Citrus Sinensis ID: 041953


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
ATANTSTITTDRDALLALKAHITHDPTNFFAKNWNTSTPVCNWTGVTCDVHSHRVTVLNISRLNLTGTIPSQLGNLSSLQSLNLSCNRLSGSIPSAIFTTYTLKYVSFRKNQLSGAFPSFAFNTSSLQYLDFGFNTLSGEIPANICSNLPFLEYLALSQNMFHGGIPSALSNCAYLQRLGLSSNDFSGVVPKEICNLTKLKGLYLGGNRLQGEIPRESGNLAELELMSLSENELQGAIPREWGNLTGLGILQLSDNFLTGITPSSIYKLLFSIKFGTVI
ccccccccHHHHHHHHHHHHcccccccccccccccccccccccEEEEEccccccEEEEEccccccEEEccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHccccccccEEEccccccEEEcccHHHcccccccEEEccccEEEEcccccccccccccEEEcccccccccccHHHHcccccccEEccccccEEccccccccccccccccccccccEEcccccccccccccEEEcccccccccccHHHHHccccccccccc
cccccccccHHHHHHHHHHHHccccccccHHccccccccccccEEEEEccccccEEEEEEccccEEccccHHHHHcccccEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHccHHHHHHHHHcc
atantstiTTDRDALLALKAHithdptnffaknwntstpvcnwtgvtcdvhshrVTVLNIsrlnltgtipsqlgnlsslQSLNLScnrlsgsipsaifTTYTLKYVSFRKnqlsgafpsfafntsslqyldfgfntlsgeipanicsnlpFLEYLALSQNmfhggipsalsnCAYLQrlglssndfsgvvpkeicnltklkglylggnrlqgeipresgnlAELELMSLSEnelqgaiprewgnltglgilqlsdnfltgitpSSIYKLLFSIKFGTVI
atantstittdrDALLALKAHITHDPTNFFAKNWNTSTPVCNWTGVTCDVHSHRVTVLNISRLNLTGTIPSQLGNLSSLQSLNLSCNRLSGSIPSAIFTTYTLKYVSFRKNQLSGAFPSFAFNTSSLQYLDFGFNTLSGEIPANICSNLPFLEYLALSQNMFHGGIPSALSNCAYLQRLGLSSNDFSGVVPKEICNLTKLKGLYLGGNRLQGEIPRESGNLAELELMSLSENELQGAIPREWGNLTGLGILQLSDNFLTGITPSSIYKllfsikfgtvi
ATANTSTITTDRDALLALKAHITHDPTNFFAKNWNTSTPVCNWTGVTCDVHSHRVTVLNISRLNLTGTIPsqlgnlsslqslnlscnrlsGSIPSAIFTTYTLKYVSFRKNQLSGAFPSFAFNTSSLQYLDFGFNTLSGEIPANICSNLPFLEYLALSQNMFHGGIPSALSNCAYLQRLGLSSNDFSGVVPKEICNLTKLKGLYLGGNRLQGEIPRESGnlaelelmslsenelQGAIPREWGNLTGLGILQLSDNFLTGITPSSIYKLLFSIKFGTVI
***********RDALLALKAHITHDPTNFFAKNWNTSTPVCNWTGVTCDVHSHRVTVLNISRLNLTGTIPSQLGNLSSLQSLNLSCNRLSGSIPSAIFTTYTLKYVSFRKNQLSGAFPSFAFNTSSLQYLDFGFNTLSGEIPANICSNLPFLEYLALSQNMFHGGIPSALSNCAYLQRLGLSSNDFSGVVPKEICNLTKLKGLYLGGNRLQGEI******************ELQGAIPREWGNLTGLGILQLSDNFLTGITPSSIYKLLFSIKFGT**
*****STITTDRDALLALKAHITHDPTNFFA*NWNTSTPVCNWTGVTCDVHSHRVTVLNISRLNLTGTIPSQLGNLSSLQSLNLSCNRLSGSIPSAIFTTYTLKYVSFRKNQLSGAFPSFAFNTSSLQYLDFGFNTLSGEIPANICSNLPFLEYLALSQNMFHGGIPSALSNCAYLQRLGLSSNDFSGVVPKEICNLTKLKGLYLGGNRLQGEIPRESGNLAELELMSLSENELQGAIPREWGNLTGLGILQLSDNFLTGITPSSIYKLLFSIKFGTVI
********TTDRDALLALKAHITHDPTNFFAKNWNTSTPVCNWTGVTCDVHSHRVTVLNISRLNLTGTIPSQLGNLSSLQSLNLSCNRLSGSIPSAIFTTYTLKYVSFRKNQLSGAFPSFAFNTSSLQYLDFGFNTLSGEIPANICSNLPFLEYLALSQNMFHGGIPSALSNCAYLQRLGLSSNDFSGVVPKEICNLTKLKGLYLGGNRLQGEIPRESGNLAELELMSLSENELQGAIPREWGNLTGLGILQLSDNFLTGITPSSIYKLLFSIKFGTVI
********TTDRDALLALKAHITHDPTNFFAKNWNTSTPVCNWTGVTCDVHSHRVTVLNISRLNLTGTIPSQLGNLSSLQSLNLSCNRLSGSIPSAIFTTYTLKYVSFRKNQLSGAFPSFAFNTSSLQYLDFGFNTLSGEIPANICSNLPFLEYLALSQNMFHGGIPSALSNCAYLQRLGLSSNDFSGVVPKEICNLTKLKGLYLGGNRLQGEIPRESGNLAELELMSLSENELQGAIPREWGNLTGLGILQLSDNFLTGITPSSIYKLLFSIKFGTVI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ATANTSTITTDRDALLALKAHITHDPTNFFAKNWNTSTPVCNWTGVTCDVHSHRVTVLNISRLNLTGTIPSQLGNLSSLQSLNLSCNRLSGSIPSAIFTTYTLKYVSFRKNQLSGAFPSFAFNTSSLQYLDFGFNTLSGEIPANICSNLPFLEYLALSQNMFHGGIPSALSNCAYLQRLGLSSNDFSGVVPKEICNLTKLKGLYLGGNRLQGEIPRESGNLAELELMSLSENELQGAIPREWGNLTGLGILQLSDNFLTGITPSSIYKLLFSIKFGTVI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query279 2.2.26 [Sep-21-2011]
Q9M2Z1 1002 Leucine-rich repeat recep yes no 0.928 0.258 0.370 6e-40
Q9FL28 1173 LRR receptor-like serine/ no no 0.913 0.217 0.358 9e-38
C0LGS2 1136 Probable LRR receptor-lik no no 0.888 0.218 0.396 9e-36
O49545 1003 Leucine-rich repeat recep no no 0.913 0.254 0.355 2e-34
Q9SHI2 1101 Leucine-rich repeat recep no no 0.935 0.237 0.359 3e-34
Q9M0G7 1013 Leucine-rich repeat recep no no 0.881 0.242 0.372 3e-34
C0LGT6 1031 LRR receptor-like serine/ no no 0.928 0.251 0.326 3e-34
Q8LPB4 1021 Phytosulfokine receptor 1 N/A no 0.949 0.259 0.325 5e-34
Q9LVP0 1102 Probable leucine-rich rep no no 0.960 0.243 0.345 7e-34
Q6XAT2 967 LRR receptor-like serine/ no no 0.974 0.281 0.347 1e-33
>sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 Back     alignment and function desciption
 Score =  164 bits (415), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 106/286 (37%), Positives = 157/286 (54%), Gaps = 27/286 (9%)

Query: 10  TDRDALLALKAHITHDPTNFFAKNWNTSTPVCNWTGVTCDVHSHRVTVLNISRLNLTGTI 69
           T+  ALL+LK+  T D  +    +WN ST  C+WTGVTCDV    VT L++S LNL+GT+
Sbjct: 26  TELHALLSLKSSFTIDEHSPLLTSWNLSTTFCSWTGVTCDVSLRHVTSLDLSGLNLSGTL 85

Query: 70  PSQLGNLSSLQSLNLSCNRLSGSIPSAIFTTYTLKYVSFRKNQLSGAFP-SFAFNTSSLQ 128
            S + +L  LQ+L+L+ N++SG IP  I   Y L++++   N  +G+FP   +    +L+
Sbjct: 86  SSDVAHLPLLQNLSLAANQISGPIPPQISNLYELRHLNLSNNVFNGSFPDELSSGLVNLR 145

Query: 129 YLDFGFNTLSGEIPANICSNLPFLEYLALSQNMFHGGIPSALSNCAYLQRLGLSSNDFSG 188
            LD   N L+G++P ++ +NL  L +L L  N F G IP+       L+ L +S N+ +G
Sbjct: 146 VLDLYNNNLTGDLPVSL-TNLTQLRHLHLGGNYFSGKIPATYGTWPVLEYLAVSGNELTG 204

Query: 189 VVPKEICNLTKLKGLYLG-------------GN------------RLQGEIPRESGNLAE 223
            +P EI NLT L+ LY+G             GN             L GEIP E G L +
Sbjct: 205 KIPPEIGNLTTLRELYIGYYNAFENGLPPEIGNLSELVRFDAANCGLTGEIPPEIGKLQK 264

Query: 224 LELMSLSENELQGAIPREWGNLTGLGILQLSDNFLTGITPSSIYKL 269
           L+ + L  N   G I +E G ++ L  + LS+N  TG  P+S  +L
Sbjct: 265 LDTLFLQVNAFTGTITQELGLISSLKSMDLSNNMFTGEIPTSFSQL 310




Necessary for male gametophyte development, as well as ovule specification and function. Involved in cell-cell communication process required during early anther development, and regulating cell division and differentiation to organize cell layers. Required for the development of high-ordered vascular strands within the leaf and a correlated control of leaf shape, size and symmetry. May regulate the CLV1-dependent CLV3-mediated signaling in meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|O49545|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 OS=Arabidopsis thaliana GN=BAM1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9M0G7|PXL2_ARATH Leucine-rich repeat receptor-like protein kinase PXL2 OS=Arabidopsis thaliana GN=PXL2 PE=2 SV=1 Back     alignment and function description
>sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 Back     alignment and function description
>sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query279
359485176 1160 PREDICTED: probable LRR receptor-like se 0.928 0.223 0.440 2e-49
255578886 1043 serine-threonine protein kinase, plant-t 0.935 0.250 0.418 7e-49
224139658 1019 predicted protein [Populus trichocarpa] 0.910 0.249 0.425 6e-48
356510768 1214 PREDICTED: probable LRR receptor-like se 0.964 0.221 0.396 9e-47
359485449 1583 PREDICTED: LRR receptor-like serine/thre 0.960 0.169 0.429 2e-45
296086336 628 unnamed protein product [Vitis vinifera] 0.913 0.406 0.395 2e-44
297740829 1892 unnamed protein product [Vitis vinifera] 0.892 0.131 0.432 4e-44
255583729 383 serine-threonine protein kinase, plant-t 0.917 0.668 0.357 8e-44
298204751 1979 unnamed protein product [Vitis vinifera] 0.928 0.130 0.411 2e-43
255583725 973 serine-threonine protein kinase, plant-t 0.910 0.261 0.411 4e-43
>gi|359485176|ref|XP_002280075.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 115/261 (44%), Positives = 158/261 (60%), Gaps = 2/261 (0%)

Query: 10  TDRDALLALKAHITHDPTNFFAKNWNTSTPVCNWTGVTCDVHSHRVTVLNISRLNLTGTI 69
            D  +LLA+KAHIT D  +  A NW+T+T  CNW GV+CD    RV  L++S ++L GTI
Sbjct: 33  ADELSLLAMKAHITSDSKDVLATNWSTTTSYCNWFGVSCDAARQRVIALDLSNMDLEGTI 92

Query: 70  PSQLGNLSSLQSLNLSCNRLSGSIPSAIFTTYTLKYVSFRKNQLSGAFPSFAFNTSSLQY 129
             Q+GNLS L +L+LS N    SIP+ I     L+ +    N+L+G+ P    N S L+ 
Sbjct: 93  APQVGNLSFLVTLDLSNNSFHASIPNEIAKCRELRQLYLFNNRLTGSIPQAIGNLSKLEQ 152

Query: 130 LDFGFNTLSGEIPANICSNLPFLEYLALSQNMFHGGIPSALSNCAYLQRLGLSSNDFSGV 189
           L  G N L+GEIP  I S+L  L+ L+   N     IPSA+ N + LQ +GL+ N  SG 
Sbjct: 153 LYLGGNQLTGEIPREI-SHLLSLKILSFRSNNLTASIPSAIFNISSLQYIGLTYNSLSGT 211

Query: 190 VPKEIC-NLTKLKGLYLGGNRLQGEIPRESGNLAELELMSLSENELQGAIPREWGNLTGL 248
           +P ++C +L KL+GLYL GN+L G+IP   G    LE +SLS NE  G+IPR  G+L+ L
Sbjct: 212 LPMDMCYSLPKLRGLYLSGNQLSGKIPTSLGKCGRLEEISLSFNEFMGSIPRGIGSLSVL 271

Query: 249 GILQLSDNFLTGITPSSIYKL 269
            +L L  N L G  P +++ L
Sbjct: 272 EVLYLGSNNLEGEIPQTLFNL 292




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255578886|ref|XP_002530297.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223530195|gb|EEF32104.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224139658|ref|XP_002323215.1| predicted protein [Populus trichocarpa] gi|222867845|gb|EEF04976.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356510768|ref|XP_003524106.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Glycine max] Back     alignment and taxonomy information
>gi|359485449|ref|XP_002276919.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296086336|emb|CBI31777.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297740829|emb|CBI31011.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255583729|ref|XP_002532618.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223527674|gb|EEF29784.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|298204751|emb|CBI25249.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255583725|ref|XP_002532616.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223527672|gb|EEF29782.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query279
TAIR|locus:2097310 1002 BAM2 "BARELY ANY MERISTEM 2" [ 0.942 0.262 0.340 3e-32
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.888 0.218 0.350 5.7e-31
TAIR|locus:2169965 1003 BAM1 "BARELY ANY MERISTEM 1" [ 0.881 0.245 0.330 1.5e-27
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.870 0.257 0.345 4.8e-27
TAIR|locus:2005629 1140 AT1G75640 [Arabidopsis thalian 0.921 0.225 0.316 1.1e-26
TAIR|locus:2120412 992 BAM3 "BARELY ANY MERISTEM 3" [ 0.924 0.260 0.315 1.4e-26
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.913 0.217 0.311 2.3e-26
TAIR|locus:2085537 894 RLP34 "AT3G11010" [Arabidopsis 0.849 0.265 0.337 3.1e-26
TAIR|locus:2144392 957 RLP53 "receptor like protein 5 0.845 0.246 0.330 4.5e-26
TAIR|locus:2079157 1011 AT3G47580 [Arabidopsis thalian 0.974 0.269 0.294 1.7e-25
TAIR|locus:2097310 BAM2 "BARELY ANY MERISTEM 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 364 (133.2 bits), Expect = 3.0e-32, P = 3.0e-32
 Identities = 91/267 (34%), Positives = 130/267 (48%)

Query:    10 TDRDALLALKAHITHDPTNFFAKNWNTSTPVCNWTGVTCDVHSHRVTVLNISRLNLTGTI 69
             T+  ALL+LK+  T D  +    +WN ST  C+WTGVTCDV    VT L++S LNL+GT+
Sbjct:    26 TELHALLSLKSSFTIDEHSPLLTSWNLSTTFCSWTGVTCDVSLRHVTSLDLSGLNLSGTL 85

Query:    70 PXXXXXXXXXXXXXXXXXXXXGSIPSAIFTTYTLKYVSFRKNQLSGAFPS-FAFNTSSLQ 128
                                  G IP  I   Y L++++   N  +G+FP   +    +L+
Sbjct:    86 SSDVAHLPLLQNLSLAANQISGPIPPQISNLYELRHLNLSNNVFNGSFPDELSSGLVNLR 145

Query:   129 YLDFGFNTLSGEIPANICSNLPFLEYLALSQNMFHGGIPSALSNCAYLQRLGLSSNDFSG 188
              LD   N L+G++P ++ +NL  L +L L  N F G IP+       L+ L +S N+ +G
Sbjct:   146 VLDLYNNNLTGDLPVSL-TNLTQLRHLHLGGNYFSGKIPATYGTWPVLEYLAVSGNELTG 204

Query:   189 VVPKEICNLTKLKGLYLGG-NRLQGEIPRESGXXXXXXXXXXXXXXXQGAIPREWGNLTG 247
              +P EI NLT L+ LY+G  N  +  +P E G                G IP E G L  
Sbjct:   205 KIPPEIGNLTTLRELYIGYYNAFENGLPPEIGNLSELVRFDAANCGLTGEIPPEIGKLQK 264

Query:   248 LGILQLSDNFLTGITPSSIYKLLFSIK 274
             L  L L  N  TG     +  L+ S+K
Sbjct:   265 LDTLFLQVNAFTGTITQEL-GLISSLK 290


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0010075 "regulation of meristem growth" evidence=IGI;RCA
GO:0048229 "gametophyte development" evidence=IGI
GO:0048437 "floral organ development" evidence=IGI
GO:0010480 "microsporocyte differentiation" evidence=IGI
GO:0048653 "anther development" evidence=IGI;RCA
GO:0009934 "regulation of meristem structural organization" evidence=IGI
GO:0005515 "protein binding" evidence=IPI
GO:0033612 "receptor serine/threonine kinase binding" evidence=IPI
GO:0000271 "polysaccharide biosynthetic process" evidence=RCA
GO:0007389 "pattern specification process" evidence=RCA
GO:0008361 "regulation of cell size" evidence=RCA
GO:0009664 "plant-type cell wall organization" evidence=RCA
GO:0009740 "gibberellic acid mediated signaling pathway" evidence=RCA
GO:0009825 "multidimensional cell growth" evidence=RCA
GO:0009832 "plant-type cell wall biogenesis" evidence=RCA
GO:0009926 "auxin polar transport" evidence=RCA
GO:0009932 "cell tip growth" evidence=RCA
GO:0010015 "root morphogenesis" evidence=RCA
GO:0010162 "seed dormancy process" evidence=RCA
GO:0010817 "regulation of hormone levels" evidence=RCA
GO:0040007 "growth" evidence=RCA
GO:0043481 "anthocyanin accumulation in tissues in response to UV light" evidence=RCA
GO:0048767 "root hair elongation" evidence=RCA
GO:0071555 "cell wall organization" evidence=RCA
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169965 BAM1 "BARELY ANY MERISTEM 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005629 AT1G75640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120412 BAM3 "BARELY ANY MERISTEM 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079157 AT3G47580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-49
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-35
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-34
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-34
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-30
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-28
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-20
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-11
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 5e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-10
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  174 bits (442), Expect = 3e-49
 Identities = 108/259 (41%), Positives = 151/259 (58%), Gaps = 13/259 (5%)

Query: 15  LLALKAHITHDPTNFFAKNWNTSTPVCNWTGVTCDVHSHRVTVLNISRLNLTGTIPSQLG 74
           LL+ K+ I +DP  + + NWN+S  VC W G+TC+ +S RV  +++S  N++G I S + 
Sbjct: 34  LLSFKSSI-NDPLKYLS-NWNSSADVCLWQGITCN-NSSRVVSIDLSGKNISGKISSAIF 90

Query: 75  NLSSLQSLNLSCNRLSGSIPSAIFTT-YTLKYVSFRKNQLSGAFPS-FAFNTSSLQYLDF 132
            L  +Q++NLS N+LSG IP  IFTT  +L+Y++   N  +G+ P     N   L+ LD 
Sbjct: 91  RLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPN---LETLDL 147

Query: 133 GFNTLSGEIPANI--CSNLPFLEYLALSQNMFHGGIPSALSNCAYLQRLGLSSNDFSGVV 190
             N LSGEIP +I   S+L  L+   L  N+  G IP++L+N   L+ L L+SN   G +
Sbjct: 148 SNNMLSGEIPNDIGSFSSLKVLD---LGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQI 204

Query: 191 PKEICNLTKLKGLYLGGNRLQGEIPRESGNLAELELMSLSENELQGAIPREWGNLTGLGI 250
           P+E+  +  LK +YLG N L GEIP E G L  L  + L  N L G IP   GNL  L  
Sbjct: 205 PRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQY 264

Query: 251 LQLSDNFLTGITPSSIYKL 269
           L L  N L+G  P SI+ L
Sbjct: 265 LFLYQNKLSGPIPPSIFSL 283


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 279
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.91
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.83
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.78
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.77
KOG0617264 consensus Ras suppressor protein (contains leucine 99.74
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.73
KOG0617264 consensus Ras suppressor protein (contains leucine 99.73
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.73
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.72
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.69
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.67
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.66
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.66
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.65
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.63
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.63
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.61
PLN03150623 hypothetical protein; Provisional 99.6
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.57
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.56
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.41
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.41
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.33
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.29
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.29
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.28
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.24
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.21
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.19
PLN03150623 hypothetical protein; Provisional 99.13
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.08
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.04
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.02
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.94
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.93
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.82
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.71
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.7
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.68
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.65
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.65
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.64
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.5
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.48
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.47
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.3
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.23
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.22
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.2
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.16
PRK15386 426 type III secretion protein GogB; Provisional 98.12
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.12
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.1
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.05
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.04
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.04
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.94
PRK15386 426 type III secretion protein GogB; Provisional 97.77
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.75
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.67
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.31
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.09
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.64
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.6
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.19
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.75
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.48
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.29
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.93
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.73
smart0037026 LRR Leucine-rich repeats, outliers. 93.38
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.38
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 93.18
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.91
KOG4308 478 consensus LRR-containing protein [Function unknown 92.9
smart0037026 LRR Leucine-rich repeats, outliers. 92.44
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.44
KOG4308 478 consensus LRR-containing protein [Function unknown 91.81
KOG4341483 consensus F-box protein containing LRR [General fu 88.48
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.37
KOG0473 326 consensus Leucine-rich repeat protein [Function un 87.56
KOG4341483 consensus F-box protein containing LRR [General fu 87.43
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 81.17
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=8.6e-33  Score=263.39  Aligned_cols=257  Identities=41%  Similarity=0.701  Sum_probs=167.5

Q ss_pred             CChhHHHHHHHHHHhccCCCcccccCCCCCCCCCcceeeeeeCCCCCeEEEEEcCCCCccccCcccccCCCCCCEEEccC
Q 041953            7 TITTDRDALLALKAHITHDPTNFFAKNWNTSTPVCNWTGVTCDVHSHRVTVLNISRLNLTGTIPSQLGNLSSLQSLNLSC   86 (279)
Q Consensus         7 ~~~~~~~~l~~~~~~~~~~~~~~~~~~w~~~~~~c~~~~~~~~~~~~~l~~L~l~~~~l~~~~~~~~~~l~~L~~L~l~~   86 (279)
                      ..++|..+|++||+.+. +|..+. .+|+...++|.|.|+.|.. ..+++.|+++++.+.+..+..|..+++|+.|++++
T Consensus        26 ~~~~~~~~l~~~~~~~~-~~~~~~-~~w~~~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~  102 (968)
T PLN00113         26 LHAEELELLLSFKSSIN-DPLKYL-SNWNSSADVCLWQGITCNN-SSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSN  102 (968)
T ss_pred             CCHHHHHHHHHHHHhCC-CCcccC-CCCCCCCCCCcCcceecCC-CCcEEEEEecCCCccccCChHHhCCCCCCEEECCC
Confidence            35689999999999986 777777 8998888999999999985 35899999999999888888999999999999999


Q ss_pred             CcccCCCCcccc-CCCCCcEEEcccCcccccCCccCCCCCCCcEEEeeccccccccChhhhcCCCCCcEEEeeccccccc
Q 041953           87 NRLSGSIPSAIF-TTYTLKYVSFRKNQLSGAFPSFAFNTSSLQYLDFGFNTLSGEIPANICSNLPFLEYLALSQNMFHGG  165 (279)
Q Consensus        87 ~~i~~~~~~~~~-~~~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~  165 (279)
                      |.+.+.+|..+. .+.+|++|++++|.+.+.+|.  ..+++|++|++++|.+.+.+|..+ .++++|++|++++|.+.+.
T Consensus       103 n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~-~~l~~L~~L~L~~n~l~~~  179 (968)
T PLN00113        103 NQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDI-GSFSSLKVLDLGGNVLVGK  179 (968)
T ss_pred             CccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHH-hcCCCCCEEECccCccccc
Confidence            999877776654 778888888888877654443  234556666666665554444443 4555555555555555545


Q ss_pred             CCccCCCCccCcEEeccCCcccccCCcccCCCCCccEEEccCcccccccCccCCCCCCCCEEeccCCcCcccCCccccCC
Q 041953          166 IPSALSNCAYLQRLGLSSNDFSGVVPKEICNLTKLKGLYLGGNRLQGEIPRESGNLAELELMSLSENELQGAIPREWGNL  245 (279)
Q Consensus       166 ~~~~l~~l~~L~~L~l~~n~~~~~~~~~l~~~~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L~l~~n~i~~~~~~~~~~~  245 (279)
                      .|..+..+++|++|++++|.+.+..|..+..+++|+.|++++|.+.+.+|..+..+++|++|++++|++.+..|..+.++
T Consensus       180 ~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l  259 (968)
T PLN00113        180 IPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNL  259 (968)
T ss_pred             CChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCC
Confidence            55555555555555555555554445445555555555555555444444444444555555555554444444444444


Q ss_pred             CCCCeEEccCCcccccCccccccc
Q 041953          246 TGLGILQLSDNFLTGITPSSIYKL  269 (279)
Q Consensus       246 ~~L~~L~l~~n~l~~~~~~~~~~~  269 (279)
                      ++|+.|++++|.+.+..|.++..+
T Consensus       260 ~~L~~L~L~~n~l~~~~p~~l~~l  283 (968)
T PLN00113        260 KNLQYLFLYQNKLSGPIPPSIFSL  283 (968)
T ss_pred             CCCCEEECcCCeeeccCchhHhhc
Confidence            444444444444444444444333



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-16
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-16
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-14
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 67.0 bits (162), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 64/253 (25%), Positives = 97/253 (38%), Gaps = 51/253 (20%) Query: 65 LTGTIPXXXXXXXXXXXXXXXXXXXXGSIPSAIFTTYTLKYVSFRKNQLSGAFPSFAFNT 124 L G IP G IPS + L ++S N+L+G P + Sbjct: 451 LEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRL 510 Query: 125 SSLQYLDFGFNTLSGEIPANI--CSNLPFLEYLALSQNMFHGGIPSAL------------ 170 +L L N+ SG IPA + C +L +L+ L+ N+F+G IP+A+ Sbjct: 511 ENLAILKLSNNSFSGNIPAELGDCRSLIWLD---LNTNLFNGTIPAAMFKQSGKIAANFI 567 Query: 171 --SNCAYLQRLGLSSN--------DFSGVVPKEI--------CNLTK------------- 199 Y++ G+ +F G+ +++ CN+T Sbjct: 568 AGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDN 627 Query: 200 ---LKGLYLGGNRLQGEIPRESGXXXXXXXXXXXXXXXQGAIPREWGNLTGLGILQLSDN 256 + L + N L G IP+E G G+IP E G+L GL IL LS N Sbjct: 628 NGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSN 687 Query: 257 FLTGITPSSIYKL 269 L G P ++ L Sbjct: 688 KLDGRIPQAMSAL 700
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-69
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-46
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-66
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-60
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-59
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-55
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-51
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-48
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-25
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-19
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-39
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-38
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-32
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-32
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-30
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-39
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-32
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-31
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-30
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-29
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-28
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-22
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-37
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-33
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-33
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-33
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-32
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-26
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-22
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-36
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-34
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-30
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-26
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-34
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-29
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-26
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-23
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-31
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-28
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-30
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-27
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-25
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-23
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-23
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 9e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-25
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-19
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-23
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-24
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-20
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-22
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 6e-21
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-22
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-22
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-23
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-21
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-20
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-22
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-19
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-22
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-16
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-13
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-22
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-20
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-19
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-22
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-16
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-22
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-21
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-12
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 1e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-18
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-20
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-12
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-20
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 8e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-16
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 5e-09
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-17
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-12
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-14
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-16
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 5e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-09
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-14
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-14
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 3e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-10
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 5e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-12
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 2e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-08
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-08
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-06
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-08
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-06
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 4e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 5e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 4e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 5e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 8e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  215 bits (550), Expect = 4e-69
 Identities = 77/287 (26%), Positives = 117/287 (40%), Gaps = 36/287 (12%)

Query: 10  TDRDALLALKAHITHDPTNFFAKNWNTSTPVCN--WTGVTCDV--HSHRVTVLNISRLNL 65
            D+ ALL +K  +  +PT     +W  +T  CN  W GV CD    ++RV  L++S LNL
Sbjct: 6   QDKQALLQIKKDLG-NPTTL--SSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNL 62

Query: 66  ---------------------------TGTIPSQLGNLSSLQSLNLSCNRLSGSIPSAIF 98
                                       G IP  +  L+ L  L ++   +SG+IP  + 
Sbjct: 63  PKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLS 122

Query: 99  TTYTLKYVSFRKNQLSGAFPSFAFNTSSLQYLDFGFNTLSGEIPANICSNLPFLEYLALS 158
              TL  + F  N LSG  P    +  +L  + F  N +SG IP +  S       + +S
Sbjct: 123 QIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTIS 182

Query: 159 QNMFHGGIPSALSNCAYLQRLGLSSNDFSGVVPKEICNLTKLKGLYLGGNRLQGEIPRES 218
           +N   G IP   +N   L  + LS N   G       +    + ++L  N L  ++  + 
Sbjct: 183 RNRLTGKIPPTFANLN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KV 240

Query: 219 GNLAELELMSLSENELQGAIPREWGNLTGLGILQLSDNFLTGITPSS 265
           G    L  + L  N + G +P+    L  L  L +S N L G  P  
Sbjct: 241 GLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG 287


>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query279
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.98
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.96
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.94
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.93
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.93
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.93
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.93
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.93
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.93
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.92
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.92
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.92
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.92
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.91
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.91
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.91
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.89
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.89
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.89
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.89
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.88
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.87
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.85
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.85
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.85
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.84
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.84
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.83
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.83
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.83
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.83
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.83
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.82
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.82
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.81
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.81
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.8
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.8
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.8
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.79
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.79
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.78
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.77
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.76
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.76
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.71
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.71
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.67
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.64
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.63
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.61
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.6
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.6
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.59
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.57
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.55
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.54
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.54
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.53
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.47
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.46
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.46
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.44
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.42
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.34
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.33
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.24
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.18
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.08
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.95
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.92
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.91
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.58
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.55
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.53
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.37
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.36
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.22
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.18
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.4
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.23
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.16
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.53
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 88.13
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=4.9e-39  Score=268.28  Aligned_cols=258  Identities=33%  Similarity=0.543  Sum_probs=192.7

Q ss_pred             CCChhHHHHHHHHHHhccCCCcccccCCCCCCCCCcc--eeeeeeCCCC--CeEEEEEcCCCCccc--cCcccccCCCCC
Q 041953            6 STITTDRDALLALKAHITHDPTNFFAKNWNTSTPVCN--WTGVTCDVHS--HRVTVLNISRLNLTG--TIPSQLGNLSSL   79 (279)
Q Consensus         6 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~w~~~~~~c~--~~~~~~~~~~--~~l~~L~l~~~~l~~--~~~~~~~~l~~L   79 (279)
                      .+.++|.++|++||+.+. +|. .+ .+|..+.++|.  |.|+.|+...  .+|+.|+++++.+.+  .+|..|.++++|
T Consensus         2 ~c~~~~~~aL~~~k~~~~-~~~-~l-~~W~~~~~~C~~~w~gv~C~~~~~~~~l~~L~L~~~~l~~~~~~~~~l~~l~~L   78 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLG-NPT-TL-SSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYL   78 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTT-CCG-GG-TTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTC
T ss_pred             CCCHHHHHHHHHHHHhcC-Ccc-cc-cCCCCCCCCCcCCCcceEeCCCCCCceEEEEECCCCCccCCcccChhHhCCCCC
Confidence            477899999999999996 665 55 89988888998  9999998643  689999999999998  889999999999


Q ss_pred             CEEEccC-CcccCCCCccccCCCCCcEEEcccCcccccCCccCCCCCCCcEEEeeccccccccChhhhcCCCCCcEEEee
Q 041953           80 QSLNLSC-NRLSGSIPSAIFTTYTLKYVSFRKNQLSGAFPSFAFNTSSLQYLDFGFNTLSGEIPANICSNLPFLEYLALS  158 (279)
Q Consensus        80 ~~L~l~~-~~i~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~l~  158 (279)
                      ++|++++ |.+.+.+|..|..+++|++|++++|.+.+.+|..+..+++|++|++++|.+.+.+|..+ ..+++|++|+++
T Consensus        79 ~~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~-~~l~~L~~L~L~  157 (313)
T 1ogq_A           79 NFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSI-SSLPNLVGITFD  157 (313)
T ss_dssp             SEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGG-GGCTTCCEEECC
T ss_pred             CeeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHH-hcCCCCCeEECc
Confidence            9999995 88888889999999999999999999988888888889999999999998876666655 778888888888


Q ss_pred             cccccccCCccCCCCc-cCcEEeccCCcccccCCcccCCCCCccEEEccCcccccccCccCCCCCCCCEEeccCCcCccc
Q 041953          159 QNMFHGGIPSALSNCA-YLQRLGLSSNDFSGVVPKEICNLTKLKGLYLGGNRLQGEIPRESGNLAELELMSLSENELQGA  237 (279)
Q Consensus       159 ~n~l~~~~~~~l~~l~-~L~~L~l~~n~~~~~~~~~l~~~~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L~l~~n~i~~~  237 (279)
                      +|.+++..|..+..++ .|+.|++++|.+.+..|..+..+. |+.|++++|.+++..|..+..+++|+.|++++|++++.
T Consensus       158 ~N~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~~~~~l~-L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~  236 (313)
T 1ogq_A          158 GNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFD  236 (313)
T ss_dssp             SSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCC-CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCB
T ss_pred             CCcccCcCCHHHhhhhhcCcEEECcCCeeeccCChHHhCCc-ccEEECcCCcccCcCCHHHhcCCCCCEEECCCCceeee
Confidence            8888877777777776 778888887777766665555554 66666666655544455555445555555554444433


Q ss_pred             CCccccCCCCCCeEEccCCcccccCccccccc
Q 041953          238 IPREWGNLTGLGILQLSDNFLTGITPSSIYKL  269 (279)
Q Consensus       238 ~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~  269 (279)
                      .+. +..+++|++|++++|.+++..|..+..+
T Consensus       237 ~~~-~~~l~~L~~L~Ls~N~l~~~~p~~l~~l  267 (313)
T 1ogq_A          237 LGK-VGLSKNLNGLDLRNNRIYGTLPQGLTQL  267 (313)
T ss_dssp             GGG-CCCCTTCCEEECCSSCCEECCCGGGGGC
T ss_pred             cCc-ccccCCCCEEECcCCcccCcCChHHhcC
Confidence            322 3344444444444444444444444433



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 279
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-25
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-09
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-17
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-17
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 9e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 4e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 8e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.002
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score =  100 bits (248), Expect = 2e-25
 Identities = 79/286 (27%), Positives = 109/286 (38%), Gaps = 34/286 (11%)

Query: 10  TDRDALLALKAHITHDPTNFFAKNWNTSTPVCN--WTGVTCD--VHSHRVTVLNISRLNL 65
            D+ ALL +K  +  +PT     +W  +T  CN  W GV CD    ++RV  L++S LNL
Sbjct: 6   QDKQALLQIKKDLG-NPTTL--SSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNL 62

Query: 66  TG--TIPSQLGNLSSLQSLNLS-CNRLSGSIPSAIFTTYTLKYVSFRKNQLSGAFPSFAF 122
                IPS L NL  L  L +   N L G IP AI     L Y+      +SGA P F  
Sbjct: 63  PKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLS 122

Query: 123 NTSSLQYLDFGFNTLSGEIPANICSNLPFLEYLALSQNMFHGGIPSALSNCAYL------ 176
              +L  LDF +N LSG +P +I  +LP L  +    N   G IP +  + + L      
Sbjct: 123 QIKTLVTLDFSYNALSGTLPPSIS-SLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTI 181

Query: 177 -----------------QRLGLSSNDFSGVVPKEICNLTKLKGLYLGGNRLQGEIPRESG 219
                                  S +        +    K                 + G
Sbjct: 182 SRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVG 241

Query: 220 NLAELELMSLSENELQGAIPREWGNLTGLGILQLSDNFLTGITPSS 265
               L  + L  N + G +P+    L  L  L +S N L G  P  
Sbjct: 242 LSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG 287


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query279
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.86
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.81
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.81
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.8
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.8
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.79
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.77
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.75
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.65
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.59
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.57
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.56
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.55
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.53
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.43
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.35
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.34
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.34
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.34
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.32
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.24
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.91
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.31
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.3
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.84
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.73
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.2
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.06
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=3.2e-36  Score=249.38  Aligned_cols=261  Identities=33%  Similarity=0.491  Sum_probs=219.1

Q ss_pred             CCChhHHHHHHHHHHhccCCCcccccCCCCCCCCCcc--eeeeeeCCCC--CeEEEEEcCCCCccc--cCcccccCCCCC
Q 041953            6 STITTDRDALLALKAHITHDPTNFFAKNWNTSTPVCN--WTGVTCDVHS--HRVTVLNISRLNLTG--TIPSQLGNLSSL   79 (279)
Q Consensus         6 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~w~~~~~~c~--~~~~~~~~~~--~~l~~L~l~~~~l~~--~~~~~~~~l~~L   79 (279)
                      -+.++|++||++||+.+. +|. .+ .+|..+.++|.  |.|+.|+...  .+|+.|+|+++++.+  .+|..+.++++|
T Consensus         2 ~c~~~e~~aLl~~k~~~~-~~~-~l-~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L   78 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLG-NPT-TL-SSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYL   78 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTT-CCG-GG-TTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTC
T ss_pred             CCCHHHHHHHHHHHHHCC-CCC-cC-CCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChHHhcCccc
Confidence            478999999999999997 554 45 88988889994  9999998643  489999999999986  478999999999


Q ss_pred             CEEEccC-CcccCCCCccccCCCCCcEEEcccCcccccCCccCCCCCCCcEEEeeccccccccChhhhcCCCCCcEEEee
Q 041953           80 QSLNLSC-NRLSGSIPSAIFTTYTLKYVSFRKNQLSGAFPSFAFNTSSLQYLDFGFNTLSGEIPANICSNLPFLEYLALS  158 (279)
Q Consensus        80 ~~L~l~~-~~i~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~l~  158 (279)
                      ++|++++ |.+.+.+|..+..+++|++|++++|++.+..+..+..+.+|+.+++++|.+.+.+|..+ .+++.+++++++
T Consensus        79 ~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l-~~l~~L~~l~l~  157 (313)
T d1ogqa_          79 NFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSI-SSLPNLVGITFD  157 (313)
T ss_dssp             SEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGG-GGCTTCCEEECC
T ss_pred             cccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhh-ccCcccceeecc
Confidence            9999987 88988999999999999999999999998888888889999999999998886777666 789999999999


Q ss_pred             cccccccCCccCCCCccC-cEEeccCCcccc-----------------------cCCcccCCCCCccEEEccCccccccc
Q 041953          159 QNMFHGGIPSALSNCAYL-QRLGLSSNDFSG-----------------------VVPKEICNLTKLKGLYLGGNRLQGEI  214 (279)
Q Consensus       159 ~n~l~~~~~~~l~~l~~L-~~L~l~~n~~~~-----------------------~~~~~l~~~~~L~~L~l~~n~~~~~~  214 (279)
                      +|.+.+.+|..+..+..+ +.+++++|.+.+                       ..|..+..+++++.++++++.+.+.+
T Consensus       158 ~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~  237 (313)
T d1ogqa_         158 GNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDL  237 (313)
T ss_dssp             SSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBG
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            998887788777766554 666666665543                       34445566678889999999887554


Q ss_pred             CccCCCCCCCCEEeccCCcCcccCCccccCCCCCCeEEccCCcccccCcccccccccc
Q 041953          215 PRESGNLAELELMSLSENELQGAIPREWGNLTGLGILQLSDNFLTGITPSSIYKLLFS  272 (279)
Q Consensus       215 ~~~~~~~~~L~~L~l~~n~i~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~  272 (279)
                      + .+..+++|+.|++++|++++.+|..+.++++|++|++++|.++|.+|+ ++.+.++
T Consensus       238 ~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L  293 (313)
T d1ogqa_         238 G-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRF  293 (313)
T ss_dssp             G-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGS
T ss_pred             c-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccCCCC
Confidence            4 678889999999999999999999999999999999999999998874 4444443



>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure