Citrus Sinensis ID: 041910

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
DDYEEAKDNILELSIDKLNLGPKKKLLVLSPSRLLVHRAHRANKATIPQNRMPDAINGGHLVFKRPFVEDFMKFCFERFEVGIWSSAKERNVDTVLYCAMGKLKDKLLFVWDQEECTDSGFKSLEKKDKPLFFKDLNKLWQKINTSNKYHFNESDTLLIDDNPYKALLNPPNTSIFPEAYNPEDVNDKVLKPNGELAKYLEGLAEAEDVQSYVKENAFGQPPVNSSHPDWRFYCKSVSC
ccHHHHHccccccccccccccccccEEEEcccccEEEEEccccccccccccccccccccEEEEEcccHHHHHHHHHHccEEEEEcccccccHHHHHHHHHccccccEEEEEcccccccccccccccccccEEEEEcHHHHHHcccccccccccccEEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHcccccHHHHHHHccccccccccccccccHHHccccc
cccHHccccccEEEHHHccccccccEEEEEEcccHHEEcEcccccccccccccccEEcccEEEEcccHHHHHHHHHHccEEEEEEcccccHHHHHHHHHHHHHcccEEEEEcccccccccccccccccccEEHHHHHHHHHccccccccccccccEEEEEccHHHHHcccccEEEEccccccccccccccccccHHHHHHHHHHccccHHHHHHHccccccccccccccccHEEHEccc
DDYEEAKDNILELSIdklnlgpkkkllvlspsrlLVHRAHrankatipqnrmpdaingghlvfkrpfVEDFMKFCFERFEVgiwssakernvDTVLYCAMGKLKDKLLFVwdqeectdsgfkslekkdkplfFKDLNKLWQKINtsnkyhfnesdtlliddnpykallnppntsifpeaynpedvndkvlkpnGELAKYLEGLAEAEDVQSYVKEnafgqppvnsshpdwrfycksvsc
ddyeeakdNILElsidklnlgpkkKLLVLSPSRLLVHRAHRankatipqnrmpdaINGGHLVFKRPFVEDFMKFCFERFEvgiwssakernvDTVLYCAMGKLKDKLLFVWDQEECTdsgfkslekkdkplFFKDLNKLWQKINTSNKYHFNESDTLLIDDNPYKALLNPPNTSIFPEAYNPEDVNDKVLKPNGELAKYLEGLAEAEDVQSYVKENAfgqppvnsshpdwRFYCKSVSC
DDYEEAKDNILELSIDKLNLGPKKKLLVLSPSRLLVHRAHRANKATIPQNRMPDAINGGHLVFKRPFVEDFMKFCFERFEVGIWSSAKERNVDTVLYCAMGKLKDKLLFVWDQEECTDSGFKSLEKKDKPLFFKDLNKLWQKINTSNKYHFNESDTLLIDDNPYKALLNPPNTSIFPEAYNPEDVNDKVLKPNGELAKYLEGLAEAEDVQSYVKENAFGQPPVNSSHPDWRFYCKSVSC
**********LELSIDKLNLGPKKKLLVLSPSRLLVHRAHRANKATIP**RMPDAINGGHLVFKRPFVEDFMKFCFERFEVGIWSSAKERNVDTVLYCAMGKLKDKLLFVWDQEECTDSGFKSLEKKDKPLFFKDLNKLWQKINTSNKYHFNESDTLLIDDNPYKALLNPPNTSIFPEAY**************ELAKYLEGLAE******Y*****************WRFYC*****
*************************LLVLSPSRLLVHRAHRA*****PQ**MPDAINGGHLVFKRPFVEDFMKFCFERFEVGIWSSAKERNVDTVLYCAMGKLKDKLLFVWDQEECTDSGFKSLEKKDKPLFFKDLNKLWQKINTS*K*HFNESDTLLIDDNPYKALLNPPNTSIFPEAYNPEDVNDKVLKPNGELAKYLEGLAEAEDVQSYVKENAFGQPPVNSSHPDWRFYCKSVSC
********NILELSIDKLNLGPKKKLLVLSPSRLLVHRAHRANKATIPQNRMPDAINGGHLVFKRPFVEDFMKFCFERFEVGIWSSAKERNVDTVLYCAMGKLKDKLLFVWDQEECTDSGFKSLEKKDKPLFFKDLNKLWQKINTSNKYHFNESDTLLIDDNPYKALLNPPNTSIFPEAYNPEDVNDKVLKPNGELAKYLEGLAEAEDVQSYVKENAFGQPPVNSSHPDWRFYCKSVSC
DD***AKDNILELSIDKLNLGPKKKLLVLSPSRLLVHRAHRANKATIPQNRMPDAINGGHLVFKRPFVEDFMKFCFERFEVGIWSSAKERNVDTVLYCAMGKLKDKLLFVWDQEECTDSGFKSLEKKDKPLFFKDLNKLWQKINTSNKYHFNESDTLLIDDNPYKALLNPPNTSIFPEAYNPEDVNDKVLKPNGELAKYLEGLAEAEDVQSYVKENAFGQPPVNSSHPDWRFYCKSVSC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DDYEEAKDNILELSIDKLNLGPKKKLLVLSPSRLLVHRAHRANKATIPQNRMPDAINGGHLVFKRPFVEDFMKFCFERFEVGIWSSAKERNVDTVLYCAMGKLKDKLLFVWDQEECTDSGFKSLEKKDKPLFFKDLNKLWQKINTSNKYHFNESDTLLIDDNPYKALLNPPNTSIFPEAYNPEDVNDKVLKPNGELAKYLEGLAEAEDVQSYVKENAFGQPPVNSSHPDWRFYCKSVSC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query239 2.2.26 [Sep-21-2011]
O94336244 Uncharacterized FCP1 homo yes no 0.707 0.692 0.263 2e-07
Q9XYL0306 Probable C-terminal domai yes no 0.523 0.408 0.274 0.0001
>sp|O94336|YHM3_SCHPO Uncharacterized FCP1 homology domain-containing protein C1271.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.03c PE=4 SV=1 Back     alignment and function desciption
 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 96/205 (46%), Gaps = 36/205 (17%)

Query: 24  KKLLVLSPSRLLVHRAH--RANKATIPQNRMPDAINGGHLVFKRPFVEDFMKFCFERFEV 81
           +KL++L  +  L+ RA   R+ K+    +R P           RP + +F+K+ F  F V
Sbjct: 23  RKLVILDLNGTLLCRALAVRSEKSVYEASRNP---------IPRPGLHNFLKYIFANFSV 73

Query: 82  GIWSSAKERNVDTVLYCAMGKLKDK-LLFVWDQEECTDSGFKSLEKKDKPLFFKDLNKLW 140
            ++SS+K  NV  +L   M + + K L+  W +    D      +   K   +K+L+ +W
Sbjct: 74  MVFSSSKPHNVQAMLSAIMNEEQKKALIACWTR---VDMKLTKHQFDRKVQTYKNLDTVW 130

Query: 141 QKIN---TSNKYHFNESDTLLIDDNPYKALLNPPNTSIFPEAYNPEDVNDKVLKPNG--- 194
           +KI+   T     +++ +T+++DD+  K   +P         YN   V+D V K +    
Sbjct: 131 EKIHHDSTGKPVSWSQYNTIIVDDSKTKCAAHP---------YNHIAVSDFVAKSHSNIP 181

Query: 195 ---ELA---KYLEGLAEAEDVQSYV 213
              ELA   +YL+ L    +V  Y+
Sbjct: 182 KDIELACVIRYLKHLKSVPNVSYYI 206

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|Q9XYL0|CTDS_DICDI Probable C-terminal domain small phosphatase OS=Dictyostelium discoideum GN=fcpA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query239
388518769262 unknown [Medicago truncatula] 0.983 0.896 0.584 2e-74
225441010274 PREDICTED: uncharacterized protein LOC10 0.933 0.813 0.577 1e-70
118481927261 unknown [Populus trichocarpa] 0.945 0.865 0.536 9e-68
297740053291 unnamed protein product [Vitis vinifera] 0.933 0.766 0.558 7e-67
224148214264 predicted protein [Populus trichocarpa] 0.945 0.856 0.527 5e-66
297823465238 NLI interacting factor family protein [A 0.815 0.819 0.531 3e-53
15227989249 haloacid dehalogenase-like hydrolase dom 0.849 0.815 0.527 7e-52
118487344270 unknown [Populus trichocarpa] 0.966 0.855 0.489 1e-51
224110096270 predicted protein [Populus trichocarpa] 0.966 0.855 0.485 1e-50
224130020285 predicted protein [Populus trichocarpa] 0.895 0.750 0.458 2e-50
>gi|388518769|gb|AFK47446.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 178/238 (74%), Gaps = 3/238 (1%)

Query: 2   DYEEAKDNILELSIDKLNLGPKKKLLVLSPSRLLVHRAHRANKATIPQNRMPDAINGGHL 61
           D+++ K   L+L ++KLNLGPKKKLL+++ +  L+HRA   +K  IP++R  D      L
Sbjct: 21  DHDDHKSPELDLFLEKLNLGPKKKLLIMNLNGFLLHRARVTDKKAIPKSRTADYKYRYFL 80

Query: 62  VFKRPFVEDFMKFCFERFEVGIWSSAKERNVDTVLYCAMGKLKDKLLFVWDQEECTDSGF 121
           ++KRPF E+FMKFC ERFEVG+WSSA E NVD  L CA+G  K+KLLFVWDQ +C DSGF
Sbjct: 81  LYKRPFSEEFMKFCLERFEVGVWSSAMEHNVDGALACAIGDSKNKLLFVWDQHKCRDSGF 140

Query: 122 KSLEKKDKPLFFKDLNKLWQKINTSNKYHFNESDTLLIDDNPYKALLNPPNTS-IFPEAY 180
           KSLE   KPLFFK+L K+W  I     Y  + S+TLLIDD PYK+ LNPPNTS IFP++Y
Sbjct: 141 KSLENNKKPLFFKELKKVWDTIKKGGPY--SASNTLLIDDKPYKSFLNPPNTSIIFPKSY 198

Query: 181 NPEDVNDKVLKPNGELAKYLEGLAEAEDVQSYVKENAFGQPPVNSSHPDWRFYCKSVS 238
           +PED +DK L PNG++ KYL+G+AEAEDVQSYVK+NA G+P + +SHPDW FY +  S
Sbjct: 199 DPEDKDDKALDPNGDICKYLKGVAEAEDVQSYVKDNAIGEPAITTSHPDWAFYSRVRS 256

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225441010|ref|XP_002277490.1| PREDICTED: uncharacterized protein LOC100264874 [Vitis vinifera] Back     alignment and taxonomy information
>gi|118481927|gb|ABK92897.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297740053|emb|CBI30235.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224148214|ref|XP_002336614.1| predicted protein [Populus trichocarpa] gi|222836336|gb|EEE74743.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297823465|ref|XP_002879615.1| NLI interacting factor family protein [Arabidopsis lyrata subsp. lyrata] gi|297325454|gb|EFH55874.1| NLI interacting factor family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15227989|ref|NP_181193.1| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] gi|4581152|gb|AAD24636.1| hypothetical protein [Arabidopsis thaliana] gi|330254172|gb|AEC09266.1| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|118487344|gb|ABK95500.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224110096|ref|XP_002315414.1| predicted protein [Populus trichocarpa] gi|222864454|gb|EEF01585.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224130020|ref|XP_002328634.1| predicted protein [Populus trichocarpa] gi|222838810|gb|EEE77161.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query239
TAIR|locus:2044862249 AT2G36540 "AT2G36540" [Arabido 0.903 0.867 0.510 8.6e-56
TAIR|locus:2091823465 AT3G29760 "AT3G29760" [Arabido 0.589 0.303 0.467 7.9e-30
UNIPROTKB|Q0BYG6197 HNE_2798 "Phosphoprotein phosp 0.719 0.873 0.272 1.3e-10
UNIPROTKB|G4MNF1485 MGG_06937 "NIF domain-containi 0.786 0.387 0.252 5e-08
POMBASE|SPBC1271.03c244 SPBC1271.03c "NLI interacting 0.656 0.643 0.260 3.7e-07
ASPGD|ASPL0000001456 619 AN6562 [Emericella nidulans (t 0.640 0.247 0.269 1.2e-06
DICTYBASE|DDB_G0273861399 ublcp1-2 "ubiquitin-like domai 0.585 0.350 0.264 5.8e-05
DICTYBASE|DDB_G0273117399 ublcp1-1 "ubiquitin-like domai 0.585 0.350 0.264 5.8e-05
DICTYBASE|DDB_G0294376306 fcpA "putative CTD phosphatase 0.539 0.421 0.292 0.00052
TAIR|locus:2044862 AT2G36540 "AT2G36540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 575 (207.5 bits), Expect = 8.6e-56, P = 8.6e-56
 Identities = 123/241 (51%), Positives = 161/241 (66%)

Query:     1 DDYEEAKDNI---LELS--IDKLNLGPK---KKLLVLSPSRLLVHRAHRANKATIPQNRM 52
             D+Y    D +    ELS  +DKL+L PK   KKLLVLS S LL+HR H+      P+NR 
Sbjct:    18 DEYSRG-DTVSDQTELSSILDKLSLEPKTEKKKLLVLSLSGLLLHRVHKKELRKKPKNRS 76

Query:    53 PDAINGGHLVFKRPFVEDFMKFCFERFEVGIWSSAKERNVDTVLYCAMGKLKDKLLFVWD 112
             PDA  G +LV+KRPF E+FMKFC ERFEVGIWSSA E      L  ++      +L V  
Sbjct:    77 PDASCGPNLVYKRPFAEEFMKFCLERFEVGIWSSACE------LVSSLN-----ILIVTG 125

Query:   113 QEECTDSGFKSLEKKDKPLFFKDLNKLWQKINTSNKYHFNESDTLLIDDNPYKALLNPPN 172
               ECTDSG+K+LE + KPLFFKDL+K+++         F+ S+T+ IDD PYKAL NP N
Sbjct:   126 PRECTDSGYKTLENRYKPLFFKDLSKVFKCFKG-----FSASNTIFIDDEPYKALRNPDN 180

Query:   173 TSIFPEAYNPEDVNDKVLKPNGELAKYLEGLAEAEDVQSYVKENAFGQPPVNSSHPDWRF 232
             T +FP +Y+  ++ D +L P GEL  YLEGLA++ DVQ+Y+K ++FG+P ++SSHPDW F
Sbjct:   181 TGLFPMSYDASNIKDNLLDPEGELCSYLEGLAKSSDVQAYIKVHSFGRPMIDSSHPDWSF 240

Query:   233 Y 233
             Y
Sbjct:   241 Y 241
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2091823 AT3G29760 "AT3G29760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0BYG6 HNE_2798 "Phosphoprotein phosphatase" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
UNIPROTKB|G4MNF1 MGG_06937 "NIF domain-containing protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
POMBASE|SPBC1271.03c SPBC1271.03c "NLI interacting factor family phosphatase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000001456 AN6562 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0273861 ublcp1-2 "ubiquitin-like domain-containing CTD phosphatase 1" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0273117 ublcp1-1 "ubiquitin-like domain-containing CTD phosphatase 1" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0294376 fcpA "putative CTD phosphatase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.4843.6.1
SubName- Full=Putative uncharacterized protein; (231 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query239
pfam03031153 pfam03031, NIF, NLI interacting factor-like phosph 1e-20
smart00577148 smart00577, CPDc, catalytic domain of ctd-like pho 7e-19
TIGR02251162 TIGR02251, HIF-SF_euk, Dullard-like phosphatase do 6e-04
TIGR02245195 TIGR02245, HAD_IIID1, HAD-superfamily subfamily II 0.002
>gnl|CDD|217328 pfam03031, NIF, NLI interacting factor-like phosphatase Back     alignment and domain information 
 Score = 84.6 bits (210), Expect = 1e-20
 Identities = 45/188 (23%), Positives = 78/188 (41%), Gaps = 37/188 (19%)

Query: 25  KLLVLSPSRLLVHRAHRANKATIPQNRMPDAINGGHLVFKRPFVEDFMKFCFERFEVGIW 84
           K LVL     LVH +   +             N G  V KRP +++F++   + +E+ I+
Sbjct: 1   KTLVLDLDETLVHSSFEPDL----PFDFVLNFNHGVYVKKRPGLDEFLQELSKYYEIVIF 56

Query: 85  SSAKERNVDTVL--YCAMGKLKDKLLFVWDQEECTDSGFKSLEKKDKPLFFKDLNKLWQK 142
           +++ +   D VL       K     L+    E CT              + KDL+ L + 
Sbjct: 57  TASSKEYADPVLDKLDPKKKYFKHRLYR---ESCT-------------FYVKDLSLLGR- 99

Query: 143 INTSNKYHFNESDTLLIDDNPYKALLNPPNTSIFPEAYNPEDVNDKVLKPNGELAKYLEG 202
                    + S  +++D++P   LL P N  I    +   D +D  L    +L  +L+ 
Sbjct: 100 ---------DLSRVVIVDNSPRSFLLQPDNG-IPIPPFY-GDPDDTELL---KLLPFLKE 145

Query: 203 LAEAEDVQ 210
           LA+ +DV+
Sbjct: 146 LAKVDDVR 153

This family contains a number of NLI interacting factor isoforms and also an N-terminal regions of RNA polymerase II CTC phosphatase and FCP1 serine phosphatase. This region has been identified as the minimal phosphatase domain. Length = 153
>gnl|CDD|214729 smart00577, CPDc, catalytic domain of ctd-like phosphatases Back     alignment and domain information
>gnl|CDD|233801 TIGR02251, HIF-SF_euk, Dullard-like phosphatase domain Back     alignment and domain information
>gnl|CDD|131299 TIGR02245, HAD_IIID1, HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 239
TIGR02245195 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase 100.0
KOG1605262 consensus TFIIF-interacting CTD phosphatase, inclu 100.0
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 100.0
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 100.0
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 99.95
KOG2832393 consensus TFIIF-interacting CTD phosphatase, inclu 99.92
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 99.9
COG5190390 FCP1 TFIIF-interacting CTD phosphatases, including 99.88
KOG0323 635 consensus TFIIF-interacting CTD phosphatases, incl 99.58
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 98.08
COG4996164 Predicted phosphatase [General function prediction 98.0
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 97.96
TIGR01684301 viral_ppase viral phosphatase. These proteins also 97.92
PHA03398303 viral phosphatase superfamily protein; Provisional 97.88
COG5190 390 FCP1 TFIIF-interacting CTD phosphatases, including 97.76
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 97.44
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 97.26
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 97.16
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 97.14
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 97.04
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 97.04
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 96.87
PF05152297 DUF705: Protein of unknown function (DUF705); Inte 96.69
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 96.66
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 96.46
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 96.43
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 96.41
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 96.37
PRK06769173 hypothetical protein; Validated 96.06
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 95.95
PRK13582205 thrH phosphoserine phosphatase; Provisional 95.94
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 95.5
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 95.46
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 95.27
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 94.89
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 94.37
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 94.28
PTZ00445219 p36-lilke protein; Provisional 94.11
PHA02530300 pseT polynucleotide kinase; Provisional 93.98
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 93.92
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 93.88
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 93.81
PRK13288214 pyrophosphatase PpaX; Provisional 93.78
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 93.6
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 93.56
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 93.42
PRK08238 479 hypothetical protein; Validated 93.42
PRK10444248 UMP phosphatase; Provisional 93.31
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 93.19
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 93.14
PLN02645311 phosphoglycolate phosphatase 93.11
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 92.89
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 92.85
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 92.81
COG3882 574 FkbH Predicted enzyme involved in methoxymalonyl-A 92.71
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 92.66
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 92.65
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 92.51
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 92.49
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 92.41
PLN02575381 haloacid dehalogenase-like hydrolase 92.38
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 92.32
PLN02770248 haloacid dehalogenase-like hydrolase family protei 92.19
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 92.18
PRK10513270 sugar phosphate phosphatase; Provisional 91.96
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 91.8
PRK11587218 putative phosphatase; Provisional 91.68
PRK12702 302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 91.66
PRK01158230 phosphoglycolate phosphatase; Provisional 91.58
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 91.47
PRK13226229 phosphoglycolate phosphatase; Provisional 91.41
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 91.26
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 91.22
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 91.13
PLN02779286 haloacid dehalogenase-like hydrolase family protei 91.01
PRK09449224 dUMP phosphatase; Provisional 90.84
PRK13222226 phosphoglycolate phosphatase; Provisional 90.7
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 90.6
PRK14988224 GMP/IMP nucleotidase; Provisional 90.23
PRK10976266 putative hydrolase; Provisional 90.17
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 90.05
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 89.99
PRK15126272 thiamin pyrimidine pyrophosphate hydrolase; Provis 89.97
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 89.96
TIGR01456 321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 89.65
PTZ00174247 phosphomannomutase; Provisional 89.06
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 88.99
PLN02770248 haloacid dehalogenase-like hydrolase family protei 88.88
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 88.71
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 88.58
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 88.46
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 88.33
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 88.31
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 88.28
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 87.87
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 87.85
COG2503274 Predicted secreted acid phosphatase [General funct 87.75
TIGR01675229 plant-AP plant acid phosphatase. This model explic 87.58
PLN02423245 phosphomannomutase 87.52
COG1877266 OtsB Trehalose-6-phosphatase [Carbohydrate transpo 87.4
PRK13223272 phosphoglycolate phosphatase; Provisional 87.39
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 87.36
PLN02940 382 riboflavin kinase 87.03
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 87.03
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 86.97
COG4359220 Uncharacterized conserved protein [Function unknow 86.82
PHA02597197 30.2 hypothetical protein; Provisional 86.77
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 86.75
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 86.55
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 86.55
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 86.37
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 86.07
COG0637221 Predicted phosphatase/phosphohexomutase [General f 85.82
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 85.8
PRK13225273 phosphoglycolate phosphatase; Provisional 85.73
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 85.01
PRK11587218 putative phosphatase; Provisional 84.89
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 84.8
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 84.7
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 84.63
PRK11590211 hypothetical protein; Provisional 84.4
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 84.32
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 84.28
PLN02151354 trehalose-phosphatase 84.27
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 83.61
PLN02887580 hydrolase family protein 83.57
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 83.48
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 83.33
PHA02597197 30.2 hypothetical protein; Provisional 83.24
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 83.07
PRK10563221 6-phosphogluconate phosphatase; Provisional 82.85
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 82.83
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 82.57
PRK14502694 bifunctional mannosyl-3-phosphoglycerate synthase/ 82.29
PRK13288214 pyrophosphatase PpaX; Provisional 82.28
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 82.1
PRK13226229 phosphoglycolate phosphatase; Provisional 81.73
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 81.61
COG0647269 NagD Predicted sugar phosphatases of the HAD super 81.45
PLN02580384 trehalose-phosphatase 80.92
PRK13225273 phosphoglycolate phosphatase; Provisional 80.68
PRK13223272 phosphoglycolate phosphatase; Provisional 80.29
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 80.2
PLN03017366 trehalose-phosphatase 80.04
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information 
Probab=100.00  E-value=1.6e-41  Score=286.06  Aligned_cols=167  Identities=22%  Similarity=0.345  Sum_probs=133.9

Q ss_pred             CCcceEEEeCCCceeEeeccCCCCCCCCCCCCCccccceEEEeCCChHHHHHHHHhCcEEEEeCCCccccHHHHHHHHhc
Q 041910           22 PKKKLLVLSPSRLLVHRAHRANKATIPQNRMPDAINGGHLVFKRPFVEDFMKFCFERFEVGIWSSAKERNVDTVLYCAMG  101 (239)
Q Consensus        22 ~~k~lLVLDLDeTLv~~~~~~~~~~~~~~~~~d~~~~~~~v~~RP~l~eFL~~l~~~fevvIwTsa~~~ya~~il~~id~  101 (239)
                      ++|+||||||||||+|+....               ...++++||||++||++|+++|||+|||||++.||+++++.++.
T Consensus        19 ~~kklLVLDLDeTLvh~~~~~---------------~~~~~~kRP~l~eFL~~~~~~feIvVwTAa~~~ya~~~l~~l~~   83 (195)
T TIGR02245        19 EGKKLLVLDIDYTLFDHRSPA---------------ETGEELMRPYLHEFLTSAYEDYDIVIWSATSMKWIEIKMTELGV   83 (195)
T ss_pred             CCCcEEEEeCCCceEcccccC---------------CCceEEeCCCHHHHHHHHHhCCEEEEEecCCHHHHHHHHHHhcc
Confidence            578999999999999874221               13578999999999999999999999999999999999999874


Q ss_pred             C--CCCcEEEEeeCCcccccCCccccCCCCCceEeecchhhcccccCCCCCCCCCCEEEEECCchhhccCCCCCcccCCC
Q 041910          102 K--LKDKLLFVWDQEECTDSGFKSLEKKDKPLFFKDLNKLWQKINTSNKYHFNESDTLLIDDNPYKALLNPPNTSIFPEA  179 (239)
Q Consensus       102 ~--~~~~~~~v~~r~~C~~~~~~~~e~~~k~~~~KDL~~l~~~~~~~~~~~~dl~~tViIDDsp~~~~~~p~N~ii~p~~  179 (239)
                      .  ...++.++|  ++|...+...  ...++.++|||+.+|.++    ++.++++|||||||+|.++.+||+||+. +.+
T Consensus        84 ~~~~~~~i~~~l--d~~~~~~~~~--~~~g~~~vKdL~~lw~~l----~~~~~~~ntiiVDd~p~~~~~~P~N~i~-I~~  154 (195)
T TIGR02245        84 LTNPNYKITFLL--DSTAMITVHT--PRRGKFDVKPLGVIWALL----PEFYSMKNTIMFDDLRRNFLMNPQNGLK-IRP  154 (195)
T ss_pred             cCCccceEEEEe--ccccceeeEe--eccCcEEEeecHHhhhhc----ccCCCcccEEEEeCCHHHHhcCCCCccc-cCC
Confidence            2  223566665  6664322211  112345699999999874    4557999999999999999999999774 446


Q ss_pred             CCCC---CCCCCccCCcchHHHHHHhhccCCCHHHHHHh
Q 041910          180 YNPE---DVNDKVLKPNGELAKYLEGLAEAEDVQSYVKE  215 (239)
Q Consensus       180 ~~~~---~~~D~~L~~~~~L~~~L~~L~~~~DVr~~l~~  215 (239)
                      |.++   +.+|++|.   .|++||+.|+.++|||++.++
T Consensus       155 f~~~~~~~~~D~eL~---~L~~yL~~la~~~Dvr~~~~~  190 (195)
T TIGR02245       155 FKKAHANRGTDQELL---KLTQYLKTIAELEDFSSLDHK  190 (195)
T ss_pred             ccccCCCCcccHHHH---HHHHHHHHHhcCcccchhhhc
Confidence            8763   47899999   999999999999999999775

This family of sequences appears to belong to the Haloacid Dehalogenase (HAD) superfamily of enzymes by virtue of the presence of three catalytic domains, in this case: LLVLD(ILV)D(YH)T, I(VMG)IWS, and (DN)(VC)K(PA)Lx{15-17}T(IL)(MH)(FV)DD(IL)(GRS)(RK)N. Since this family has no large "cap" domain between motifs 1 and 2 or between 2 and 3, it is formally a "class III" HAD.
>KOG1605 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>KOG2832 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>COG4996 Predicted phosphatase [General function prediction only] Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>PTZ00445 p36-lilke protein; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>PLN02151 trehalose-phosphatase Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>PLN03017 trehalose-phosphatase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query239
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 8e-22
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 2e-13
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 1e-12
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 8e-04
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Length = 320 Back     alignment and structure
 Score = 91.0 bits (225), Expect = 8e-22
 Identities = 32/160 (20%), Positives = 58/160 (36%), Gaps = 17/160 (10%)

Query: 62  VFKRPFVEDFMKFCFERFEVGIWSSAKERNVDTVLYCAM--GKLKDKLLFVWDQEECTDS 119
              RP++ +F+   +E +++ IWS+   R ++  +           K++F  D       
Sbjct: 163 ELMRPYLHEFLTSAYEDYDIVIWSATSMRWIEEKMRLLGVASNDNYKVMFYLDSTAM--- 219

Query: 120 GFKSLEKKDKPLFFKDLNKLWQKINTSNKYHFNESDTLLIDDNPYKALLNPPNT-SIFPE 178
                  +   +  K L  +W          +N S+T++ DD     L+NP +   I P 
Sbjct: 220 -ISVHVPERGVVDVKPLGVIWALYK-----QYNSSNTIMFDDIRRNFLMNPKSGLKIRPF 273

Query: 179 AYNPE-DVNDKVLKPNGELAKYLEGLA-EAEDVQSYVKEN 216
                    D  L    +L+ YL  +A    D  S     
Sbjct: 274 RQAHLNRGTDTELL---KLSDYLRKIAHHCPDFNSLNHRK 310
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Length = 181 Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Length = 195 Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Length = 204 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Length = 372 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query239
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 100.0
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 100.0
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 100.0
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 100.0
3ef1_A 442 RNA polymerase II subunit A C-terminal domain phos 99.95
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 99.94
3ib6_A189 Uncharacterized protein; structural genomics, unkn 97.78
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 97.71
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 97.68
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 97.66
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 97.59
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 97.33
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 97.25
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 97.14
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 96.96
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 96.96
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 96.94
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 96.8
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 96.63
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 96.56
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 96.48
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 96.48
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 96.39
2o2x_A218 Hypothetical protein; structural genomics, joint c 96.39
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 96.29
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 96.25
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 96.15
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 95.93
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 95.91
3mmz_A176 Putative HAD family hydrolase; structural genomics 95.9
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 95.53
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 95.36
3mn1_A189 Probable YRBI family phosphatase; structural genom 95.34
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 95.3
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 95.24
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 94.88
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 94.86
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 94.75
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 94.56
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 94.51
1l6r_A227 Hypothetical protein TA0175; structural genomics, 94.27
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 94.22
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 94.13
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 94.06
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 93.93
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 93.9
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 93.8
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 93.73
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 93.44
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 93.23
3dnp_A290 Stress response protein YHAX; structural PSI-2, pr 92.99
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 92.92
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 92.9
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 92.78
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 92.68
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 92.64
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 92.39
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 92.38
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 92.37
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 92.26
3kc2_A 352 Uncharacterized protein YKR070W; HAD-like, mitocho 92.22
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 92.0
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 91.65
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 91.62
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 91.54
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 91.47
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 91.45
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 91.4
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 91.27
3dao_A283 Putative phosphatse; structural genomics, joint ce 91.24
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 91.24
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; 91.05
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 91.0
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 90.88
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 90.77
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 90.72
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 90.57
2hsz_A243 Novel predicted phosphatase; structural genomics, 90.37
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 90.31
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 90.2
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 90.19
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 90.0
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 89.71
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 89.53
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 89.44
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 89.4
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 89.39
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 89.25
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 89.24
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 88.85
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 88.76
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 88.75
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 88.74
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 88.47
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 88.38
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 88.37
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 88.15
3sd7_A240 Putative phosphatase; structural genomics, haloaci 88.04
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 87.61
2zg6_A220 Putative uncharacterized protein ST2620, probable 87.25
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 86.84
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 86.81
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 86.71
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 86.56
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 86.48
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 86.47
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 86.43
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 85.9
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 85.62
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 85.61
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 85.6
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 85.49
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 85.42
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 85.34
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 85.29
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 85.25
2p11_A231 Hypothetical protein; putative haloacid dehalogena 85.17
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 84.98
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 84.84
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 84.77
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 84.61
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 84.6
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 84.44
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 84.38
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 84.1
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 84.1
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 84.09
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 84.09
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 84.05
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 83.89
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 83.88
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 83.85
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 83.81
1te2_A226 Putative phosphatase; structural genomics, phospha 83.81
1te2_A226 Putative phosphatase; structural genomics, phospha 83.8
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 83.79
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 83.58
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 83.51
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 83.31
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 83.3
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 83.22
3fvv_A232 Uncharacterized protein; unknown function, structu 83.17
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 83.04
2hsz_A243 Novel predicted phosphatase; structural genomics, 82.93
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 82.91
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 82.88
2zg6_A220 Putative uncharacterized protein ST2620, probable 82.84
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 82.78
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 82.64
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 82.63
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 82.55
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 82.38
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 82.32
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 82.31
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 82.21
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 82.1
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 81.87
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 81.82
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 81.67
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 81.66
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 81.53
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 81.46
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 81.31
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 81.3
3sd7_A240 Putative phosphatase; structural genomics, haloaci 81.28
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 81.21
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 80.96
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 80.95
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 80.44
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 80.41
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 80.09
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 80.06
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
Probab=100.00  E-value=1.8e-39  Score=274.90  Aligned_cols=155  Identities=25%  Similarity=0.321  Sum_probs=136.0

Q ss_pred             CCCcceEEEeCCCceeEeeccCCCCCCCCCCCCCccccceEEEeCCChHHHHHHHHhCcEEEEeCCCccccHHHHHHHHh
Q 041910           21 GPKKKLLVLSPSRLLVHRAHRANKATIPQNRMPDAINGGHLVFKRPFVEDFMKFCFERFEVGIWSSAKERNVDTVLYCAM  100 (239)
Q Consensus        21 ~~~k~lLVLDLDeTLv~~~~~~~~~~~~~~~~~d~~~~~~~v~~RP~l~eFL~~l~~~fevvIwTsa~~~ya~~il~~id  100 (239)
                      ..+|+||||||||||||+...+.              .++++.+|||+++||++|+++|||+||||+.+.||++|++.|+
T Consensus        31 ~~~~~tLVLDLDeTLvh~~~~~~--------------~~~~v~~RPgl~eFL~~l~~~yeivI~Tas~~~ya~~vl~~LD   96 (204)
T 3qle_A           31 YQRPLTLVITLEDFLVHSEWSQK--------------HGWRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLD   96 (204)
T ss_dssp             -CCSEEEEEECBTTTEEEEEETT--------------TEEEEEECTTHHHHHHHHTTTEEEEEECSSCHHHHHHHHHHTS
T ss_pred             cCCCeEEEEeccccEEeeecccc--------------CceeEEeCCCHHHHHHHHHhCCEEEEEcCCcHHHHHHHHHHhC
Confidence            46789999999999999986531              3678999999999999999999999999999999999999999


Q ss_pred             cCCCCcEEEEeeCCcccccCCccccCCCCCceEeecchhhcccccCCCCCCCCCCEEEEECCchhhccCCCCCcccCCCC
Q 041910          101 GKLKDKLLFVWDQEECTDSGFKSLEKKDKPLFFKDLNKLWQKINTSNKYHFNESDTLLIDDNPYKALLNPPNTSIFPEAY  180 (239)
Q Consensus       101 ~~~~~~~~~v~~r~~C~~~~~~~~e~~~k~~~~KDL~~l~~~~~~~~~~~~dl~~tViIDDsp~~~~~~p~N~ii~p~~~  180 (239)
                      +.+ ..+.++++|++|...         .+.++|||++|        |  +++++||||||+|.++..||+|+| .+.+|
T Consensus        97 p~~-~~f~~rl~R~~c~~~---------~g~y~KdL~~L--------g--rdl~~vIiIDDsp~~~~~~p~N~I-~I~~~  155 (204)
T 3qle_A           97 PIH-AFVSYNLFKEHCVYK---------DGVHIKDLSKL--------N--RDLSKVIIIDTDPNSYKLQPENAI-PMEPW  155 (204)
T ss_dssp             TTC-SSEEEEECGGGSEEE---------TTEEECCGGGS--------C--SCGGGEEEEESCTTTTTTCGGGEE-ECCCC
T ss_pred             CCC-CeEEEEEEecceeEE---------CCeeeecHHHh--------C--CChHHEEEEECCHHHHhhCccCce-EeeeE
Confidence            875 378899999999852         24689999999        3  789999999999999999999966 55569


Q ss_pred             CCCCCCCCccCCcchHHHHHHhhc--cCCCHHHHHHh
Q 041910          181 NPEDVNDKVLKPNGELAKYLEGLA--EAEDVQSYVKE  215 (239)
Q Consensus       181 ~~~~~~D~~L~~~~~L~~~L~~L~--~~~DVr~~l~~  215 (239)
                      .| + .|++|.   .|++||+.|+  .++|||++|++
T Consensus       156 ~~-~-~D~eL~---~L~~~L~~L~~~~~~DVR~~L~~  187 (204)
T 3qle_A          156 NG-E-ADDKLV---RLIPFLEYLATQQTKDVRPILNS  187 (204)
T ss_dssp             CS-S-CCCHHH---HHHHHHHHHHHTCCSCSHHHHTT
T ss_pred             CC-C-CChhHH---HHHHHHHHHhhcChHHHHHHHHH
Confidence            86 3 467898   9999999998  58999999988
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 239
d1ta0a_181 c.108.1.16 (A:) Carboxy-terminal domain RNA polyme 1e-21
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 181 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NLI interacting factor-like phosphatase
domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 86.2 bits (213), Expect = 1e-21
 Identities = 38/195 (19%), Positives = 79/195 (40%), Gaps = 27/195 (13%)

Query: 22  PKKKLLVLSPSRLLVHRAHR-ANKATIPQNRMPDAINGGHLVFKRPFVEDFMKFCFERFE 80
             K  +V+     LVH + +  N A        D +     V KRP V++F++   E FE
Sbjct: 13  SDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFE 72

Query: 81  VGIWSSAKERNVDTVLYCAMGKLKDKLLFVWDQEECTDSGFKSLEKKDKPLFFKDLNKLW 140
             +++++  +  D V                 +E C       +         KDL++L 
Sbjct: 73  CVLFTASLAKYADPVADLLDK--WGAFRARLFRESCVFHRGNYV---------KDLSRLG 121

Query: 141 QKINTSNKYHFNESDTLLIDDNPYKALLNPPNTSIFPEAYNPEDVNDKVLKPNGELAKYL 200
                      +    L++D++P   + +P N ++   ++  ++++D  L    +L  + 
Sbjct: 122 ----------RDLRRVLILDNSPASYVFHPDN-AVPVASWF-DNMSDTELH---DLLPFF 166

Query: 201 EGLAEAEDVQSYVKE 215
           E L+  +DV S +++
Sbjct: 167 EQLSRVDDVYSVLRQ 181

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query239
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 100.0
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 98.36
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 97.76
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 97.27
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 97.25
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 96.8
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 96.72
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 96.68
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 96.54
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 96.45
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 95.78
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 95.09
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 94.96
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 94.72
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 94.55
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 94.17
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 94.12
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 94.0
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 93.95
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 93.89
d1vjra_261 Hypothetical protein TM1742 {Thermotoga maritima [ 93.63
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 93.49
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 93.11
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 92.88
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 92.67
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 92.64
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 92.56
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 92.47
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 92.06
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 91.86
d1nrwa_285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 91.65
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 91.48
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 90.88
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 90.7
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 90.09
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 89.91
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 89.75
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 89.34
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 88.41
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 88.02
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 87.37
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 86.6
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 85.31
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 84.37
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 84.02
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 83.5
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 83.45
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 83.43
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 83.35
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 82.97
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 82.22
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 81.45
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NLI interacting factor-like phosphatase
domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=8.6e-44  Score=294.23  Aligned_cols=169  Identities=21%  Similarity=0.295  Sum_probs=141.2

Q ss_pred             CCCcceEEEeCCCceeEeeccCCCC-CCCCCCCCCccccceEEEeCCChHHHHHHHHhCcEEEEeCCCccccHHHHHHHH
Q 041910           21 GPKKKLLVLSPSRLLVHRAHRANKA-TIPQNRMPDAINGGHLVFKRPFVEDFMKFCFERFEVGIWSSAKERNVDTVLYCA   99 (239)
Q Consensus        21 ~~~k~lLVLDLDeTLv~~~~~~~~~-~~~~~~~~d~~~~~~~v~~RP~l~eFL~~l~~~fevvIwTsa~~~ya~~il~~i   99 (239)
                      ..+|+||||||||||||+...+... ..............++|++|||+++||++|+++|||+|||||+++||++|++.|
T Consensus        12 ~~~k~~LVLDLDeTLihs~~~~~~~~~~~~~~~~~~~~~~~~v~~RP~l~eFL~~l~~~yei~I~Ta~~~~YA~~il~~l   91 (181)
T d1ta0a_          12 DSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLL   91 (181)
T ss_dssp             GTTSCEEEECCBTTTEEEESSCCTTCSEEEEEEETTEEEEEEEEECTTHHHHHHHHHHHSEEEEECSSCHHHHHHHHHHH
T ss_pred             cCCCeEEEEeCCCCEEccccCCCCCccceeeecccceeeeeEEecCCCHHHHHHHHHhceEEEEEcCCcHHHHHHHHHHh
Confidence            3478999999999999998654221 110011111222467999999999999999999999999999999999999999


Q ss_pred             hcCCCCcEEEEeeCCcccccCCccccCCCCCceEeecchhhcccccCCCCCCCCCCEEEEECCchhhccCCCCCcccCCC
Q 041910          100 MGKLKDKLLFVWDQEECTDSGFKSLEKKDKPLFFKDLNKLWQKINTSNKYHFNESDTLLIDDNPYKALLNPPNTSIFPEA  179 (239)
Q Consensus       100 d~~~~~~~~~v~~r~~C~~~~~~~~e~~~k~~~~KDL~~l~~~~~~~~~~~~dl~~tViIDDsp~~~~~~p~N~ii~p~~  179 (239)
                      +|..  .+.++++|++|...         +..++|||++++          +++++||||||+|.++..||+|++ .+.+
T Consensus        92 dp~~--~~~~~~~r~~c~~~---------~~~~~KdL~~l~----------~~l~~vvivDd~~~~~~~~~~N~I-~I~~  149 (181)
T d1ta0a_          92 DKWG--AFRARLFRESCVFH---------RGNYVKDLSRLG----------RDLRRVLILDNSPASYVFHPDNAV-PVAS  149 (181)
T ss_dssp             CSSC--CEEEEECGGGSEEE---------TTEEECCGGGSC----------SCGGGEEEECSCGGGGTTCGGGBC-CCCC
T ss_pred             ccCC--ceeEEEEeeeeeec---------CCcccccHhhcC----------CCHHHeEEEcCChhhhhcCccCee-EecC
Confidence            9975  57889999999864         246899999993          789999999999999999999965 6667


Q ss_pred             CCCCCCCCCccCCcchHHHHHHhhccCCCHHHHHHh
Q 041910          180 YNPEDVNDKVLKPNGELAKYLEGLAEAEDVQSYVKE  215 (239)
Q Consensus       180 ~~~~~~~D~~L~~~~~L~~~L~~L~~~~DVr~~l~~  215 (239)
                      |.| +.+|++|.   .|++||+.|+.++|||++||+
T Consensus       150 f~~-~~~D~eL~---~l~~~L~~l~~~~DVR~~l~~  181 (181)
T d1ta0a_         150 WFD-NMSDTELH---DLLPFFEQLSRVDDVYSVLRQ  181 (181)
T ss_dssp             CSS-CTTCCHHH---HHHHHHHHHTTCSCHHHHHCC
T ss_pred             cCC-CCCcHHHH---HHHHHHHHHccCCcHHHHhcC
Confidence            987 68999999   999999999999999999974
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure