Citrus Sinensis ID: 041908


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880---
MGRYLIIFKFSLWVAIAFVQMHGLKSCLDNERIGLLEIKTFIKSVSDMQFADAILVSWVDNRTSDCCSWERIKCNVTTANYNNNGSLKQLKILNIGFNSFSESLVPLLTSLTSLTSLFLEGNNLGVGFKPMKVLPNLRNLEVLDLSGNGLIGSLTMQGEKLELLNNKCREMNARICELKNLVELNLSWNKLDGSLPQCLSNLTYLRVLDLTSNQLSGNLPISVFANLTSLEYLSLSGNNFQGSFSLSVLANHSRLEVLQISRLQIETENFPWLPRFQLKVLNLRRCNISGTIPSFLQYQYDLRYIDLSHNNLAGTFPTWLLQNNTKLEFLFLFNNFLKGLLHLPDSKRDLLHLVISNNNFIGMLPDNFGMILPELVYLDMSQNSFEGSIPPSMGYTVRLLFLDLSSNNFSGELPKQFLTGCVSLAFMNVSHNYFGGQIFPKYMSMTQLAWLYLNDNQFTGRLEEGLLNAPSLHILDVSNNMLSGQLPHWVGNFSNLDVLLMSRNSLEGDVSVPLSNLQVARILDISENKLYGPLEFSFNHSSSLWHLFLHNNSLNGSIPSALFQSSQLMTLDLRDNEFSGNIPPLINEDSNLRALLLRGNNLQGNIPQQLCHLRKIAIVDISYNLLDGSIPSCFTNIWPWMEEGDPFNGFVFGYTLVVEHFPAISAYYNSTLNLIFSGEDNRELRQRVEVKFMAKNRYESYKGGVLEYMTGLDLSSNELTGEIPSAIGYLQELHALNLSHNHLSGSIPRSFSNLKMIESMDLSYNKLRGQIPLELSELNYLAIFNVSYNDLSGPTPNTKQFANFDESNYRGNLNLCGPAVLKNCSTDLPPPPPMTPAEEDESAIDMVAFNWSFAVSYVTVIVGLLALLFLNSYWHRQWFFLID
ccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEEcccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEcccccccEEccHHHHcccccccEEEccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEcccccccEEcccccccccccEEEccccEEEEEcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccEEEEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccEEEccccccEEcccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHcccccccEEEccccccEEEccccccccccccEEEcccccccccccHHHHHHHHHHHcccccccccccccEEEccccccccccccccEEEEccccHHHHccEEEEEEEEEccccccccccccccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEEcccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEEEEEEHHHHHHccccccccccccc
ccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEcccccccHHHcccccEEEEEcccccccccccHHHHccccccEEEccccccccccccHHHHccccccEEEEcccccccccccHHHHcHHHHHcccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEcccccccccccHHHHHHcccccEEEcccccccccccHHcccccEEEEEEccccccccccHHHHccccccEEEEccccccccccHHHHccccHHHHHHHcccccccccHHHcccccccEEEcccccccccccHHHHHHcccccEEEcccccccccccHHHccccccEEEEEccccccccccHHHHHccccccEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHccHHHHHHHHccccccccccccccccccEEEccccccccccccccccccccEEEEcccccccccccHHHcccccEEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHcccccccHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHEcc
MGRYLIIFKFSLWVAIAFVQMHGLkscldnerigLLEIKTFIKSVSDMQFADAILVSWvdnrtsdccswerikcnvttanynnngslkQLKILNIGFNSFSESLVPLLTSLTSltslflegnnlgvgfkpmkvlpnlrnlevldlsgngligsltMQGEKLELLNNKCREMNARICELKNLVELNLswnkldgslpqclsnltylRVLDltsnqlsgnlpisVFANLTSLEYLslsgnnfqgsfSLSVLANHSRLEVLQISRLQietenfpwlprfqlkvlnlrrcnisgtipsflqyqydlryidlshnnlagtfptwllqnntkLEFLFLFNNFLKGllhlpdskrDLLHLVISNnnfigmlpdnfgmiLPELVYLdmsqnsfegsippsmgyTVRLLFLDlssnnfsgelpkqfLTGCVSLAFMNvshnyfggqifpkymSMTQLAWLYLNDNQFTGRLeegllnapslhildvsnnmlsgqlphwvgnfsNLDVLLMSRnslegdvsvplsnlqVARILdisenklygplefsfnhssSLWHLFLhnnslngsipsalfqssqlmtldlrdnefsgnipplinedSNLRALLLRGnnlqgnipqQLCHLRKIAIVDISynlldgsipscftniwpwmeegdpfngfvFGYTLVVEHFPAISAYYNSTLNLIFSGEDNRELRQRVEVKFMAKNRYESYKGGVLEYMtgldlssneltgeiPSAIGYLQELHALNLshnhlsgsiprsfsnlkMIESMDLSYnklrgqiplelseLNYLAIFNVsyndlsgptpntkqfanfdesnyrgnlnlcgpavlkncstdlpppppmtpaeedesaiDMVAFNWSFAVSYVTVIVGLLALLFLNSYWHRQWFFLID
MGRYLIIFKFSLWVAIAFVQMHGLKSCLDNERIGLLEIKTFIKSVSDMQFADAILVSWVDNRTSDCCSWERIKCNVttanynnngsLKQLKILNIGFNSFSESLVPLLTSLTSLTSLFLEGNNLGVGFKPMKVLPNLRNLEVLDLSGNGLIGSLTMQGEKLELLNNKCREMNARICELKNLVELNLSWNKLDGSLPQCLSNLTYLRVLDLTSNQLSGNLPISVFANLTSLEYLSLSGNNFQGSFSLSVLANHSRLEVLQISRLqietenfpwLPRFQLKVLNLRRCNISGTIPSFLQYQYDLRYIDLSHNNLAGTFPTWLLQNNTKLEFLFLFNNFLKGLLHLPDSKRDLLHLVISNNNFIGMLPDNFGMILPELVYLDMSQNSFEGSIPPSMGYTVRLLFLDLSSNNFSGELPKQFLTGCVSLAFMNVSHNYFGGQIFPKYMSMTQLAWLYLNDNQFTGRLEEGLLNAPSLHILDVSNNMLSGQLPHWVGNFSNLDVLLMSRNSLEGDVSVPLSNLQVARILDISENKLYGPLEFSFNHSSSLWHLFLHNNSLNGSIPSALFQSSQLMTLDLRDNEFSGNIPPLINEDSNLRALLLRGNNLQGNIPQQLCHLRKIAIVDISYNLLDGSIPSCFTNIWPWMEEGDPFNGFVFGYTLVVEHFPAISAYYNSTLNLIFSGEDNRELRQRVEVKfmaknryesykgGVLEYMTGLDLSSNELTGEIPSAIGYLQELHALNLSHNHLSGSIPRSFSNLKMIESMDLSYNKLRGQIPLELSELNYLAIFNVSYNDLSGPTPNTKQFANFDESNYRGNLNLCGPAVLKNCSTDLPPPPPMTPAEEDESAIDMVAFNWSFAVSYVTVIVGLLALLFLNSYWHRQWFFLID
MGRYLIIFKFSLWVAIAFVQMHGLKSCLDNERIGLLEIKTFIKSVSDMQFADAILVSWVDNRTSDCCSWERIKCNVTTANYNNNGSLKQLKILNIGFNSFseslvplltsltsltslflEGNNLGVGFKPMKVLPNLRNLEVLDLSGNGLIGSLTMQGEKLELLNNKCREMNARICELKNLVELNLSWNKLDGSLPQCLSNLTYLRVLDLTSNQLSGNLPISVFANLTSLEYLSLSGNNFQGSFSLSVLANHSRLEVLQISRLQIETENFPWLPRFQLKVLNLRRCNISGTIPSFLQYQYDLRYIDLSHNNLAGTFPTWLLQnntkleflflfnnflkgllhlPDSKRDLLHLVISNNNFIGMLPDNFGMILPELVYLDMSQNSFEGSIPPSMGYTVRllfldlssnnfsGELPKQFLTGCVSLAFMNVSHNYFGGQIFPKYMSMTQLAWLYLNDNQFTGRLEEGLLNAPSLHILDVSNNMLSGQLPHWVGNFSNLDVLLMSRNSLEGDVSVPLSNLQVARILDISENKLYGPLEFSFNHSSSLWHLFLHNNSLNGSIPSALFQSSQLMTLDLRDNEFSGNIPPLINEDSnlralllrgnnlqgnIPQQLCHLRKIAIVDISYNLLDGSIPSCFTNIWPWMEEGDPFNGFVFGYTLVVEHFPAISAYYNSTLNLIFSGEDNRELRQRVEVKFMAKNRYESYKGGVLEYMTGLDLSSNELTGEIPSAIGYLQElhalnlshnhlsGSIPRSFSNLKMIESMDLSYNKLRGQIPLELSELNYLAIFNVSYNDLSGPTPNTKQFANFDESNYRGNLNLCGPAVLKNCSTDLpppppMTPAEEDESAIDMVAFNWSFAVSYVTVIVGLLALLFLNSYWHRQWFFLID
**RYLIIFKFSLWVAIAFVQMHGLKSCLDNERIGLLEIKTFIKSVSDMQFADAILVSWVDNRTSDCCSWERIKCNVTTANYNNNGSLKQLKILNIGFNSFSESLVPLLTSLTSLTSLFLEGNNLGVGFKPMKVLPNLRNLEVLDLSGNGLIGSLTMQGEKLELLNNKCREMNARICELKNLVELNLSWNKLDGSLPQCLSNLTYLRVLDLTSNQLSGNLPISVFANLTSLEYLSLSGNNFQGSFSLSVLANHSRLEVLQISRLQIETENFPWLPRFQLKVLNLRRCNISGTIPSFLQYQYDLRYIDLSHNNLAGTFPTWLLQNNTKLEFLFLFNNFLKGLLHLPDSKRDLLHLVISNNNFIGMLPDNFGMILPELVYLDMSQNSFEGSIPPSMGYTVRLLFLDLSSNNFSGELPKQFLTGCVSLAFMNVSHNYFGGQIFPKYMSMTQLAWLYLNDNQFTGRLEEGLLNAPSLHILDVSNNMLSGQLPHWVGNFSNLDVLLMSRNSLEGDVSVPLSNLQVARILDISENKLYGPLEFSFNHSSSLWHLFLHNNSLNGSIPSALFQSSQLMTLDLRDNEFSGNIPPLINEDSNLRALLLRGNNLQGNIPQQLCHLRKIAIVDISYNLLDGSIPSCFTNIWPWMEEGDPFNGFVFGYTLVVEHFPAISAYYNSTLNLIFSGEDNRELRQRVEVKFMAKNRYESYKGGVLEYMTGLDLSSNELTGEIPSAIGYLQELHALNLSHNHLSGSIPRSFSNLKMIESMDLSYNKLRGQIPLELSELNYLAIFNVSYNDLSG******QFANFDESNYRGNLNLCGPAVLK*********************IDMVAFNWSFAVSYVTVIVGLLALLFLNSYWHRQWFFLI*
MGRYLIIFKFSLWVAIAFVQMHGLKSCLDNERIGLLEIKTFIKSVSDMQFADAILVSWVDNRTSDCCSWERIKCNVTTANYNNNGSLKQLKILNIGFNSFSESLVPLLTSLTSLTSLFLEGNNLGVGFKPMKVLPNLRNLEVLDLSGNGLIGSLTMQGEKLELLNNKCREMNARICELKNLVELNLSWNKLDGSLPQCLSNLTYLRVLDLTSNQLSGNLPISVFANLTSLEYLSLSGNNFQGSFSLSVLANHSRLEVLQISRLQIETENFPWLPRFQLKVLNLRRCNISGTIPSFLQYQYDLRYIDLSHNNLAGTFPTWLLQNNTKLEFLFLFNNFLKGLLHLPDSKRDLLHLVISNNNFIGMLPDNFGMILPELVYLDMSQNSFEGSIPPSMGYTVRLLFLDLSSNNFSGELPKQFLTGCVSLAFMNVSHNYFGGQIFPKYMSMTQLAWLYLNDNQFTGRLEEGLLNAPSLHILDVSNNMLSGQLPHWVGNFSNLDVLLMSRNSLEGDVSVPLSNLQVARILDISENKLYGPLEFSFNHSSSLWHLFLHNNSLNGSIPSALFQSSQLMTLDLRDNEFSGNIPPLINEDSNLRALLLRGNNLQGNIPQQLCHLRKIAIVDISYNLLDGSIPSCFTNIWPW**********VFGYTLVVEHFPAISAYYNSTLNLIFSGEDNRELRQRVEVKFMAKNRYESYKGGVLEYMTGLDLSSNELTGEIPSAIGYLQELHALNLSHNHLSGSIPRSFSNLKMIESMDLSYNKLRGQIPLELSELNYLAIFNVSYNDLSGPTPNTKQFANFDESNYRGNLNLCGPA****************************AFNWSFAVSYVTVIVGLLALLFLNSYWHRQWFFLID
MGRYLIIFKFSLWVAIAFVQMHGLKSCLDNERIGLLEIKTFIKSVSDMQFADAILVSWVDNRTSDCCSWERIKCNVTTANYNNNGSLKQLKILNIGFNSFSESLVPLLTSLTSLTSLFLEGNNLGVGFKPMKVLPNLRNLEVLDLSGNGLIGSLTMQGEKLELLNNKCREMNARICELKNLVELNLSWNKLDGSLPQCLSNLTYLRVLDLTSNQLSGNLPISVFANLTSLEYLSLSGNNFQGSFSLSVLANHSRLEVLQISRLQIETENFPWLPRFQLKVLNLRRCNISGTIPSFLQYQYDLRYIDLSHNNLAGTFPTWLLQNNTKLEFLFLFNNFLKGLLHLPDSKRDLLHLVISNNNFIGMLPDNFGMILPELVYLDMSQNSFEGSIPPSMGYTVRLLFLDLSSNNFSGELPKQFLTGCVSLAFMNVSHNYFGGQIFPKYMSMTQLAWLYLNDNQFTGRLEEGLLNAPSLHILDVSNNMLSGQLPHWVGNFSNLDVLLMSRNSLEGDVSVPLSNLQVARILDISENKLYGPLEFSFNHSSSLWHLFLHNNSLNGSIPSALFQSSQLMTLDLRDNEFSGNIPPLINEDSNLRALLLRGNNLQGNIPQQLCHLRKIAIVDISYNLLDGSIPSCFTNIWPWMEEGDPFNGFVFGYTLVVEHFPAISAYYNSTLNLIFSGEDNRELRQRVEVKFMAKNRYESYKGGVLEYMTGLDLSSNELTGEIPSAIGYLQELHALNLSHNHLSGSIPRSFSNLKMIESMDLSYNKLRGQIPLELSELNYLAIFNVSYNDLSGPTPNTKQFANFDESNYRGNLNLCGPAVLKNCSTDLPPPPPMTPAEEDESAIDMVAFNWSFAVSYVTVIVGLLALLFLNSYWHRQWFFLID
MGRYLIIFKFSLWVAIAFVQMHGLKSCLDNERIGLLEIKTFIKSVSDMQFADAILVSWVDNRTSDCCSWERIKCNVTTANYNNNGSLKQLKILNIGFNSFSESLVPLLTSLTSLTSLFLEGNNLGVGFKPMKVLPNLRNLEVLDLSGNGLIGSLTMQGEKLELLNNKCREMNARICELKNLVELNLSWNKLDGSLPQCLSNLTYLRVLDLTSNQLSGNLPISVFANLTSLEYLSLSGNNFQGSFSLSVLANHSRLEVLQISRLQIETENFPWLPRFQLKVLNLRRCNISGTIPSFLQYQYDLRYIDLSHNNLAGTFPTWLLQNNTKLEFLFLFNNFLKGLLHLPDSKRDLLHLVISNNNFIGMLPDNFGMILPELVYLDMSQNSFEGSIPPSMGYTVRLLFLDLSSNNFSGELPKQFLTGCVSLAFMNVSHNYFGGQIFPKYMSMTQLAWLYLNDNQFTGRLEEGLLNAPSLHILDVSNNMLSGQLPHWVGNFSNLDVLLMSRNSLEGDVSVPLSNLQVARILDISENKLYGPLEFSFNHSSSLWHLFLHNNSLNGSIPSALFQSSQLMTLDLRDNEFSGNIPPLINEDSNLRALLLRGNNLQGNIPQQLCHLRKIAIVDISYNLLDGSIPSCFTNIWPWMEEGDPFNGFVFGYTLVVEHFPAISAYYNSTLNLIFSGEDNRELRQRVEVKFMAKNRYESYKGGVLEYMTGLDLSSNELTGEIPSAIGYLQELHALNLSHNHLSGSIPRSFSNLKMIESMDLSYNKLRGQIPLELSELNYLAIFNVSYNDLSGPTPNTKQFANFDESNYRGNLNLCGPAVLKNC*******************IDMVAFNWSFAVSYVTVIVGLLALLFLNSYWHRQWFFLID
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRYLIIFKFSLWVAIAFVQMHGLKSCLDNERIGLLEIKTFIKSVSDMQFADAILVSWVDNRTSDCCSWERIKCNVTTANYNNNGSLKQLKILNIGFNSFSESLVPLLTSLTSLTSLFLEGNNLGVGFKPMKVLPNLRNLEVLDLSGNGLIGSLTMQGEKLELLNNKCREMNARICELKNLVELNLSWNKLDGSLPQCLSNLTYLRVLDLTSNQLSGNLPISVFANLTSLEYLSLSGNNFQGSFSLSVLANHSRLEVLQISRLQIETENFPWLPRFQLKVLNLRRCNISGTIPSFLQYQYDLRYIDLSHNNLAGTFPTWLLQNNTKLEFLFLFNNFLKGLLHLPDSKRDLLHLVISNNNFIGMLPDNFGMILPELVYLDMSQNSFEGSIPPSMGYTVRLLFLDLSSNNFSGELPKQFLTGCVSLAFMNVSHNYFGGQIFPKYMSMTQLAWLYLNDNQFTGRLEEGLLNAPSLHILDVSNNMLSGQLPHWVGNFSNLDVLLMSRNSLEGDVSVPLSNLQVARILDISENKLYGPLEFSFNHSSSLWHLFLHNNSLNGSIPSALFQSSQLMTLDLRDNEFSGNIPPLINEDSNLRALLLRGNNLQGNIPQQLCHLRKIAIVDISYNLLDGSIPSCFTNIWPWMEEGDPFNGFVFGYTLVVEHFPAISAYYNSTLNLIFSGEDNRELRQRVEVKFMAKNRYESYKGGVLEYMTGLDLSSNELTGEIPSAIGYLQELHALNLSHNHLSGSIPRSFSNLKMIESMDLSYNKLRGQIPLELSELNYLAIFNVSYNDLSGPTPNTKQFANFDESNYRGNLNLCGPAVLKNCSTDLPPPPPMTPAEEDESAIDMVAFNWSFAVSYVTVIVGLLALLFLNSYWHRQWFFLID
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query883 2.2.26 [Sep-21-2011]
C0LGQ5 1249 LRR receptor-like serine/ no no 0.784 0.554 0.300 1e-69
Q9C9H7847 Receptor-like protein 12 no no 0.828 0.864 0.287 4e-69
Q9SHI2 1101 Leucine-rich repeat recep no no 0.707 0.567 0.325 2e-65
Q9FL28 1173 LRR receptor-like serine/ no no 0.810 0.610 0.290 1e-64
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.788 0.555 0.318 3e-64
Q8L899 1207 Systemin receptor SR160 O N/A no 0.800 0.585 0.298 4e-61
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.738 0.540 0.316 8e-61
O22476 1196 Protein BRASSINOSTEROID I no no 0.711 0.525 0.323 3e-58
Q9FZ59 1088 Leucine-rich repeat recep no no 0.694 0.563 0.300 2e-57
C0LGS2 1136 Probable LRR receptor-lik no no 0.674 0.524 0.317 2e-55
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function desciption
 Score =  265 bits (677), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 239/796 (30%), Positives = 378/796 (47%), Gaps = 103/796 (12%)

Query: 98  NSFSESLVPLLTSLTSLTSLFLEGNNLGVGFKPMKVLPNLRNLEVLDLSGNGLIGSLTMQ 157
           +++ E  +P      S  ++F    N+  G  P + L  L NLE+L+L+ N L G     
Sbjct: 200 DNYLEGPIPAELGNCSDLTVFTAAENMLNGTIPAE-LGRLENLEILNLANNSLTG----- 253

Query: 158 GEKLELLNNKCREMNARICELKNLVELNLSWNKLDGSLPQCLSNLTYLRVLDLTSNQLSG 217
                       E+ +++ E+  L  L+L  N+L G +P+ L++L  L+ LDL++N L+G
Sbjct: 254 ------------EIPSQLGEMSQLQYLSLMANQLQGLIPKSLADLGNLQTLDLSANNLTG 301

Query: 218 NLPISVFANLTSLEYLSLSGNNFQGSFSLSVLANHSRLEVLQISRLQIETENFPWLPRFQ 277
            +P   F N++ L  L L+ N+  GS   S+ +N++ LE L +S  Q+            
Sbjct: 302 EIP-EEFWNMSQLLDLVLANNHLSGSLPKSICSNNTNLEQLVLSGTQL------------ 348

Query: 278 LKVLNLRRCNISGTIPSFLQYQYDLRYIDLSHNNLAGTFPTWLLQNNTKLEFLFLFNNFL 337
                      SG IP  L     L+ +DLS+N+LAG+ P  L +   +L  L+L NN L
Sbjct: 349 -----------SGEIPVELSKCQSLKQLDLSNNSLAGSIPEALFEL-VELTDLYLHNNTL 396

Query: 338 KGLLHLPDSKRDLLHLVISNNNFIGMLPDNFGMILPELVYLDMSQNSFEGSIPPSMGYTV 397
           +G L  P          ISN              L  L +L +  N+ EG +P  +    
Sbjct: 397 EGTLS-PS---------ISN--------------LTNLQWLVLYHNNLEGKLPKEISALR 432

Query: 398 RLLFLDLSSNNFSGELPKQFLTGCVSLAFMNVSHNYFGGQIFPKYMSMTQLAWLYLNDNQ 457
           +L  L L  N FSGE+P++ +  C SL  +++  N+F G+I P    + +L  L+L  N+
Sbjct: 433 KLEVLFLYENRFSGEIPQE-IGNCTSLKMIDMFGNHFEGEIPPSIGRLKELNLLHLRQNE 491

Query: 458 FTGRLEEGLLNAPSLHILDVSNNMLSGQLPHWVGNFSNLDVLLMSRNSLEGDVSVPLSNL 517
             G L   L N   L+ILD+++N LSG +P   G    L+ L++  NSL+G++   L +L
Sbjct: 492 LVGGLPASLGNCHQLNILDLADNQLSGSIPSSFGFLKGLEQLMLYNNSLQGNLPDSLISL 551

Query: 518 QVARILDISENKLYGPLEFSFNHSSSLWHLFLHNNSLNGSIPSALFQSSQLMTLDLRDNE 577
           +    +++S N+L G +      SSS     + NN     IP  L  S  L  L L  N+
Sbjct: 552 RNLTRINLSHNRLNGTIH-PLCGSSSYLSFDVTNNGFEDEIPLELGNSQNLDRLRLGKNQ 610

Query: 578 FSGNIPPLINEDSNLRALLLRGNNLQGNIPQQLCHLRKIAIVDISYNLLDGSIPSCFTNI 637
            +G IP  + +   L  L +  N L G IP QL   +K+  +D++ N L G IP      
Sbjct: 611 LTGKIPWTLGKIRELSLLDMSSNALTGTIPLQLVLCKKLTHIDLNNNFLSGPIP------ 664

Query: 638 WPWMEEGDPFNGFVFGYTLVVEHFPAISAYYNSTLNLIFSGEDNR---ELRQRV------ 688
            PW+ +              VE  P  +  +N T  L+ S + N     + Q +      
Sbjct: 665 -PWLGKLSQLGELKLSSNQFVESLP--TELFNCTKLLVLSLDGNSLNGSIPQEIGNLGAL 721

Query: 689 EVKFMAKNRYES---YKGGVLEYMTGLDLSSNELTGEIPSAIGYLQELH-ALNLSHNHLS 744
            V  + KN++        G L  +  L LS N LTGEIP  IG LQ+L  AL+LS+N+ +
Sbjct: 722 NVLNLDKNQFSGSLPQAMGKLSKLYELRLSRNSLTGEIPVEIGQLQDLQSALDLSYNNFT 781

Query: 745 GSIPRSFSNLKMIESMDLSYNKLRGQIPLELSELNYLAIFNVSYNDLSGPTPNTKQFANF 804
           G IP +   L  +E++DLS+N+L G++P  + ++  L   NVS+N+L G     KQF+ +
Sbjct: 782 GDIPSTIGTLSKLETLDLSHNQLTGEVPGSVGDMKSLGYLNVSFNNLGGKL--KKQFSRW 839

Query: 805 DESNYRGNLNLCGPAVLKNCSTDLPPPPPMTPAEEDESAIDMVAFNWSFAVSYVTVIVGL 864
              ++ GN  LCG + L  C+           +   +  +   +     A+S +T I GL
Sbjct: 840 PADSFLGNTGLCG-SPLSRCNR--------VRSNNKQQGLSARSVVIISAISALTAI-GL 889

Query: 865 LALLFLNSYWHRQWFF 880
           + L+    +  R  FF
Sbjct: 890 MILVIALFFKQRHDFF 905




Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query883
358345693 1011 Receptor-like protein kinase [Medicago t 0.947 0.827 0.414 0.0
357468861 1016 Receptor-like protein kinase [Medicago t 0.947 0.823 0.414 0.0
297842171966 leucine-rich repeat family protein [Arab 0.972 0.889 0.406 0.0
15221162965 receptor like protein 15 [Arabidopsis th 0.969 0.887 0.400 0.0
12324907910 putative disease resistance protein; 468 0.942 0.914 0.409 1e-180
358345471933 Receptor kinase [Medicago truncatula] gi 0.959 0.907 0.428 1e-178
186495296 1000 receptor like protein 13 [Arabidopsis th 0.902 0.797 0.437 1e-174
12323814 1068 disease resistance protein, putative; 11 0.902 0.746 0.437 1e-174
12323813951 disease resistance protein, putative; 63 0.963 0.894 0.414 1e-170
12321378 1784 hypothetical protein [Arabidopsis thalia 0.950 0.470 0.428 1e-169
>gi|358345693|ref|XP_003636910.1| Receptor-like protein kinase [Medicago truncatula] gi|355502845|gb|AES84048.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/982 (41%), Positives = 568/982 (57%), Gaps = 145/982 (14%)

Query: 13  WVAIAFVQMHGLKSCLDNERIGLLEIKTFIKSVSDMQFADAILVSWVDNRTSDCCSWERI 72
           +V +  +   G   CL+ ERI LLEIK +  S +   +    L SWVD+R S+CCSW  +
Sbjct: 13  FVTLMLMLTQGCNGCLEKERISLLEIKHYFLSQTGDPYNK--LGSWVDDRDSNCCSWNNV 70

Query: 73  KC-NVTTA----------------NYNNNGSL----KQLKILNIGFNSF----------- 100
           KC N+++                 +   N SL    K+L++L++ +NSF           
Sbjct: 71  KCSNISSGHIIELSIRKLLFDIPFDMKLNVSLFRPFKELRLLDLSYNSFLGWIGNEGFPR 130

Query: 101 --------------SESLVPLLTSLTSLTSLF------------------------LEGN 122
                         + S++P L  LT+LT+L                         L GN
Sbjct: 131 LKRLETLDLSGNYLNSSILPSLKGLTALTTLKLVSNSMENFSAQGFSRSKELEVLDLSGN 190

Query: 123 NLGV-------GFKPMKVL----------------PNLRNLEVLDLSGNGLIGSLTMQG- 158
            L         GF  ++ L                     LE+LDL GN   GSL ++  
Sbjct: 191 RLNCNIITSLHGFTSLRSLILSYNNFNCSLSTLDFAKFSRLELLDLGGNQFTGSLHVEDV 250

Query: 159 ---EKLELLNNKCREMNARICELKNLVELNLSWNKLDGSLPQCLSNLTYLRVLDLTSNQL 215
              + L++L+    +MN  +C  K+LVEL++S N     LP CLSNLT LRVL+L++N  
Sbjct: 251 QHLKNLKMLSLNDNQMNG-LCNFKDLVELDISKNMFSAKLPDCLSNLTNLRVLELSNNLF 309

Query: 216 SGNLPISVFANLTSLEYLSLSGNNFQGSFSLSVLANHSRLEVLQISR-----LQIETENF 270
           SGN P S  +NLTSL YLS  GN  QGSFSLS LANHS LEVL IS      + IETE  
Sbjct: 310 SGNFP-SFISNLTSLAYLSFYGNYMQGSFSLSTLANHSNLEVLYISSKNNIGVDIETEKT 368

Query: 271 PWLPRFQLKVLNLRRCNIS----GTIPSFLQYQYDLRYIDLSHNNLAGTFPT-WLLQNNT 325
            W P+FQLK L +R CN++      IP+FL YQY+L Y+ LS NN+ G+ P+ WL+ N+ 
Sbjct: 369 KWFPKFQLKSLIVRNCNLNKDEGSVIPTFLSYQYNLVYLVLSSNNINGSLPSNWLIHND- 427

Query: 326 KLEFLFLFNNFLKGLLHLPDSKRDLLHLVISNNNFIGMLPDNFGMILPELVYLDMSQNSF 385
                                  D+++L ISNNN  G+LP + G+ LP + YL+ S NSF
Sbjct: 428 -----------------------DMIYLDISNNNLSGLLPKDIGIFLPNVTYLNFSWNSF 464

Query: 386 EGSIPPSMGYTVRLLFLDLSSNNFSGELPKQFLTGCVSLAFMNVSHNYFGGQIFPKYMSM 445
           EG+IP S+G   +L  LD S N+FSGELPKQ  TGC +L ++ +S+N+  G I P++ + 
Sbjct: 465 EGNIPSSIGKMKQLQLLDFSQNHFSGELPKQLATGCDNLQYLKLSNNFLHGNI-PRFCNS 523

Query: 446 TQLAWLYLNDNQFTGRLEEGLLNAPSLHILDVSNNMLSGQLPHWVGNFSNLDVLLMSRNS 505
             +  L+LN+N F+G LE+ L N   L  L +SNN  SG +P  +G FSN+  LLMS+N 
Sbjct: 524 VNMFGLFLNNNNFSGTLEDVLGNNTRLETLSISNNSFSGTIPSSIGMFSNMWALLMSKNQ 583

Query: 506 LEGDVSVPLSNLQVARILDISENKLYGPLEFSFNHSSSLWHLFLHNNSLNGSIPSALFQS 565
           LEG++ + +S++   +ILD+S+NKL G +    +  + L  L+L  N L+GSIP  L++ 
Sbjct: 584 LEGEIPIEISSIWRLQILDLSQNKLNGSIP-PLSGLTLLRFLYLQENGLSGSIPYELYEG 642

Query: 566 SQLMTLDLRDNEFSGNIPPLINEDSNLRALLLRGNNLQGNIPQQLCHLRKIAIVDISYNL 625
            QL  LDLR+N+FSG IP  +++ S LR LLL GNN +G IP QLC L+KI I+D+S N+
Sbjct: 643 FQLQLLDLRENKFSGKIPNWMDKFSELRVLLLGGNNFEGEIPMQLCRLKKINIMDLSRNM 702

Query: 626 LDGSIPSCFTNIWPWMEEGDPFNGFVFGYTLVV--EHFPAISAYYNSTLNLIFSGEDNRE 683
           L+ SIPSCF N+   M +   +   VF  + ++  +H      +++S+L++    E ++ 
Sbjct: 703 LNASIPSCFRNMLFGMRQ---YVDAVFDLSSILYGQHIQDTHYFFDSSLSIDLPLEKDQL 759

Query: 684 LRQ--RVEVKFMAKNRYESYKGGVLEYMTGLDLSSNELTGEIPSAIGYLQELHALNLSHN 741
           +     +EV+F  K+    YKG VLE MTGLDLS N+LTG IPS IG LQ++ ALNLSHN
Sbjct: 760 IEDLLHLEVEFRTKHYEYFYKGKVLENMTGLDLSCNKLTGVIPSQIGDLQQIRALNLSHN 819

Query: 742 HLSGSIPRSFSNLKMIESMDLSYNKLRGQIPLELSELNYLAIFNVSYNDLSGPTPNTKQF 801
           HLSG IP +FSNL  IES+DLSYN L G+IP EL++LN+L+ FNVSYN+LSG  P+  QF
Sbjct: 820 HLSGPIPITFSNLTQIESLDLSYNDLSGKIPNELTQLNFLSTFNVSYNNLSGTPPSIGQF 879

Query: 802 ANFDESNYRGNLNLCGPAVLKNCSTDLPPPPPMT-PAEEDESAIDMVAFNWSFAVSYVTV 860
           ANFDE NYRGN +LCGP + + C    PPP   +   EE+E+ +DM+ F WSF  SY+T+
Sbjct: 880 ANFDEDNYRGNPSLCGPLLSRKCERVEPPPSSQSNDNEEEETGVDMITFYWSFTASYITI 939

Query: 861 IVGLLALLFLNSYWHRQWFFLI 882
           ++  + +L +N  W   WF+ I
Sbjct: 940 LLAFITVLCINPRWRMAWFYYI 961




Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|357468861|ref|XP_003604715.1| Receptor-like protein kinase [Medicago truncatula] gi|355505770|gb|AES86912.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|297842171|ref|XP_002888967.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297334808|gb|EFH65226.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15221162|ref|NP_177559.1| receptor like protein 15 [Arabidopsis thaliana] gi|12323812|gb|AAG51871.1|AC079678_1 disease resistance protein, putative; 1096-4664 [Arabidopsis thaliana] gi|332197443|gb|AEE35564.1| receptor like protein 15 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|12324907|gb|AAG52409.1|AC020579_11 putative disease resistance protein; 46848-50365 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|358345471|ref|XP_003636801.1| Receptor kinase [Medicago truncatula] gi|355502736|gb|AES83939.1| Receptor kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|186495296|ref|NP_177557.2| receptor like protein 13 [Arabidopsis thaliana] gi|332197441|gb|AEE35562.1| receptor like protein 13 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|12323814|gb|AAG51873.1|AC079678_3 disease resistance protein, putative; 11609-15699 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|12323813|gb|AAG51872.1|AC079678_2 disease resistance protein, putative; 6346-10057 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|12321378|gb|AAG50756.1|AC079131_1 hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query883
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.833 0.736 0.396 8.9e-141
TAIR|locus:2019662965 RLP15 "AT1G74190" [Arabidopsis 0.841 0.769 0.392 5.1e-138
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.890 0.882 0.382 9.3e-130
TAIR|locus:20250121083 RLP1 "AT1G07390" [Arabidopsis 0.824 0.672 0.393 1.5e-129
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.831 0.752 0.397 5.2e-129
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.891 0.841 0.354 2.2e-114
TAIR|locus:2155909908 RLP56 "AT5G49290" [Arabidopsis 0.565 0.549 0.386 9.7e-80
TAIR|locus:2078102875 RLP33 "receptor like protein 3 0.828 0.836 0.252 2.4e-62
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.827 0.585 0.283 1.5e-60
TAIR|locus:2096349860 RLP31 "receptor like protein 3 0.720 0.739 0.254 2.2e-47
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1377 (489.8 bits), Expect = 8.9e-141, P = 8.9e-141
 Identities = 303/764 (39%), Positives = 445/764 (58%)

Query:   127 GFKPMKVLPNLRNLEVLDLSGNGLIGSLTMQGEKLELLNNKCREMNARICELKNLVELNL 186
             G  P++ L  LR L+ LDLS N    S+ +QG+       K + ++   C  KN+ EL L
Sbjct:   212 GSIPVRALFALRKLKALDLSDNEFSSSVELQGKFA-----KTKPLSGT-CPWKNMEELKL 265

Query:   187 SWNKLDGSLPQCLSNLTYLRVLDLTSNQLSGNLPISVFANLTSLEYLSLSGNNFQGSFSL 246
             S NKL G  P CL++LT LRVLDL+SNQL+GN+P S  ANL SLEYLSL GNNF+G FSL
Sbjct:   266 SNNKLAGQFPLCLTSLTGLRVLDLSSNQLTGNVP-SALANLESLEYLSLFGNNFEGFFSL 324

Query:   247 SVLANHSRLEVLQI----SRLQIETENFPWLPRFQLKVLNLRRCNISGTIPSFLQYQYDL 302
              +LAN S+L+VL++    + L++E E   W P+FQL V+ LR CN+   +P FL +Q DL
Sbjct:   325 GLLANLSKLKVLRLDSQSNSLEVEFET-SWKPKFQLVVIALRSCNLE-KVPHFLLHQKDL 382

Query:   303 RYIDLSHNNLAGTFPTWLLQXXXXXXXXXXXXXXXXXXXXXPDSKRDLLHLVISNNNFIG 362
              ++DLS N + G FP+WLL+                     P S  +LL L +S N F  
Sbjct:   383 HHVDLSDNQIHGNFPSWLLENNTKLEVLLLQNNSFTSFQL-PKSAHNLLFLNVSVNKFNH 441

Query:   363 MLPDNFGMILPELVYLDMSQNSFEGSIPPSMGYTVRXXXXXXXXXXXXGELPKQFLTGCV 422
             +   NFG ILP LV ++++ N F+G++P S+                 G+LP++FL GC 
Sbjct:   442 LFLQNFGWILPHLVCVNLAYNGFQGNLPSSLDNMKSIEFLDLSHNRFHGKLPRRFLKGCY 501

Query:   423 SLAFMNVSHNYFGGQIFPKYMSMTQLAWLYLNDNQFTGRLEEGLLNAPSLHILDVSNNML 482
             +L  + +SHN   G++FP+  + T+L  + +++N FTG + +G  + PSL++LD+SNN L
Sbjct:   502 NLTILKLSHNKLSGEVFPEAANFTRLWVMSMDNNLFTGNIGKGFRSLPSLNVLDISNNKL 561

Query:   483 SGQLPHWVGNFSNLDVLLMSRNSLEGDVSVPLSNLQVARILDISENKLYGPLEFSFNHSS 542
             +G +P W+G    L  L +S N LEG++   L N+   ++LD+S N+L G +     H S
Sbjct:   562 TGVIPSWIGERQGLFALQLSNNMLEGEIPTSLFNISYLQLLDLSSNRLSGDIP---PHVS 618

Query:   543 SLWH---LFLHNNSLNGSIPSALFQSSQLMTLDLRDNEFSGNIPPLINEDSXXXXXXXXX 599
             S++H   L L NN+L+G IP  L  +  ++ LDLR+N  SGN+P  IN  +         
Sbjct:   619 SIYHGAVLLLQNNNLSGVIPDTLLLN--VIVLDLRNNRLSGNLPEFINTQNISILLLRGN 676

Query:   600 XXXXXXIPQQLCHLRKIAIVDISYNLLDGSIPSCFTNIWPWMEEGDPFNGFVFGYTLVVE 659
                   IP Q C L  I ++D+S N  +GSIPSC +N    + +GD      + Y +   
Sbjct:   677 NFTGQ-IPHQFCSLSNIQLLDLSNNKFNGSIPSCLSNTSFGLRKGDDS----YRYDVPSR 731

Query:   660 HFPAISAYYNSTLNLIFSGEDNRELRQRVEVKFMAKNRYESYKGGVLEYMTGLDLSSNEL 719
                A    Y  +L +I       E   + +++F  K+RY++Y GG L+ + G+DLS NEL
Sbjct:   732 FGTAKDPVYFESLLMIDEFNMVNETNSQTKIEFATKHRYDAYMGGNLKLLFGMDLSENEL 791

Query:   720 TGEIPSAIGYLQEXXXXXXXXXXXXGSIPRSFSNLKMIESMDLSYNKLRGQIPLELSELN 779
             +GEIP  +G L E            G I  SFS LK +ES+DLS+N+L+G IPL+L+++ 
Sbjct:   792 SGEIPVELGGLVELEALNLSHNNLSGVILESFSGLKNVESLDLSFNRLQGPIPLQLTDMI 851

Query:   780 YLAIFNVSYNDLSGPTPNTKQFANFDESNYRGNLNLCGPAVLKNCSTDLXXXXXMTPAEE 839
              LA+FNVSYN+LSG  P  +QF  F+  +Y GN  LCG ++  +C+++          E 
Sbjct:   852 SLAVFNVSYNNLSGIVPQGRQFNTFETQSYFGNPLLCGKSIDISCASNNFHPTD-NGVEA 910

Query:   840 DESAIDMVAFNWSFAVSYVTVIVGLLALLFLNSYWHRQWFFLID 883
             DES +DM +F WSF  +YVT+++G+LA L  +S W R WF+++D
Sbjct:   911 DESTVDMESFYWSFVAAYVTILLGILASLSFDSPWSRAWFYIVD 954


GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096349 RLP31 "receptor like protein 31" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh2_kg.2__1688__AT1G74190.1
annotation not avaliable (966 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query883
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-64
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-54
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-49
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-46
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-29
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-28
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 7e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.003
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  233 bits (597), Expect = 2e-64
 Identities = 187/653 (28%), Positives = 294/653 (45%), Gaps = 108/653 (16%)

Query: 181 LVELNLSWNKLDGSLPQCLSNLTYLRVLDLTSNQLSGNLPISVFANLTSLEYLSLSGNNF 240
           +V ++LS   + G +   +  L Y++ ++L++NQLSG +P  +F   +SL YL+LS NNF
Sbjct: 71  VVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNF 130

Query: 241 QGSFSLSVLANHSRLEVLQISRLQIETENFPWLPRFQLKVLNLRRCNISGTIPSFLQYQY 300
            GS     + N                          L+ L+L    +SG IP+ +    
Sbjct: 131 TGSIPRGSIPN--------------------------LETLDLSNNMLSGEIPNDIGSFS 164

Query: 301 DLRYIDLSHNNLAGTFPTWLLQNNTKLEFLFLFNNFLKGLLHLPDSKRDLLHLVISNNNF 360
            L+ +DL  N L G  P  L  N T LEFL L                            
Sbjct: 165 SLKVLDLGGNVLVGKIPNSL-TNLTSLEFLTL---------------------------- 195

Query: 361 IGMLPDNFGMILPELVYLDMSQNSFEGSIPPSMGYTVRLLFLDLSSNNFSGELPKQFLTG 420
                               + N   G IP  +G    L ++ L  NN SGE+P + + G
Sbjct: 196 --------------------ASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYE-IGG 234

Query: 421 CVSLAFMNVSHNYFGGQIFPKYMSMTQLAWLYLNDNQFTGRLEEGLLNAPSLHILDVSNN 480
             SL  +++ +N   G I     ++  L +L+L  N+ +G +   + +   L  LD+S+N
Sbjct: 235 LTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDN 294

Query: 481 MLSGQLPHWVGNFSNLDVLLMSRNSLEGDVSVPLSNLQVARILDISENKLYGPLEFSFNH 540
            LSG++P  V    NL++L +  N+  G + V L++L   ++L +  NK  G +  +   
Sbjct: 295 SLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGK 354

Query: 541 SSSLWHLFLHNNSLNGSIPSALFQSSQLMTLDLRDNEFSGNIPPLINEDSNLRALLLRGN 600
            ++L  L L  N+L G IP  L  S  L  L L  N   G IP  +    +LR + L+ N
Sbjct: 355 HNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDN 414

Query: 601 NLQGNIPQQLCHLRKIAIVDISYNLLDGSIPSCFTNIWPWMEEGDPFNGFVFGYTLVVEH 660
           +  G +P +   L  +  +DIS N L G I     N   W                    
Sbjct: 415 SFSGELPSEFTKLPLVYFLDISNNNLQGRI-----NSRKW-------------------D 450

Query: 661 FPAISAYYNSTLNLIFSGEDNRELRQRVEVKFMAKNRYESY---KGGVLEYMTGLDLSSN 717
            P++    +   N  F G  +    +R+E   +++N++      K G L  +  L LS N
Sbjct: 451 MPSLQM-LSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSEN 509

Query: 718 ELTGEIPSAIGYLQELHALNLSHNHLSGSIPRSFSNLKMIESMDLSYNKLRGQIPLELSE 777
           +L+GEIP  +   ++L +L+LSHN LSG IP SFS + ++  +DLS N+L G+IP  L  
Sbjct: 510 KLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGN 569

Query: 778 LNYLAIFNVSYNDLSGPTPNTKQFANFDESNYRGNLNLCGPAVLKNCSTDLPP 830
           +  L   N+S+N L G  P+T  F   + S   GN++LCG     + ++ LPP
Sbjct: 570 VESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCG----GDTTSGLPP 618


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 883
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG4237498 consensus Extracellular matrix protein slit, conta 99.92
PLN032101153 Resistant to P. syringae 6; Provisional 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
KOG4237498 consensus Extracellular matrix protein slit, conta 99.85
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.75
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
PLN03150623 hypothetical protein; Provisional 99.64
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
PLN03150623 hypothetical protein; Provisional 99.5
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.4
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.23
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.19
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.17
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.05
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.05
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.02
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.0
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.97
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.94
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.89
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.84
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.84
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.82
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.81
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.8
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.72
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.7
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.57
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.47
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.4
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.33
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.22
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.11
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.04
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.03
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.0
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.91
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.91
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.88
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.87
PRK15386426 type III secretion protein GogB; Provisional 97.83
KOG4341483 consensus F-box protein containing LRR [General fu 97.81
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.76
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.67
PRK15386426 type III secretion protein GogB; Provisional 97.52
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.38
KOG4341483 consensus F-box protein containing LRR [General fu 97.35
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.29
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.98
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.94
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.87
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.53
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.91
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.82
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.78
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.67
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.5
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.41
KOG4308478 consensus LRR-containing protein [Function unknown 92.65
KOG0473 326 consensus Leucine-rich repeat protein [Function un 92.15
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.38
KOG4308478 consensus LRR-containing protein [Function unknown 90.98
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.55
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.17
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.09
smart0037026 LRR Leucine-rich repeats, outliers. 90.09
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.72
smart0037026 LRR Leucine-rich repeats, outliers. 86.72
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 83.6
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=5.9e-75  Score=723.68  Aligned_cols=585  Identities=33%  Similarity=0.536  Sum_probs=460.2

Q ss_pred             cHHHHHHHHHhhhcCCcCCcccccCCccCCCCCCCCCCCCccceeecCCCCCCCCCCcCCCCCCEEECCCCCCCCCCchh
Q 041908           28 LDNERIGLLEIKTFIKSVSDMQFADAILVSWVDNRTSDCCSWERIKCNVTTANYNNNGSLKQLKILNIGFNSFSESLVPL  107 (883)
Q Consensus        28 ~~~~~~all~~k~~~~~~~~~~~~~~~l~sW~~~~~~~cc~w~gv~C~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~  107 (883)
                      .++|++||++||+++.++      .+.+.+| +. ..+||.|.||+|+..          .+++.|||++|.+.+.++..
T Consensus        27 ~~~~~~~l~~~~~~~~~~------~~~~~~w-~~-~~~~c~w~gv~c~~~----------~~v~~L~L~~~~i~~~~~~~   88 (968)
T PLN00113         27 HAEELELLLSFKSSINDP------LKYLSNW-NS-SADVCLWQGITCNNS----------SRVVSIDLSGKNISGKISSA   88 (968)
T ss_pred             CHHHHHHHHHHHHhCCCC------cccCCCC-CC-CCCCCcCcceecCCC----------CcEEEEEecCCCccccCChH
Confidence            568999999999998532      4567899 33 478999999999753          26899999999999999999


Q ss_pred             hcCCCCCCEEeCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCccccccccchhhcccccchhhhhcCCCCCCEEEcc
Q 041908          108 LTSLTSLTSLFLEGNNLGVGFKPMKVLPNLRNLEVLDLSGNGLIGSLTMQGEKLELLNNKCREMNARICELKNLVELNLS  187 (883)
Q Consensus       108 l~~l~~L~~L~Ls~n~l~~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~L~~~~n~~~~~~~~l~~l~~L~~L~Ls  187 (883)
                      +..+++|++|+|++|++.+. +|...+.++++|++|+|++|.+.+.+|                   .+.+++|++|+|+
T Consensus        89 ~~~l~~L~~L~Ls~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p-------------------~~~l~~L~~L~Ls  148 (968)
T PLN00113         89 IFRLPYIQTINLSNNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIP-------------------RGSIPNLETLDLS  148 (968)
T ss_pred             HhCCCCCCEEECCCCccCCc-CChHHhccCCCCCEEECcCCccccccC-------------------ccccCCCCEEECc
Confidence            99999999999999999876 886556689999999999999988776                   2457888888888


Q ss_pred             CCcCCCCCCccccCCCCCCEEEccCCccccccChhhhcCCCCCCEEeccCCcCccccChHhhhcCCCCcEEEccCccccc
Q 041908          188 WNKLDGSLPQCLSNLTYLRVLDLTSNQLSGNLPISVFANLTSLEYLSLSGNNFQGSFSLSVLANHSRLEVLQISRLQIET  267 (883)
Q Consensus       188 ~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~ip~~~~~~l~~L~~L~L~~n~l~g~~~~~~l~~l~~L~~L~L~~~~~~~  267 (883)
                      +|.+++.+|..++++++|++|++++|.+.+.+| ..++++++|++|++++|.+++.+|                      
T Consensus       149 ~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p-~~~~~l~~L~~L~L~~n~l~~~~p----------------------  205 (968)
T PLN00113        149 NNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIP-NSLTNLTSLEFLTLASNQLVGQIP----------------------  205 (968)
T ss_pred             CCcccccCChHHhcCCCCCEEECccCcccccCC-hhhhhCcCCCeeeccCCCCcCcCC----------------------
Confidence            888888888888888888888888888887788 677888888888887777665433                      


Q ss_pred             CCCCCCCCccceEEEcccCcCCccCchhhhcCCCCCEEEccCCCCcCCcchHHHhcCCCCcEEEcccccccccccCCCCC
Q 041908          268 ENFPWLPRFQLKVLNLRRCNISGTIPSFLQYQYDLRYIDLSHNNLAGTFPTWLLQNNTKLEFLFLFNNFLKGLLHLPDSK  347 (883)
Q Consensus       268 ~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~  347 (883)
                                                ..+..+++|++|++++|.+.+.+|..+. ++++                     
T Consensus       206 --------------------------~~l~~l~~L~~L~L~~n~l~~~~p~~l~-~l~~---------------------  237 (968)
T PLN00113        206 --------------------------RELGQMKSLKWIYLGYNNLSGEIPYEIG-GLTS---------------------  237 (968)
T ss_pred             --------------------------hHHcCcCCccEEECcCCccCCcCChhHh-cCCC---------------------
Confidence                                      3444455555556666655555555432 2222                     


Q ss_pred             CCccEEEccCCccccccchhhhcCCCCCcEEeCCCCcCCCCCCccccccCcccEEeccCCcccCccchhHhhCCCCCCEE
Q 041908          348 RDLLHLVISNNNFIGMLPDNFGMILPELVYLDMSQNSFEGSIPPSMGYTVRLLFLDLSSNNFSGELPKQFLTGCVSLAFM  427 (883)
Q Consensus       348 ~~L~~L~ls~n~l~~~~p~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~ip~~~~~~l~~L~~L  427 (883)
                        |++|++++|.+.+.+|..+.. +++|++|++++|.+.+.+|..+..+++|++|++++|.+.+.+|.            
T Consensus       238 --L~~L~L~~n~l~~~~p~~l~~-l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~------------  302 (968)
T PLN00113        238 --LNHLDLVYNNLTGPIPSSLGN-LKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPE------------  302 (968)
T ss_pred             --CCEEECcCceeccccChhHhC-CCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCCh------------
Confidence              222222223333333444433 55666666666666656666666666666666666655555444            


Q ss_pred             EccCcccCCcCcccccCCCCCCeEEccCcccCccccccccCCCCCCEEEccCCccCCCcchhhhCCCCCCEEECCCCcCC
Q 041908          428 NVSHNYFGGQIFPKYMSMTQLAWLYLNDNQFTGRLEEGLLNAPSLHILDVSNNMLSGQLPHWVGNFSNLDVLLMSRNSLE  507 (883)
Q Consensus       428 ~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~  507 (883)
                                   .+..+++|+.|++++|.+.+.+|..+..+++|+.|++++|.+.+.+|..++.+++|+.|++++|+++
T Consensus       303 -------------~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~  369 (968)
T PLN00113        303 -------------LVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLT  369 (968)
T ss_pred             -------------hHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeE
Confidence                         4445556666666666666666666666777777777777777777777777777777777777777


Q ss_pred             CCCCccccCCCcccEEecCCCcCcCccccccccCCCcCeeecccCccccccchhhhcCCCCCEEeccCCcCCccCCcccc
Q 041908          508 GDVSVPLSNLQVARILDISENKLYGPLEFSFNHSSSLWHLFLHNNSLNGSIPSALFQSSQLMTLDLRDNEFSGNIPPLIN  587 (883)
Q Consensus       508 ~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~~~~~~~L~~L~Ls~N~l~~~~p~~l~  587 (883)
                      +.+|..++.+++|+.|++++|++.+.+|..+..+++|+.|++++|++++.+|..+..++.|+.|++++|++++.+|..+.
T Consensus       370 ~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~  449 (968)
T PLN00113        370 GEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKW  449 (968)
T ss_pred             eeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhc
Confidence            77777777777778888888888777777777888888888888888888888888888888899999888888888888


Q ss_pred             CCCCCcEEEccCCcccccCchhhcCCCCCCEEEcCCCcCCCCCCcccccccccccCCCCCCCcccccccccccccchhhh
Q 041908          588 EDSNLRALLLRGNNLQGNIPQQLCHLRKIAIVDISYNLLDGSIPSCFTNIWPWMEEGDPFNGFVFGYTLVVEHFPAISAY  667 (883)
Q Consensus       588 ~l~~L~~L~L~~N~l~g~~p~~l~~l~~L~~L~ls~N~l~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  667 (883)
                      .+++|+.|++++|++.|.+|..+ ..++|+.||+++|++++.+|..+.+                               
T Consensus       450 ~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~-------------------------------  497 (968)
T PLN00113        450 DMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGS-------------------------------  497 (968)
T ss_pred             cCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhh-------------------------------
Confidence            88899999999999988888765 4588999999999999888876533                               


Q ss_pred             ccccccccccCCChhhhcceeEEEEeeccccccccccccccccEEEccCCcCcccCcccccccccCCeeeCCCCcCCcCC
Q 041908          668 YNSTLNLIFSGEDNRELRQRVEVKFMAKNRYESYKGGVLEYMTGLDLSSNELTGEIPSAIGYLQELHALNLSHNHLSGSI  747 (883)
Q Consensus       668 ~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~i  747 (883)
                                                            ++.|+.|||++|+++|.+|..++++++|++|+|++|.++|.+
T Consensus       498 --------------------------------------l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~  539 (968)
T PLN00113        498 --------------------------------------LSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQI  539 (968)
T ss_pred             --------------------------------------hhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccC
Confidence                                                  457889999999999999999999999999999999999999


Q ss_pred             CccccCcCCCCEEECCCCcccccCCccccCCCCCcEEEccCCcCcccCCCCccCCCCCCcccCCCcCCCCCC
Q 041908          748 PRSFSNLKMIESMDLSYNKLRGQIPLELSELNYLAIFNVSYNDLSGPTPNTKQFANFDESNYRGNLNLCGPA  819 (883)
Q Consensus       748 p~~l~~l~~L~~LdLs~N~Lsg~ip~~l~~l~~L~~l~ls~N~l~g~ip~~~~~~~~~~~~~~gn~~lc~~~  819 (883)
                      |..++++++|+.|||++|+++|.+|..+.++++|+.+++++|+++|.+|..++|.+|.+.+|.||+++||.+
T Consensus       540 p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        540 PASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             ChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            999999999999999999999999999999999999999999999999999999999999999999999864



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query883
3rgx_A768 Structural Insight Into Brassinosteroid Perception 8e-44
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 5e-14
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 9e-44
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 6e-14
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-08
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-08
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 7e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 175 bits (444), Expect = 8e-44, Method: Compositional matrix adjust. Identities = 183/651 (28%), Positives = 277/651 (42%), Gaps = 24/651 (3%) Query: 181 LVELNLSWNKLDGSLPQ--CLSNLTYLRVLDLTSNQLSGNLPISVFANLTSLEYLSLSGN 238 L L+LS N L G + L + + L+ L+++SN L +S L SLE L LS N Sbjct: 102 LTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSAN 161 Query: 239 NFQGSFSLS-VLANH-SRLEVLQISRLQIETENFPWLPRFQLKVLNLRRCNISGTIPSFL 296 + G+ + VL++ L+ L IS +I + L+ L++ N S IP FL Sbjct: 162 SISGANVVGWVLSDGCGELKHLAISGNKISGD-VDVSRCVNLEFLDVSSNNFSTGIP-FL 219 Query: 297 QYQYDLRYIDLSHNNLAGTFPTWLLQXXXXXXXXXXXXXXXXXXXXXPDSKRDLLHLVIS 356 L+++D+S N L+G F + P + L +L ++ Sbjct: 220 GDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLP--LKSLQYLSLA 277 Query: 357 NNNFIGMLPDNFGMILPELVYLDMSQNSFEGSIPPSMGYTVRXXXXXXXXXXXXGELPKQ 416 N F G +PD L LD+S N F G++PP G GELP Sbjct: 278 ENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMD 337 Query: 417 FLTGCVSLAFMNVSHNYFGGQIFPKYMSMT-QLAWLYLNDNQFTGRLEEGLLNAP--SLH 473 L L +++S N F G++ +++ L L L+ N F+G + L P +L Sbjct: 338 TLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQ 397 Query: 474 ILDVSNNMLSGQLPHWVGNFSNLDVLLMSRNSLEGDVSVPLSNLQVARILDISENKLYGP 533 L + NN +G++P + N S L L +S N L G + L +L R L + N L G Sbjct: 398 ELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGE 457 Query: 534 LEFSFNHSSSLWHLFLHNNSLNGSIPSALFQSSQLMTLDLRDNEFSGNIPPLINEDSXXX 593 + + +L L L N L G IPS L + L + L +N +G IP I Sbjct: 458 IPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLA 517 Query: 594 XXXXXXXXXXXXIPQQLCHLRKIAIVDISYNLLDGSIPSCFTNIWPWMEEGDPFNGFVFG 653 IP +L R + +D++ NL +G+IP+ + + G F+ G Sbjct: 518 ILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAM-----FKQSGKIAANFIAG 572 Query: 654 YTLVVEHFPAISAYYNSTLNLI-FSGEDNRELRQRVEVKFMAKNRYESYKGGVLEY---- 708 V + + NL+ F G + +L R+ + Y G Sbjct: 573 KRYVYIKNDGMKKECHGAGNLLEFQGIRSEQL-NRLSTRNPCNITSRVYGGHTSPTFDNN 631 Query: 709 --MTGLDLSSNELTGEIPSAIGYLQEXXXXXXXXXXXXGSIPRSFSNLKMIESMDLSYNK 766 M LD+S N L+G IP IG + GSIP +L+ + +DLS NK Sbjct: 632 GSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNK 691 Query: 767 LRGQIPLELSELNYLAIFNVSYNDLSGPTPNTKQFANFDESNYRGNLNLCG 817 L G+IP +S L L ++S N+LSGP P QF F + + N LCG Sbjct: 692 LDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCG 742
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query883
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 0.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-74
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-72
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-57
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-47
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-66
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-64
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-58
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-39
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-31
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-63
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-55
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-39
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-32
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-25
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-60
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-59
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-53
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-44
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-40
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-32
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-59
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-54
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-52
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-36
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-30
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-28
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-22
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-54
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-49
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-39
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-34
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-27
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-49
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-46
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-43
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-31
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-47
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-23
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-04
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-44
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-42
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-40
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-44
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-43
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-36
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-22
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-44
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-31
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-31
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-34
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-32
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-27
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-07
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-06
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-05
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-31
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-29
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-18
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-32
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-31
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-19
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-30
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-27
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-09
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-29
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-27
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-27
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-26
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-27
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-11
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-26
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-24
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-22
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-20
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-11
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 8e-24
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-23
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-21
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-20
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-05
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-19
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-07
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-18
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-17
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-17
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-17
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-15
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-14
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-11
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-11
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-11
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-11
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 8e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 5e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 6e-05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 8e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  568 bits (1467), Expect = 0.0
 Identities = 223/828 (26%), Positives = 345/828 (41%), Gaps = 81/828 (9%)

Query: 26  SCLDNERIGLLEIKTFIKSVSDMQFADAILVSWVDNRTSDCCSWERIKCNVTTANYNNNG 85
             L  E   L+  K  +           +L  W  +   + C+++ + C         + 
Sbjct: 8   QSLYREIHQLISFKDVLPD-------KNLLPDW--SSNKNPCTFDGVTCR--------DD 50

Query: 86  SLKQLKILNIGFNSFSESLVPLLTSLTSLTSLFLEGNNLGVGFKPMKVLPNLRNLEVLDL 145
            +  + + +   N    ++   L SLT L SLFL  +++              +L  LDL
Sbjct: 51  KVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVSG---FKCSASLTSLDL 107

Query: 146 SGNGLIGSLTMQGEKLELLNNKCREMNARICELKNLVELNLSWNKLDGSLP-QCLSNLTY 204
           S N L G +T                   +     L  LN+S N LD          L  
Sbjct: 108 SRNSLSGPVTTLTS---------------LGSCSGLKFLNVSSNTLDFPGKVSGGLKLNS 152

Query: 205 LRVLDLTSNQLSGNLPISVFA--NLTSLEYLSLSGNNFQGSFSLSVLANHSRLEVLQISR 262
           L VLDL++N +SG   +          L++L++SGN   G   +S   N           
Sbjct: 153 LEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVN----------- 201

Query: 263 LQIETENFPWLPRFQLKVLNLRRCNISGTIPSFLQYQYDLRYIDLSHNNLAGTFPTWLLQ 322
                          L+ L++   N S  IP        L+++D+S N L+G F   +  
Sbjct: 202 ---------------LEFLDVSSNNFSTGIPFLGDCS-ALQHLDISGNKLSGDFSRAI-S 244

Query: 323 NNTKLEFLFLFNNFLKGLLHLPDSK-RDLLHLVISNNNFIGMLPDNFGMILPELVYLDMS 381
             T+L+ L + +N   G   +P    + L +L ++ N F G +PD        L  LD+S
Sbjct: 245 TCTELKLLNISSNQFVG--PIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLS 302

Query: 382 QNSFEGSIPPSMGYTVRLLFLDLSSNNFSGELPKQFLTGCVSLAFMNVSHNYFGGQIFPK 441
            N F G++PP  G    L  L LSSNNFSGELP   L     L  +++S N F G++   
Sbjct: 303 GNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPES 362

Query: 442 YMSMT-QLAWLYLNDNQFTGRL--EEGLLNAPSLHILDVSNNMLSGQLPHWVGNFSNLDV 498
             +++  L  L L+ N F+G +          +L  L + NN  +G++P  + N S L  
Sbjct: 363 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVS 422

Query: 499 LLMSRNSLEGDVSVPLSNLQVARILDISENKLYGPLEFSFNHSSSLWHLFLHNNSLNGSI 558
           L +S N L G +   L +L   R L +  N L G +     +  +L  L L  N L G I
Sbjct: 423 LHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEI 482

Query: 559 PSALFQSSQLMTLDLRDNEFSGNIPPLINEDSNLRALLLRGNNLQGNIPQQLCHLRKIAI 618
           PS L   + L  + L +N  +G IP  I    NL  L L  N+  GNIP +L   R +  
Sbjct: 483 PSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIW 542

Query: 619 VDISYNLLDGSIPSCFTNIWPWMEEGDPFNGFVFGYTLVVEHFPAISAYYNSTLNLIFSG 678
           +D++ NL +G+IP+        +      N       + +++       + +   L F G
Sbjct: 543 LDLNTNLFNGTIPAAMFKQSGKIAA----NFIAGKRYVYIKNDGMKKECHGAGNLLEFQG 598

Query: 679 EDNRELRQ--RVEVKFMAKNRY---ESYKGGVLEYMTGLDLSSNELTGEIPSAIGYLQEL 733
             + +L +        +    Y    S        M  LD+S N L+G IP  IG +  L
Sbjct: 599 IRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYL 658

Query: 734 HALNLSHNHLSGSIPRSFSNLKMIESMDLSYNKLRGQIPLELSELNYLAIFNVSYNDLSG 793
             LNL HN +SGSIP    +L+ +  +DLS NKL G+IP  +S L  L   ++S N+LSG
Sbjct: 659 FILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSG 718

Query: 794 PTPNTKQFANFDESNYRGNLNLCGPAVLKNCSTDLPPPPPMTPAEEDE 841
           P P   QF  F  + +  N  LCG  + +   ++         +    
Sbjct: 719 PIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQRSHHHH 766


>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query883
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.84
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.75
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.75
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.73
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.65
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.6
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.57
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.54
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.49
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.48
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.48
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.46
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.44
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.44
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.43
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.43
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.42
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.33
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.3
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.25
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.2
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.19
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.18
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.17
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.16
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.94
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.91
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.87
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.74
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.43
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.4
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.34
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.31
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.63
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.53
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.01
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.96
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.93
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.84
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.2e-93  Score=868.16  Aligned_cols=717  Identities=31%  Similarity=0.412  Sum_probs=573.1

Q ss_pred             CCcHHHHHHHHHhhhcCCcCCcccccCCccCCCCCCCCCCCCccceeecCCCCCCCCCCcCCCCCCEEECCCCCCCCC--
Q 041908           26 SCLDNERIGLLEIKTFIKSVSDMQFADAILVSWVDNRTSDCCSWERIKCNVTTANYNNNGSLKQLKILNIGFNSFSES--  103 (883)
Q Consensus        26 ~c~~~~~~all~~k~~~~~~~~~~~~~~~l~sW~~~~~~~cc~w~gv~C~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~--  103 (883)
                      .+.++||+|||+||+++.++      . .+++|.  .+++||+|+||+|+  ++         +++.|||+++.+.|.  
T Consensus         8 ~~~~~~~~all~~k~~~~~~------~-~l~~W~--~~~~~C~w~gv~C~--~~---------~v~~L~L~~~~l~g~~~   67 (768)
T 3rgz_A            8 QSLYREIHQLISFKDVLPDK------N-LLPDWS--SNKNPCTFDGVTCR--DD---------KVTSIDLSSKPLNVGFS   67 (768)
T ss_dssp             CCHHHHHHHHHHHHTTCSCT------T-SSTTCC--TTSCGGGSTTEEEE--TT---------EEEEEECTTSCCCEEHH
T ss_pred             cCCHHHHHHHHHHHhhCCCc------c-cccCCC--CCCCCcCCcceEEC--CC---------cEEEEECCCCCcCCccC
Confidence            45789999999999999632      4 789994  35799999999998  22         799999999999998  


Q ss_pred             -CchhhcCCCCCCEEeCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCccccccccchhhcccccchhh--hhcCCCC
Q 041908          104 -LVPLLTSLTSLTSLFLEGNNLGVGFKPMKVLPNLRNLEVLDLSGNGLIGSLTMQGEKLELLNNKCREMNA--RICELKN  180 (883)
Q Consensus       104 -~~~~l~~l~~L~~L~Ls~n~l~~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~L~~~~n~~~~~~~--~l~~l~~  180 (883)
                       +++.+.++++|+.++++.+.+..  +| +.++++++|++|||++|.+.|.+|                 .  .++++++
T Consensus        68 ~l~~~l~~L~~L~~l~~~~~~~~~--l~-~~~~~l~~L~~L~Ls~n~l~~~~~-----------------~~~~l~~l~~  127 (768)
T 3rgz_A           68 AVSSSLLSLTGLESLFLSNSHING--SV-SGFKCSASLTSLDLSRNSLSGPVT-----------------TLTSLGSCSG  127 (768)
T ss_dssp             HHHHHTTTCTTCCEEECTTSCEEE--CC-CCCCCCTTCCEEECCSSEEEEEGG-----------------GGGGGGGCTT
T ss_pred             ccChhHhccCcccccCCcCCCcCC--Cc-hhhccCCCCCEEECCCCcCCCcCC-----------------ChHHHhCCCC
Confidence             89999999999999999998754  55 589999999999999999998887                 5  7899999


Q ss_pred             CCEEEccCCcCCCCCCccc-cCCCCCCEEEccCCccccccChhh---hcCCCCCCEEeccCCcCccccChHhhhcCCCCc
Q 041908          181 LVELNLSWNKLDGSLPQCL-SNLTYLRVLDLTSNQLSGNLPISV---FANLTSLEYLSLSGNNFQGSFSLSVLANHSRLE  256 (883)
Q Consensus       181 L~~L~Ls~n~l~~~~p~~l-~~l~~L~~L~Ls~n~l~~~ip~~~---~~~l~~L~~L~L~~n~l~g~~~~~~l~~l~~L~  256 (883)
                      |++|+|++|.+++.+|..+ .++++|++||+++|++++..| ..   ++++++|++|++++|.+++.++.   .++++|+
T Consensus       128 L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~-~~~~~~~~l~~L~~L~Ls~n~l~~~~~~---~~l~~L~  203 (768)
T 3rgz_A          128 LKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANV-VGWVLSDGCGELKHLAISGNKISGDVDV---SRCVNLE  203 (768)
T ss_dssp             CCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETH-HHHHHTTCCTTCCEEECCSSEEESCCBC---TTCTTCC
T ss_pred             CCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCC-hhhhhhccCCCCCEEECCCCcccccCCc---ccCCcCC
Confidence            9999999999998888776 899999999999999997666 44   78999999999999999876653   5666666


Q ss_pred             EEEccCcccccCCCCCCCCccceEEEcccCcCCccCchhhhcCCCCCEEEccCCCCcCCcchHHHhcCCCCcEEEccccc
Q 041908          257 VLQISRLQIETENFPWLPRFQLKVLNLRRCNISGTIPSFLQYQYDLRYIDLSHNNLAGTFPTWLLQNNTKLEFLFLFNNF  336 (883)
Q Consensus       257 ~L~L~~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~~l~~L~~L~L~~n~  336 (883)
                      +|++++|.+                       .+.+|. ++.+++|++|++++|.+++.+|..+. ++++|++|++++|.
T Consensus       204 ~L~Ls~n~l-----------------------~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~-~l~~L~~L~Ls~n~  258 (768)
T 3rgz_A          204 FLDVSSNNF-----------------------STGIPF-LGDCSALQHLDISGNKLSGDFSRAIS-TCTELKLLNISSNQ  258 (768)
T ss_dssp             EEECCSSCC-----------------------CSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTT-TCSSCCEEECCSSC
T ss_pred             EEECcCCcC-----------------------CCCCcc-cccCCCCCEEECcCCcCCCcccHHHh-cCCCCCEEECCCCc
Confidence            666555554                       444444 55555555555555555555554443 55555555555555


Q ss_pred             ccccccCCCCCCCccEEEccCCccccccchhhhcCCCCCcEEeCCCCcCCCCCCccccccCcccEEeccCCcccCccchh
Q 041908          337 LKGLLHLPDSKRDLLHLVISNNNFIGMLPDNFGMILPELVYLDMSQNSFEGSIPPSMGYTVRLLFLDLSSNNFSGELPKQ  416 (883)
Q Consensus       337 l~~~~~~~~~~~~L~~L~ls~n~l~~~~p~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~ip~~  416 (883)
                      +.+..+.. .+++|++|++++|.+.+.+|..++..+++|++|++++|.+++.+|..++.+++|++|++++|.++|.+|..
T Consensus       259 l~~~~~~~-~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~  337 (768)
T 3rgz_A          259 FVGPIPPL-PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMD  337 (768)
T ss_dssp             CEESCCCC-CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHH
T ss_pred             ccCccCcc-ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHH
Confidence            55433222 56777888888888888888887665688999999999888888888888899999999999888888888


Q ss_pred             HhhCCCCCCEEEccCcccCCcCcccccCCC-CCCeEEccCcccCccccccccC--CCCCCEEEccCCccCCCcchhhhCC
Q 041908          417 FLTGCVSLAFMNVSHNYFGGQIFPKYMSMT-QLAWLYLNDNQFTGRLEEGLLN--APSLHILDVSNNMLSGQLPHWVGNF  493 (883)
Q Consensus       417 ~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~-~L~~L~L~~n~l~~~~~~~~~~--l~~L~~L~ls~n~l~~~~p~~~~~l  493 (883)
                      .+..+++|++|++++|.+++.+|..+..++ +|++|++++|++++.+|..+..  +++|++|++++|.+++.+|..++++
T Consensus       338 ~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l  417 (768)
T 3rgz_A          338 TLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC  417 (768)
T ss_dssp             HHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGC
T ss_pred             HHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcC
Confidence            677888999999999988888888888887 8999999999988888877766  7789999999999988888889999


Q ss_pred             CCCCEEECCCCcCCCCCCccccCCCcccEEecCCCcCcCccccccccCCCcCeeecccCccccccchhhhcCCCCCEEec
Q 041908          494 SNLDVLLMSRNSLEGDVSVPLSNLQVARILDISENKLYGPLEFSFNHSSSLWHLFLHNNSLNGSIPSALFQSSQLMTLDL  573 (883)
Q Consensus       494 ~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~~~~~~~L~~L~L  573 (883)
                      ++|++|++++|++++.+|..+..+++|+.|++++|++.+.+|..+..+++|++|++++|++++.+|..+.++++|++|++
T Consensus       418 ~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L  497 (768)
T 3rgz_A          418 SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISL  497 (768)
T ss_dssp             TTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEEC
T ss_pred             CCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEc
Confidence            99999999999998888888989999999999999998888888888889999999999999888988999999999999


Q ss_pred             cCCcCCccCCccccCCCCCcEEEccCCcccccCchhhcCCCCCCEEEcCCCcCCCCCCcccccccccccCCCCCCCcccc
Q 041908          574 RDNEFSGNIPPLINEDSNLRALLLRGNNLQGNIPQQLCHLRKIAIVDISYNLLDGSIPSCFTNIWPWMEEGDPFNGFVFG  653 (883)
Q Consensus       574 s~N~l~~~~p~~l~~l~~L~~L~L~~N~l~g~~p~~l~~l~~L~~L~ls~N~l~~~~p~~~~~~~~~~~~~~~~~~~~~~  653 (883)
                      ++|++++.+|.+++.+++|++|++++|+++|.+|..++.+++|+.||+++|+++|.+|.++............. +....
T Consensus       498 ~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~-~~~~~  576 (768)
T 3rgz_A          498 SNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIA-GKRYV  576 (768)
T ss_dssp             CSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTC-SCEEE
T ss_pred             cCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccc-ccccc
Confidence            99999988999999999999999999999999999999999999999999999999998776654322111000 00000


Q ss_pred             ----------------cccccccccchhhhccccccccccCCChhhhcceeEEEEeeccccccccccccccccEEEccCC
Q 041908          654 ----------------YTLVVEHFPAISAYYNSTLNLIFSGEDNRELRQRVEVKFMAKNRYESYKGGVLEYMTGLDLSSN  717 (883)
Q Consensus       654 ----------------~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~LdLs~N  717 (883)
                                      ...+.+..+.   ...........     .+.. ....    +.. ....+.+++|+.||||+|
T Consensus       577 ~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~l~~~~~~-----~l~~-~~~~----g~~-~~~~~~l~~L~~LdLs~N  642 (768)
T 3rgz_A          577 YIKNDGMKKECHGAGNLLEFQGIRSE---QLNRLSTRNPC-----NITS-RVYG----GHT-SPTFDNNGSMMFLDMSYN  642 (768)
T ss_dssp             EEECCSCCTTCCSSEEEEECTTCCGG---GGGGGGGTCCS-----CTTS-CEEE----EEC-CCSCSSSBCCCEEECCSS
T ss_pred             ccccccccccccccccccccccccch---hhhcccccccc-----cccc-ceec----ccC-chhhhccccccEEECcCC
Confidence                            0000000000   00000000000     0000 0000    000 001134688999999999


Q ss_pred             cCcccCcccccccccCCeeeCCCCcCCcCCCccccCcCCCCEEECCCCcccccCCccccCCCCCcEEEccCCcCcccCCC
Q 041908          718 ELTGEIPSAIGYLQELHALNLSHNHLSGSIPRSFSNLKMIESMDLSYNKLRGQIPLELSELNYLAIFNVSYNDLSGPTPN  797 (883)
Q Consensus       718 ~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~l~~L~~LdLs~N~Lsg~ip~~l~~l~~L~~l~ls~N~l~g~ip~  797 (883)
                      +++|.||.+|+++++|++|+||+|+++|.||..++++++|++||||+|+++|.||.++.++++|++||+|+|+|+|+||.
T Consensus       643 ~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~  722 (768)
T 3rgz_A          643 MLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPE  722 (768)
T ss_dssp             CCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCS
T ss_pred             cccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccCCCCCCcccCCCcCCCCCCCCCCCCCCC
Q 041908          798 TKQFANFDESNYRGNLNLCGPAVLKNCSTDL  828 (883)
Q Consensus       798 ~~~~~~~~~~~~~gn~~lc~~~~~~~c~~~~  828 (883)
                      ++||.+|.+.+|.|||++||+|+. .|....
T Consensus       723 ~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~~  752 (768)
T 3rgz_A          723 MGQFETFPPAKFLNNPGLCGYPLP-RCDPSN  752 (768)
T ss_dssp             SSSGGGSCGGGGCSCTEEESTTSC-CCCSCC
T ss_pred             chhhccCCHHHhcCCchhcCCCCc-CCCCCc
Confidence            999999999999999999999986 897544



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 883
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-14
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 4e-06
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 1e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 4e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 9e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 3e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 80.0 bits (196), Expect = 2e-16
 Identities = 66/364 (18%), Positives = 120/364 (32%), Gaps = 34/364 (9%)

Query: 177 ELKNLVELNLSWNKLDGSLPQCLSNLTYLRVLDLTSNQLSGNLPISVFANLTSLEYLSLS 236
           +L  +  L      +       +  L  L  ++ ++NQL+   P+    NLT L  + ++
Sbjct: 42  DLDQVTTLQADRLGI--KSIDGVEYLNNLTQINFSNNQLTDITPLK---NLTKLVDILMN 96

Query: 237 GNNFQGSFSLSVLANHSRLEVLQISRLQIETENFPWLPRFQLKVLNL------------R 284
            N       L+ L N + L +       I+               N              
Sbjct: 97  NNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSL 156

Query: 285 RCNISGTIPSFLQYQYDLRYIDLSHNNLAGTFPTWLLQNNTKLEFLFLFNNFLKGLLHLP 344
           +    G   + L+   +L  ++    +        +L   T LE L   NN +  +    
Sbjct: 157 QQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITP-L 215

Query: 345 DSKRDLLHLVISNNNFIGMLPDNFGMILPELVYLDMSQNSFEGSIPPSMGYTVRLLFLDL 404
               +L  L ++ N             L  L  LD++ N      P  +    +L  L L
Sbjct: 216 GILTNLDELSLNGNQLKD--IGTLAS-LTNLTDLDLANNQISNLAP--LSGLTKLTELKL 270

Query: 405 SSNNFSGELPKQFLTGCVSLAFMNVSHNYFGGQIFPKYMSMTQLAWLYLNDNQFTGRLEE 464
            +N  S   P   LT        N+  N    +      ++  L +L L  N  +     
Sbjct: 271 GANQISNISPLAGLTAL-----TNLELNENQLEDISPISNLKNLTYLTLYFNNISD--IS 323

Query: 465 GLLNAPSLHILDVSNNMLSGQLPHWVGNFSNLDVLLMSRNSLEGDVSVPLSNLQVARILD 524
            + +   L  L  +NN +S      + N +N++ L    N +      PL+NL     L 
Sbjct: 324 PVSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHNQISD--LTPLANLTRITQLG 379

Query: 525 ISEN 528
           +++ 
Sbjct: 380 LNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query883
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.78
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.44
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.44
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.21
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.19
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.17
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.1
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.2
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.12
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.56
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.39
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.64
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.64
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=8.4e-38  Score=334.92  Aligned_cols=295  Identities=27%  Similarity=0.463  Sum_probs=204.0

Q ss_pred             CCcHHHHHHHHHhhhcCCcCCcccccCCccCCCCCCCCCCCCc--cceeecCCCCCCCCCCcCCCCCCEEECCCCCCCCC
Q 041908           26 SCLDNERIGLLEIKTFIKSVSDMQFADAILVSWVDNRTSDCCS--WERIKCNVTTANYNNNGSLKQLKILNIGFNSFSES  103 (883)
Q Consensus        26 ~c~~~~~~all~~k~~~~~~~~~~~~~~~l~sW~~~~~~~cc~--w~gv~C~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~  103 (883)
                      .|.++||+||++||+++.++       ..+++|. . ++|||.  |+||+|+..++       -.++++|||+++++.+.
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~-------~~l~sW~-~-~~d~C~~~w~gv~C~~~~~-------~~~v~~L~L~~~~l~g~   65 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNP-------TTLSSWL-P-TTDCCNRTWLGVLCDTDTQ-------TYRVNNLDLSGLNLPKP   65 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCC-------GGGTTCC-T-TSCTTTTCSTTEEECCSSS-------CCCEEEEEEECCCCSSC
T ss_pred             CCCHHHHHHHHHHHHHCCCC-------CcCCCCC-C-CCCCCCCcCCCeEEeCCCC-------cEEEEEEECCCCCCCCC
Confidence            49999999999999999643       3689993 3 479994  99999986433       24799999999999884


Q ss_pred             --CchhhcCCCCCCEEeCCC-CCCCCCCCCCCCCCCCCCCCEEECCCCCCCCccccccccchhhcccccchhhhhcCCCC
Q 041908          104 --LVPLLTSLTSLTSLFLEG-NNLGVGFKPMKVLPNLRNLEVLDLSGNGLIGSLTMQGEKLELLNNKCREMNARICELKN  180 (883)
Q Consensus       104 --~~~~l~~l~~L~~L~Ls~-n~l~~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~L~~~~n~~~~~~~~l~~l~~  180 (883)
                        +|+.++++++|++|+|++ |++.|. +| ..++++++|++|+|++|++.+..+                 ..+..+.+
T Consensus        66 ~~lp~~l~~L~~L~~L~Ls~~N~l~g~-iP-~~i~~L~~L~~L~Ls~N~l~~~~~-----------------~~~~~~~~  126 (313)
T d1ogqa_          66 YPIPSSLANLPYLNFLYIGGINNLVGP-IP-PAIAKLTQLHYLYITHTNVSGAIP-----------------DFLSQIKT  126 (313)
T ss_dssp             EECCGGGGGCTTCSEEEEEEETTEESC-CC-GGGGGCTTCSEEEEEEECCEEECC-----------------GGGGGCTT
T ss_pred             CCCChHHhcCccccccccccccccccc-cc-cccccccccchhhhcccccccccc-----------------ccccchhh
Confidence              788889999999999986 778776 88 578888888888888888877666                 66777888


Q ss_pred             CCEEEccCCcCCCCCCccccCCCCCCEEEccCCccccccChhhhcCCCCC-CEEeccCCcCccccChHhhhcCCCCcEEE
Q 041908          181 LVELNLSWNKLDGSLPQCLSNLTYLRVLDLTSNQLSGNLPISVFANLTSL-EYLSLSGNNFQGSFSLSVLANHSRLEVLQ  259 (883)
Q Consensus       181 L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~ip~~~~~~l~~L-~~L~L~~n~l~g~~~~~~l~~l~~L~~L~  259 (883)
                      |+++++++|.+.+.+|..+++++.|+++++++|.++|.+| ..+..+.++ +.+++++|+++|..+. .+.++.      
T Consensus       127 L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip-~~~~~l~~l~~~l~~~~n~l~~~~~~-~~~~l~------  198 (313)
T d1ogqa_         127 LVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIP-DSYGSFSKLFTSMTISRNRLTGKIPP-TFANLN------  198 (313)
T ss_dssp             CCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECC-GGGGCCCTTCCEEECCSSEEEEECCG-GGGGCC------
T ss_pred             hcccccccccccccCchhhccCcccceeeccccccccccc-cccccccccccccccccccccccccc-cccccc------
Confidence            8888888888888888888888888888888888888888 566666664 7777777777755442 222221      


Q ss_pred             ccCcccccCCCCCCCCccceEEEcccCcCCccCchhhhcCCCCCEEEccCCCCcCCcchHHHhcCCCCcEEEcccccccc
Q 041908          260 ISRLQIETENFPWLPRFQLKVLNLRRCNISGTIPSFLQYQYDLRYIDLSHNNLAGTFPTWLLQNNTKLEFLFLFNNFLKG  339 (883)
Q Consensus       260 L~~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~~l~~L~~L~L~~n~l~~  339 (883)
                                        ...+++.++...+.+|..+..+++++.+++++|.+.+.+|.                     
T Consensus       199 ------------------~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~~---------------------  239 (313)
T d1ogqa_         199 ------------------LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGK---------------------  239 (313)
T ss_dssp             ------------------CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGGG---------------------
T ss_pred             ------------------ccccccccccccccccccccccccccccccccccccccccc---------------------
Confidence                              22334444444445555555555555555555555543332                     


Q ss_pred             cccCCCCCCCccEEEccCCccccccchhhhcCCCCCcEEeCCCCcCCCCCCccccccCcccEEeccCCc
Q 041908          340 LLHLPDSKRDLLHLVISNNNFIGMLPDNFGMILPELVYLDMSQNSFEGSIPPSMGYTVRLLFLDLSSNN  408 (883)
Q Consensus       340 ~~~~~~~~~~L~~L~ls~n~l~~~~p~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~  408 (883)
                          ...+++|++|++++|++.|.+|+.++. +++|++|+|++|+++|.+|. ++++++|+.+++++|+
T Consensus       240 ----~~~~~~L~~L~Ls~N~l~g~iP~~l~~-L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         240 ----VGLSKNLNGLDLRNNRIYGTLPQGLTQ-LKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNK  302 (313)
T ss_dssp             ----CCCCTTCCEEECCSSCCEECCCGGGGG-CTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSS
T ss_pred             ----cccccccccccCccCeecccCChHHhC-CCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCc
Confidence                112344555555555555566666554 56666666666666665553 4555566666666654



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure