	89.99
d2fr1a1		259	Erythromycin synthase, eryAI, 1st ketoreductase mo	89.59
d1qyda_		312	Pinoresinol-lariciresinol reductase {Giant arborvi	89.59
d1snya_		248	Carbonyl reductase sniffer {Fruit fly (Drosophila	89.27
d1gz6a_		302	(3R)-hydroxyacyl-CoA dehydrogenase domain of estra	88.84
d1lssa_		132	Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax	88.72
d1d7oa_		297	Enoyl-ACP reductase {Oil seed rape (Brassica napus	87.82
d1vmea1		148	ROO-like flavoprotein TM0755, C-terminal domain {T	87.67
d1orra_		338	CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId:	87.6
d2b69a1		312	UDP-glucuronate decarboxylase 1 {Human (Homo sapie	87.59
d1e6ua_		315	GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (	87.29
d1e5da1		152	Rubredoxin oxygen:oxidoreductase (ROO), C-terminal	86.86
d1rkxa_		356	CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc	85.93
d1n7ha_		339	GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop	85.89
d1y1pa1		342	Aldehyde reductase II {Sporobolomyces salmonicolor	85.01
d1jtva_		285	Human estrogenic 17beta-hydroxysteroid dehydrogena	84.52
d1ycga1		149	Nitric oxide reductase C-terminal domain {Moorella	84.19
d1i24a_		393	Sulfolipid biosynthesis protein SQD1 {Thale cress	83.96
d2a35a1		212	Hypothetical protein PA4017 {Pseudomonas aeruginos	83.75
d1npya1		167	Shikimate 5-dehydrogenase-like protein HI0607 {Hae	83.49
d1vl0a_		281	DTDP-4-dehydrorhamnose reductase RfbD {Clostridium	82.77
d1xgka_		350	Negative transcriptional regulator NmrA {Aspergill	81.83
d2bkaa1		232	TAT-interacting protein TIP30 {Human (Homo sapiens	80.4
d2c5aa1		363	GDP-mannose-3', 5'-epimerase {Thale cress (Arabido	80.36

>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Tropinone reductase
species: Jimsonweed (Datura stramonium), I [TaxId: 4076]

Probab=95.49  E-value=0.014  Score=47.36  Aligned_cols=42  Identities=24%  Similarity=0.328  Sum_probs=33.8

Q ss_pred             ceEEEecccchHHHHHHHHHHhcCcEEEec--chhHHHHHHhhc
Q 041887           49 TQVVIRGILTKVAYATAFALCQKGIQVVTL--REDEHEKLIRSF   90 (223)
Q Consensus        49 ~qV~L~G~~sKva~aiA~aLC~rgvqV~~~--~~~~y~~lk~~~   90 (223)
                      |.||+||.++=+|+|||..|.++|.+|+++  ++++-+++.++.
T Consensus         7 K~alITGas~GIG~aia~~la~~G~~V~i~~r~~~~l~~~~~~~   50 (258)
T d1ae1a_           7 TTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIW   50 (258)
T ss_dssp             CEEEEESCSSHHHHHHHHHHHHTTCEEEEEESCHHHHHHHHHHH
T ss_pred             CEEEEeCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH
Confidence            578999999999999999999999999993  344445554443

PyMOL of d1ae1a_

>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}	Back information, alignment and structure

>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]}	Back information, alignment and structure

>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]}	Back information, alignment and structure

>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]}	Back information, alignment and structure

>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]}	Back information, alignment and structure

>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]}	Back information, alignment and structure

>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]}	Back information, alignment and structure

>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]}	Back information, alignment and structure

>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]}	Back information, alignment and structure

>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]}	Back information, alignment and structure

>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]}	Back information, alignment and structure

>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]}	Back information, alignment and structure

>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]}	Back information, alignment and structure

>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]}	Back information, alignment and structure

>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]}	Back information, alignment and structure

>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]}	Back information, alignment and structure

>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]}	Back information, alignment and structure

>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]}	Back information, alignment and structure

>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]}	Back information, alignment and structure

>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]}	Back information, alignment and structure

>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]}	Back information, alignment and structure

>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]}	Back information, alignment and structure

>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}	Back information, alignment and structure

>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]}	Back information, alignment and structure

>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]}	Back information, alignment and structure

>d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]}	Back information, alignment and structure

>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]}	Back information, alignment and structure

>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]}	Back information, alignment and structure

>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]}	Back information, alignment and structure

>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]}	Back information, alignment and structure

>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]}	Back information, alignment and structure

>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]}	Back information, alignment and structure

>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure