Citrus Sinensis ID: 041975

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540---
MLLQIHYVPDYIVWQSIAILSVSYFHLAVDKGSEAIEGISLDMSKVKEICMHPSIFTKMHRLRFFKFYNSISGENRCKVHHVRSMESLFNEQRYFHWDGYPLKTLPSKISPEHLVSLEMPNSNIEQLWNDVQLEELPSSIGNLSRLVTLDLRKCLRLKKVSSSLCNLKSLESLYLSGCLKLEKLPEEIGNLGSLKNMVANEIAISQVPSSISCLNRVELLSFAGCKGRPPQMGLKLPILFQSQILENLSLINCNIIELPESLGQLPSLKYLNLEENNFEKIPSNIKQVSKLSLLILDNWKRFLSLPELPCGSSVYARHCTSLETLSNLSTLFKPLCQKFDFCNCFKLNRNEVREIVEEALKKIQVLATWWKEQDLEDDHHPPRGSIWYPGSEIPEWFSFQSMGSSVTLELPPGWFYNNFVGFALCAIFPEFRGDTRNLLVDSEFKLKTKDGDWHVATYLLFVWNEDFGVNSSLESDHVLLGYDFSMDLDGLGGSDKACIQFYIGNYLDKRTEGFDVKKCGAHLIYAQDPSKRLRSKVEDDQVL
cccccccccccccccHHHHHHHHHHHcccccccccEEEEEEEcccccEEEEcHHHHcccccccEEEEEcccccccccEEEccccccccccccEEEEEccccccccccccccccccEEEcccccccccccccccEEccccccccccccEEEcccccccEEccccccccccccEEEccccccccccccccccccccHHHcccccccEEccccccccccccEEEcccccccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccEEEcccccccEEEccccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEccccccccccccccccEEEEEcccccccccccEEEEEEEEcccccccccccEEEEEEEEEccccEEEEEEEEEEEcccccccccccccEEEEEEccccccccccccccEEEEEEEEEccccccccEEEEEEEEEEEEEccccccccccccccccc
cEEEEEEcccEEEEcHHHHHHHHHHHHHccccccEEEEEEEEccccccccccHHHHHHcHccEEEEEEcccccccccEEEcccccccccHHHEEEEccccccccccccccHHHHEEEccccHHHHHHHcccccEcccccHHccHcccEEcccccccHHHccccHHHHHcccEEEccccHHHHcccccHHHHHHHHEEEcccccEEcccccHHHHHHHHEEcccccccccccccccccHHHccccccEEEcccccccccccccccccHccEEEccccccccccHHHHHHHHccEEEcccccHcccccccccccEEEcccccccEEccccccccccccEEEEEcccHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEccccccHHHcccccccEEEEEcccccccccccEEEEEEEEEcccccccccEEEEEEEEEEcccccEEcccEEccccccccccccccccEEEEEEcccccccccccccEEEEEEEEEcccccccccEEEEEcEEEEEEEccccccccccccccccc
mllqihyvpdyIVWQSIAILSVSYFHLAVDKGSEAIEGISLDMSKVKEicmhpsiftkmHRLRFFKFYnsisgenrckvHHVRSMEslfneqryfhwdgyplktlpskispehlvslempnsnieQLWNDvqleelpssignlsrLVTLDLRKCLRLKKVSSSLCNLKSLESLYLSGCLKLEKLPEEIGNLGSLKNMVANEIaisqvpssisclnRVELLsfagckgrppqmglklpiLFQSQILENLSlincniielpeslgqlpslkylnleennfekipsnikQVSKLSLLILDNWKrflslpelpcgssvyarhctsletlsnlstlfkplcqkfdfcncfklnRNEVREIVEEALKKIQVLATWWkeqdleddhhpprgsiwypgseipewfsfqsmgssvtlelppgwfynnfvgfalcaifpefrgdtrnllvdsefklktkdgdWHVATYLLFVWnedfgvnsslesDHVLlgydfsmdldglggsdkACIQFYIGNYldkrtegfdvkkcGAHLIyaqdpskrlrskveddqvl
MLLQIHYVPDYIVWQSIAILSVSYFHLAVDKGSEAIEGISLDMSKVKEICMHPSIFTKMHRLRFFKFYNSISGENRCKVHHVRSMESLFNEQRYFHWDGYPLKTLPSKISPEHLVSLEMPNSNIEQLWNDVQLEELPSSIGNLSRLVTLDLRKCLRLKKvssslcnlkslESLYLSGCLKLEKLPEEIGNLGSLKNMVANEIAISQVPSSISCLNRVELLSFAGCKGRPPQMGLKLPILFQSQILENLSLINCNIIELPESLGQLPSLKYLNLEENNFEKIPSNIKQVSKLSLLILDNWKRFLSLPELPCGSSVYARHCTSLETLSNLSTLFKPLCQKFDFCNCFKLNRNEVREIVEEALKKIQVLATWWKEQDLEDDHHPPRGSIWYPGSEIPEWFSFQSMGSSVTLELPPGWFYNNFVGFALCAIFPEFRGDTRNLLVDSEFKLKTKDGDWHVATYLLFVWNEDFGVNSSLESDHVLLGYDFSMDLDGLGGSDKACIQFYIGNYLDKRTEGFDVKKCGAHLiyaqdpskrlrskveddqvl
MLLQIHYVPDYIVWQSIAILSVSYFHLAVDKGSEAIEGISLDMSKVKEICMHPSIFTKMHRLRFFKFYNSISGENRCKVHHVRSMESLFNEQRYFHWDGYPLKTLPSKISPEHLVSLEMPNSNIEQLWNDVQLEELPSSIGNLSRLVTLDLRKCLRLKKVSSSLCNLKSLESLYLSGCLKLEKLPEEIGNLGSLKNMVANEIAISQVPSSISCLNRVELLSFAGCKGRPPQMGLKLPILFQSQILENLSLINCNIIELPESLGQLPSLKYLNLEENNFEKIPSNIKQVSKLSLLILDNWKRFLSLPELPCGSSVYARHCtsletlsnlstlFKPLCQKFDFCNCFKLNRNEVREIVEEALKKIQVLATWWKEQDLEDDHHPPRGSIWYPGSEIPEWFSFQSMGSSVTLELPPGWFYNNFVGFALCAIFPEFRGDTRNLLVDSEFKLKTKDGDWHVATYLLFVWNEDFGVNSSLESDHVLLGYDFSMDLDGLGGSDKACIQFYIGNYLDKRTEGFDVKKCGAHLIYAQDPSKRLRSKVEDDQVL
**LQIHYVPDYIVWQSIAILSVSYFHLAVDKGSEAIEGISLDMSKVKEICMHPSIFTKMHRLRFFKFYNSISGENRCKVHHVRSMESLFNEQRYFHWDGYPLKTLPSKISPEHLVSLEMPNSNIEQLWNDVQLEELPSSIGNLSRLVTLDLRKCLRLKKVSSSLCNLKSLESLYLSGCLKLEKLPEEIGNLGSLKNMVANEIAISQVPSSISCLNRVELLSFAGCKGRPPQMGLKLPILFQSQILENLSLINCNIIELPESLGQLPSLKYLNLEENNFEKIPSNIKQVSKLSLLILDNWKRFLSLPELPCGSSVYARHCTSLETLSNLSTLFKPLCQKFDFCNCFKLNRNEVREIVEEALKKIQVLATWWKEQDLED****PRGSIWYPGSEIPEWFSFQSMGSSVTLELPPGWFYNNFVGFALCAIFPEFRGDTRNLLVDSEFKLKTKDGDWHVATYLLFVWNEDFGVNSSLESDHVLLGYDFSMDLDGLGGSDKACIQFYIGNYLDKRTEGFDVKKCGAHLIYA*****************
MLLQ**YVPDYIVWQSIAILSVSYFHLAVDKGSEAIEGISLDMSKVKEICMHPSIFTKMHRLRFFKFYNSISGENRCKVHHVRSMESLFNEQRYFHWDGYPLKTLPSKISPEHLVSLEMPNSNIEQLWNDVQLEELPSSIGNLSRLVTLDLRKCLRLKKVSSSLCNLKSLESLYLSGCLKLEKLPEEIGNLGSLKNMVANEIAISQVPSSISCLNRVELLSFAGCKGRPP**G*KLPILFQSQILENLSLINCNIIELPESLGQLPSLKYLNLEENNFEKIPSNIKQVSKLSLLILDNWKRFLSLPELPCGSSVYARHCTSLETLSNLSTLFKPLCQKFDFCNCFKLNRNEVREIVEEALKKIQVLATWWKEQDLEDDHHPPRGSIWYPGSEIPEWFSFQSMGSSVTLELPPGWFYNNFVGFALCAIFPEFRGDTRNLLVDSEFKLKTKDGDWHVATYLLFVWNEDFGVNSSLESDHVLLGYDFSMDLDGLGGSDKACIQFYIGNYLDKRTEGFDVKKCGAHLIY******************
MLLQIHYVPDYIVWQSIAILSVSYFHLAVDKGSEAIEGISLDMSKVKEICMHPSIFTKMHRLRFFKFYNSISGENRCKVHHVRSMESLFNEQRYFHWDGYPLKTLPSKISPEHLVSLEMPNSNIEQLWNDVQLEELPSSIGNLSRLVTLDLRKCLRLKKVSSSLCNLKSLESLYLSGCLKLEKLPEEIGNLGSLKNMVANEIAISQVPSSISCLNRVELLSFAGCKGRPPQMGLKLPILFQSQILENLSLINCNIIELPESLGQLPSLKYLNLEENNFEKIPSNIKQVSKLSLLILDNWKRFLSLPELPCGSSVYARHCTSLETLSNLSTLFKPLCQKFDFCNCFKLNRNEVREIVEEALKKIQVLATWWKEQDLEDDHHPPRGSIWYPGSEIPEWFSFQSMGSSVTLELPPGWFYNNFVGFALCAIFPEFRGDTRNLLVDSEFKLKTKDGDWHVATYLLFVWNEDFGVNSSLESDHVLLGYDFSMDLDGLGGSDKACIQFYIGNYLDKRTEGFDVKKCGAHLIYAQDPS*************
MLLQIHYVPDYIVWQSIAILSVSYFHLAVDKGSEAIEGISLDMSKVKEICMHPSIFTKMHRLRFFKFYNSISGENRCKVHHVRSMESLFNEQRYFHWDGYPLKTLPSKISPEHLVSLEMPNSNIEQLWNDVQLEELPSSIGNLSRLVTLDLRKCLRLKKVSSSLCNLKSLESLYLSGCLKLEKLPEEIGNLGSLKNMVANEIAISQVPSSISCLNRVELLSFAGCKGRPPQMGLKLPILFQSQILENLSLINCNIIELPESLGQLPSLKYLNLEENNFEKIPSNIKQVSKLSLLILDNWKRFLSLPELPCGSSVYARHCTSLETLSNLSTLFKPLCQKFDFCNCFKLNRNEVREIVEEALKKIQVLATWWKEQDLEDDHHPPRGSIWYPGSEIPEWFSFQSMGSSVTLELPPGWFYNNFVGFALCAIFPEFRGDTRNLLVDSEFKLKTKDGDWHVATYLLFVWNEDFGVNSSLESDHVLLGYDFSMDLDGLGGSDKACIQFYIGNYLDKRTEGFDVKKCGAHLIYAQD***************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLQIHYVPDYIVWQSIAILSVSYFHLAVDKGSEAIEGISLDMSKVKEICMHPSIFTKMHRLRFFKFYNSISGENRCKVHHVRSMESLFNEQRYFHWDGYPLKTLPSKISPEHLVSLEMPNSNIEQLWNDVQLEELPSSIGNLSRLVTLDLRKCLRLKKVSSSLCNLKSLESLYLSGCLKLEKLPEEIGNLGSLKNMVANEIAISQVPSSISCLNRVELLSFAGCKGRPPQMGLKLPILFQSQILENLSLINCNIIELPESLGQLPSLKYLNLEENNFEKIPSNIKQVSKLSLLILDNWKRFLSLPELPCGSSVYARHCTSLETLSNLSTLFKPLCQKFDFCNCFKLNRNEVREIVEEALKKIQVLATWWKEQDLEDDHHPPRGSIWYPGSEIPEWFSFQSMGSSVTLELPPGWFYNNFVGFALCAIFPEFRGDTRNLLVDSEFKLKTKDGDWHVATYLLFVWNEDFGVNSSLESDHVLLGYDFSMDLDGLGGSDKACIQFYIGNYLDKRTEGFDVKKCGAHLIYAQDPSKRLRSKVEDDQVL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query543 2.2.26 [Sep-21-2011]
Q403921144 TMV resistance protein N N/A no 0.500 0.237 0.356 6e-29
O825001095 Putative disease resistan no no 0.605 0.300 0.267 5e-26
Q9FL92 1372 Probable WRKY transcripti no no 0.861 0.341 0.257 2e-24
Q9SZ67 1895 Probable WRKY transcripti no no 0.478 0.137 0.308 4e-23
Q9FH83 1288 Probable WRKY transcripti no no 0.887 0.374 0.241 2e-19
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.664 0.223 0.279 1e-14
O23530 1301 Protein SUPPRESSOR OF npr no no 0.423 0.176 0.286 6e-12
Q14160 1630 Protein scribble homolog yes no 0.337 0.112 0.316 2e-11
O61967 699 Protein lap1 OS=Caenorhab yes no 0.257 0.200 0.323 4e-11
Q80U72 1612 Protein scribble homolog yes no 0.294 0.099 0.343 3e-10
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score =  129 bits (324), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 111/311 (35%), Positives = 157/311 (50%), Gaps = 39/311 (12%)

Query: 133  LEELPSSIGNLSRLVT-LDLRKCLRLKKVSSSLCNLKSLESLYLSGCLKLEKLPEEIGNL 191
            + ELPSSI      VT L L     L  + SS+C LKSL SL +SGC KLE LPEEIG+L
Sbjct: 724  IRELPSSIFQYKTHVTKLLLWNMKNLVALPSSICRLKSLVSLSVSGCSKLESLPEEIGDL 783

Query: 192  GSLKNMVANEIAISQVPSSISCLNRVELLSFAGCKGRPPQMGLKL---PILFQSQILENL 248
             +L+   A++  I + PSSI  LN++ +L F G K      G+     P+      LE L
Sbjct: 784  DNLRVFDASDTLILRPPSSIIRLNKLIILMFRGFKD-----GVHFEFPPVAEGLHSLEYL 838

Query: 249  SLINCNIIE--LPESLGQLPSLKYLNLEENNFEKIPSNIKQVSKLSLLILDNWKRFLSLP 306
            +L  CN+I+  LPE +G L SLK L+L  NNFE +PS+I Q+  L  L L + +R   LP
Sbjct: 839  NLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGALQSLDLKDCQRLTQLP 898

Query: 307  ELPCGSSVYARHC-TSLETLSNLSTLFKPLCQKFDFCNCFKLNRNEVREIVEEALKKIQV 365
            ELP   +     C  +L+ +  L T  K            KL+R ++ +   + +  +  
Sbjct: 899  ELPPELNELHVDCHMALKFIHYLVTKRK------------KLHRVKLDDAHNDTMYNLFA 946

Query: 366  LATWWKEQDLEDDHHPPRGSIW----------YPGSEIPEWFSFQSMGSSVTLELPPGWF 415
               +   Q++    H    S            YP  +IP WF  Q   SSV++ LP  W+
Sbjct: 947  YTMF---QNISSMRHDISASDSLSLTVFTGQPYP-EKIPSWFHHQGWDSSVSVNLPENWY 1002

Query: 416  Y-NNFVGFALC 425
              + F+GFA+C
Sbjct: 1003 IPDKFLGFAVC 1013
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 Back     alignment and function description
>sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 Back     alignment and function description
>sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query543
296090597 1201 unnamed protein product [Vitis vinifera] 0.889 0.402 0.333 8e-68
359493489 1092 PREDICTED: TMV resistance protein N-like 0.885 0.440 0.337 6e-59
255537139 1137 leucine-rich repeat-containing protein, 0.915 0.437 0.309 2e-58
359495289 1133 PREDICTED: TMV resistance protein N-like 0.685 0.328 0.369 5e-58
147817181 1015 hypothetical protein VITISV_018104 [Viti 0.685 0.366 0.367 3e-57
359496034 1132 PREDICTED: TMV resistance protein N-like 0.841 0.403 0.317 2e-56
359486075 1291 PREDICTED: TMV resistance protein N-like 0.749 0.315 0.358 3e-55
147770134 1414 hypothetical protein VITISV_040107 [Viti 0.749 0.287 0.358 3e-55
359495270 1154 PREDICTED: TMV resistance protein N-like 0.882 0.415 0.315 9e-52
297794743 1184 predicted protein [Arabidopsis lyrata su 0.841 0.385 0.324 2e-51
>gi|296090597|emb|CBI40966.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  264 bits (675), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 194/582 (33%), Positives = 290/582 (49%), Gaps = 99/582 (17%)

Query: 23   SYFHLAVDKGSEAIEGISLDMSKVKEICMHPSIFTKMHRLRFFKFYN-------SISGEN 75
            +Y  L+ + G++ +EGI  ++S ++EI      F  M +LR  KFY+         + + 
Sbjct: 511  AYHVLSKNTGTQEVEGIFFNLSDIEEIHFTTKAFAGMDKLRLLKFYDYSPSTNSECTSKR 570

Query: 76   RCKVHHVRSMESLFNEQRYFHWDGYPLKTLPSKISPEHLVSLEMPNSNIEQLWNDVQ--- 132
            +CKVH  R  +  +NE RY H  GYPL+ LP   SP++LV L +  S+++QLW  ++   
Sbjct: 571  KCKVHIPRDFKFHYNELRYLHLHGYPLEQLPHDFSPKNLVDLSLSCSDVKQLWKGIKVLD 630

Query: 133  -----------------------------------LEELPSSIGNLSRLVTLDLRKCLRL 157
                                               L E+  ++G L +L  L LR C  L
Sbjct: 631  KLKFMDLSHSKYLVETPNFSGISNLEKLDLTGCTYLREVHPTLGVLGKLSFLSLRDCKML 690

Query: 158  KKVSSSLCNLKSLESLYLSGCLKLEKLPEEIGNLGSLKNMVANEIAISQVPSSISCLNRV 217
            K + +S+C LKSLE+   SGC K+E  PE  GNL  LK + A+E AIS +PSSI  L  +
Sbjct: 691  KNIPNSICKLKSLETFIFSGCSKVENFPENFGNLEQLKELYADETAISALPSSICHLRIL 750

Query: 218  ELLSFAGCKGRPPQMGLKLPILFQSQ-------------ILENLSLINCNIIELPE--SL 262
            ++LSF GCKG P    L L     S               L+ L+L +CNI E  +   L
Sbjct: 751  QVLSFNGCKGPPSASWLTLLPRKSSNSGKFLLSPLSGLGSLKELNLRDCNISEGADLSHL 810

Query: 263  GQLPSLKYLNLEENNFEKIPSNIKQVSKLSLLILDNWKRFLSLPELPCG-SSVYARHCTS 321
              L SL+YL+L  NNF  +PS++ Q+S+L  L L N +R  +L ELP     + A +C S
Sbjct: 811  AILSSLEYLDLSGNNFISLPSSMSQLSQLVSLKLQNCRRLQALSELPSSIKEIDAHNCMS 870

Query: 322  LETLSNLSTLFKPLCQKFDFCNCFKLN--RNEVREIVEEALKKIQVLATWWK--EQDLED 377
            LET+SN S    P  +   F  C K+   +N +  +       +Q LAT+ +  ++    
Sbjct: 871  LETISNRSLF--PSLRHVSFGECLKIKTYQNNIGSM-------LQALATFLQTHKRSRYA 921

Query: 378  DHHPPRGSIWY----PGSEIPEWFSFQSMGSSVTLELPPGWFYNNFVGFALCAIF----- 428
              +P   +I +    PGSEIP+WFS+QS G+ V +ELPP WF +NF+GFAL A+F     
Sbjct: 922  RDNPESVTIEFSTVVPGSEIPDWFSYQSSGNVVNIELPPNWFNSNFLGFALSAVFGFDPL 981

Query: 429  PEFRGDTRNLLVDSEFKLKTKDGDWHVATYLLFVWNEDFGVNSSLESDHVLLGYDFSMDL 488
            P++  + +   +   F  +        A+Y   V++ + G  + +ESDH+ LGY   +  
Sbjct: 982  PDYNPNHKVFCLFCIFSFQNS-----AASYRDNVFHYNSG-PALIESDHLWLGYAPVVSS 1035

Query: 489  DGLGGSD--KACIQFYIGNYLDKRTEGFDVKKCGAHLIYAQD 528
                  +  KA  Q Y           F VK+CG HL+Y+ +
Sbjct: 1036 FKWHEVNHFKAAFQIY--------GRHFVVKRCGIHLVYSSE 1069

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359493489|ref|XP_002264004.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255537139|ref|XP_002509636.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223549535|gb|EEF51023.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359495289|ref|XP_002276927.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147817181|emb|CAN77679.1| hypothetical protein VITISV_018104 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496034|ref|XP_002277500.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486075|ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147770134|emb|CAN76615.1| hypothetical protein VITISV_040107 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495270|ref|XP_002276075.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297794743|ref|XP_002865256.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297311091|gb|EFH41515.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query543
TAIR|locus:21181061219 AT4G12010 [Arabidopsis thalian 0.749 0.333 0.300 8.8e-43
TAIR|locus:21229651210 AT4G19510 [Arabidopsis thalian 0.672 0.301 0.323 4.5e-41
TAIR|locus:2081810 1226 AT3G51570 [Arabidopsis thalian 0.484 0.214 0.294 2.9e-34
TAIR|locus:2155189980 AT5G49140 [Arabidopsis thalian 0.631 0.35 0.301 9.6e-31
TAIR|locus:21954781031 AT1G63870 [Arabidopsis thalian 0.602 0.317 0.315 6.5e-30
TAIR|locus:20266241131 AT1G63750 [Arabidopsis thalian 0.627 0.301 0.304 8.3e-30
TAIR|locus:21604871085 AT5G41550 [Arabidopsis thalian 0.626 0.313 0.291 9.4e-30
UNIPROTKB|Q403921144 N "TMV resistance protein N" [ 0.476 0.226 0.364 1.7e-29
TAIR|locus:21532071165 AT5G45060 [Arabidopsis thalian 0.683 0.318 0.294 4.6e-28
TAIR|locus:21604721038 AT5G41540 [Arabidopsis thalian 0.664 0.347 0.300 4.9e-28
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 464 (168.4 bits), Expect = 8.8e-43, P = 8.8e-43
 Identities = 128/426 (30%), Positives = 199/426 (46%)

Query:   121 NSNIEQLWND-VQLEELPSSIGNLSRLVTLDLRKCLRLKKVSSSLCNLKSLESLYLSGCL 179
             + N+E L  D   ++ LP SI    RL  L+L+ C +LK +SS L  LK L+ L LSGC 
Sbjct:   733 SENVEVLLLDGTVIKSLPESIQTFRRLALLNLKNCKKLKHLSSDLYKLKCLQELILSGCS 792

Query:   180 KLEKLPEEIGNLGSLKNMVANEIAISQVPSSISCLNRVELLSFAGCKGRPPQMGLKLPIL 239
             +LE  PE   ++ SL+ ++ ++ +I+++P  +  L+ ++  S  G           +P  
Sbjct:   793 QLEVFPEIKEDMESLEILLMDDTSITEMPKMMH-LSNIKTFSLCGTSSHVSVSMFFMPPT 851

Query:   240 FQSQILENLSLINCNIIELPESLGQLPSLKYLNLEENNFEKIPSNIKQVSKLSLLILDNW 299
                  L +L L  C++ +LP+++G L SL+ L L  NN E +P +  Q++ L    L   
Sbjct:   852 LGCSRLTDLYLSRCSLYKLPDNIGGLSSLQSLCLSGNNIENLPESFNQLNNLKWFDLKFC 911

Query:   300 KRFLSLPELPCGSSVYARH-CXXXXXXXXXXXXF---KPLCQKFDFCNCFKLNRNEVREI 355
             K   SLP LP        H C                + +   F F NC+KLN++    +
Sbjct:   912 KMLKSLPVLPQNLQYLDAHECESLETLANPLTPLTVGERIHSMFIFSNCYKLNQDAQASL 971

Query:   356 VEEALKKIQVLATWWKEQDLEDDHHPPRGSIWYPGSEIPEWFSFQSMGSSVTLELPPGWF 415
             V  A  K Q++A    ++        P   I YP +EIP WF  Q +G S+ + LPP W 
Sbjct:   972 VGHARIKSQLMANASAKRYYRGFVPEPLVGICYPATEIPSWFCHQRLGRSLEIPLPPHWC 1031

Query:   416 YNNFVGFALCAI--FPEFRGDTRNLLVDSEFKLKTKDGDWHVATYLLFVWNEDFGVNS-- 471
               NFVG AL  +  F ++    +   V      + KD  +    + L  WNE  G  S  
Sbjct:  1032 DINFVGLALSVVVSFKDYEDSAKRFSVKCCGNFENKDSSFTRFDFTLAGWNEPCGSLSHE 1091

Query:   472 --SLESDHVLLGYDFSMDLDGLGGSDKAC------IQFYI-GNYLDKRTEGFDVKKCGAH 522
                L SDHV +GY+    +  + G   +C       +FY+  +   K+ E  +V KCG  
Sbjct:  1092 SRKLTSDHVFMGYNSCFLVKNVHGESNSCCYTKASFEFYVTDDETRKKIETCEVIKCGMS 1151

Query:   523 LIYAQD 528
             L+Y  +
Sbjct:  1152 LMYVPE 1157
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
TAIR|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081810 AT3G51570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155189 AT5G49140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195478 AT1G63870 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026624 AT1G63750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160487 AT5G41550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] Back     alignment and assigned GO terms
TAIR|locus:2153207 AT5G45060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160472 AT5G41540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query543
PLN032101153 PLN03210, PLN03210, Resistant to P 3e-28
PLN032101153 PLN03210, PLN03210, Resistant to P 2e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-09
PLN032101153 PLN03210, PLN03210, Resistant to P 1e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 4e-04
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 0.003
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score =  119 bits (300), Expect = 3e-28
 Identities = 96/336 (28%), Positives = 152/336 (45%), Gaps = 52/336 (15%)

Query: 30  DKGSEAIEGISLDMSKVKEICMHPSIFTKMHRLRFFKFYN-SISGENRCKVHHVRSMESL 88
           + G++ + GI+LD+ ++ E+ +H + F  M  L F KFY      +   + H     + L
Sbjct: 528 NTGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYL 587

Query: 89  FNEQRYFHWDGYPLKTLPSKISPEHLVSLEMPNSNIEQLWNDVQ---------------L 133
             + R   WD YPL+ +PS   PE+LV L+M  S +E+LW+ V                L
Sbjct: 588 PPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNL 647

Query: 134 EELPSSIGNLS---RLVTLDLRKCLRLKKVSSSLCNLKSLESLYLSGCLKLEKLPEEIGN 190
           +E+P    +LS    L TL L  C  L ++ SS+  L  LE L +S C  LE LP  I N
Sbjct: 648 KEIP----DLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-N 702

Query: 191 LGSLKNMVANEIA----ISQVPSSISCLNRVELLSFAGCKGRPPQMGLKLPILFQSQILE 246
           L SL  +  +  +       + ++IS L+    L     +  P  + L        + L+
Sbjct: 703 LKSLYRLNLSGCSRLKSFPDISTNISWLD----LDETAIEEFPSNLRL--------ENLD 750

Query: 247 NLSLINCNIIELPESLGQL--------PSLKYLNLEEN-NFEKIPSNIKQVSKLSLLILD 297
            L L      +L E +  L        PSL  L L +  +  ++PS+I+ + KL  L ++
Sbjct: 751 ELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIE 810

Query: 298 NWKRFLSLP---ELPCGSSVYARHCTSLETLSNLST 330
           N     +LP    L    S+    C+ L T  ++ST
Sbjct: 811 NCINLETLPTGINLESLESLDLSGCSRLRTFPDIST 846

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 543
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.93
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.91
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.87
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.87
PLN032101153 Resistant to P. syringae 6; Provisional 99.82
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.82
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.8
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.77
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.7
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.69
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.69
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.68
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.67
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.64
KOG4237498 consensus Extracellular matrix protein slit, conta 99.55
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.49
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.43
KOG4237498 consensus Extracellular matrix protein slit, conta 99.36
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.31
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.3
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.27
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.27
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.21
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.2
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.14
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.09
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.0
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.94
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.9
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.9
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.86
PLN03150623 hypothetical protein; Provisional 98.71
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.7
PLN03150623 hypothetical protein; Provisional 98.67
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.66
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.56
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.54
PRK15386426 type III secretion protein GogB; Provisional 98.51
PRK15386426 type III secretion protein GogB; Provisional 98.41
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.33
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.28
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.23
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.21
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.19
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.15
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.02
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.97
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.77
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.74
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.63
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.62
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.62
KOG4341483 consensus F-box protein containing LRR [General fu 97.55
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.5
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.43
KOG4341483 consensus F-box protein containing LRR [General fu 97.34
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.33
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.16
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.85
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.55
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.17
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.6
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.54
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.49
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.18
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.98
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.89
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.12
PF0772520 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Le 93.83
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.74
KOG4308478 consensus LRR-containing protein [Function unknown 93.5
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.21
KOG4308478 consensus LRR-containing protein [Function unknown 91.46
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.93
smart0037026 LRR Leucine-rich repeats, outliers. 89.64
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.64
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.88
KOG0473326 consensus Leucine-rich repeat protein [Function un 85.74
smart0037026 LRR Leucine-rich repeats, outliers. 85.26
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.26
KOG3864221 consensus Uncharacterized conserved protein [Funct 83.4
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=100.00  E-value=4.5e-46  Score=431.90  Aligned_cols=475  Identities=27%  Similarity=0.420  Sum_probs=323.7

Q ss_pred             cCccccccccchhhhhhhcccCcccccEEEEEeecCCceeeccChHHHhCCCCccEEEEecCCCC-CCcceeeecCCccc
Q 041975            9 PDYIVWQSIAILSVSYFHLAVDKGSEAIEGISLDMSKVKEICMHPSIFTKMHRLRFFKFYNSISG-ENRCKVHHVRSMES   87 (543)
Q Consensus         9 ~~~~~w~~~~i~~~i~~vL~~~~~~~~v~~i~L~~s~~~~~~i~~~~f~~l~~Lr~L~l~~n~~~-~~~~~~~~~~~l~~   87 (543)
                      ++.++|+..+    |++||++++|+++|++|.+|.+.+.+..+...+|.+|++|++|.++.+... .......+|.++..
T Consensus       511 ~r~~l~~~~d----i~~vl~~~~g~~~v~~i~l~~~~~~~~~i~~~aF~~m~~L~~L~~~~~~~~~~~~~~~~lp~~~~~  586 (1153)
T PLN03210        511 EREFLVDAKD----ICDVLEDNTGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDY  586 (1153)
T ss_pred             cceeEeCHHH----HHHHHHhCcccceeeEEEeccCccceeeecHHHHhcCccccEEEEecccccccccceeecCcchhh
Confidence            4567787766    589999999999999999999999989999999999999999999876321 12245678899999


Q ss_pred             ccccceEEEECCCCCCCCCCCCCCCCeeEEEcCCCCcccccccc---------------cccccCccccCCcCCcEEecc
Q 041975           88 LFNEQRYFHWDGYPLKTLPSKISPEHLVSLEMPNSNIEQLWNDV---------------QLEELPSSIGNLSRLVTLDLR  152 (543)
Q Consensus        88 l~~~Lr~L~l~~~~l~~lp~~~~l~~L~~L~L~~n~l~~l~~~~---------------~l~~lp~~l~~l~~L~~L~L~  152 (543)
                      +|++||+|+|.+|+++.+|..+.+.+|++|+|++|+++.+|.+.               .+..+|. ++.+++|++|+|+
T Consensus       587 lp~~Lr~L~~~~~~l~~lP~~f~~~~L~~L~L~~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~-ls~l~~Le~L~L~  665 (1153)
T PLN03210        587 LPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPD-LSMATNLETLKLS  665 (1153)
T ss_pred             cCcccEEEEecCCCCCCCCCcCCccCCcEEECcCccccccccccccCCCCCEEECCCCCCcCcCCc-cccCCcccEEEec
Confidence            99899999999999999999999999999999999999998765               2344553 6667777777777


Q ss_pred             ccccCeecCCcccCCCCCCEEeccCCCCCCcCCcccCCCCCCceeecc---------------------CccccccCCCC
Q 041975          153 KCLRLKKVSSSLCNLKSLESLYLSGCLKLEKLPEEIGNLGSLKNMVAN---------------------EIAISQVPSSI  211 (543)
Q Consensus       153 ~~~~l~~lp~~i~~l~~L~~L~Ls~~~~~~~~p~~l~~l~~L~~L~l~---------------------~~~i~~lp~~i  211 (543)
                      +|..+..+|..+.++++|+.|++++|..++.+|..+ ++++|+.|+++                     +|.+..+|..+
T Consensus       666 ~c~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~i-~l~sL~~L~Lsgc~~L~~~p~~~~nL~~L~L~~n~i~~lP~~~  744 (1153)
T PLN03210        666 DCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDISTNISWLDLDETAIEEFPSNL  744 (1153)
T ss_pred             CCCCccccchhhhccCCCCEEeCCCCCCcCccCCcC-CCCCCCEEeCCCCCCccccccccCCcCeeecCCCccccccccc
Confidence            777777777777777777777777777666666544 34444444443                     33333343321


Q ss_pred             CCC-------------------------------CCCcEEEccCcCCCCCCCCCCCCc-cccCCCCCeEeccCC-CCCcC
Q 041975          212 SCL-------------------------------NRVELLSFAGCKGRPPQMGLKLPI-LFQSQILENLSLINC-NIIEL  258 (543)
Q Consensus       212 ~~l-------------------------------~~L~~L~L~~~~~~~~~~~~~lp~-~~~l~~L~~L~Ls~n-~l~~l  258 (543)
                       .+                               ++|+.|++++|.....     +|. +.++++|+.|++++| ++..+
T Consensus       745 -~l~~L~~L~l~~~~~~~l~~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~~-----lP~si~~L~~L~~L~Ls~C~~L~~L  818 (1153)
T PLN03210        745 -RLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVE-----LPSSIQNLHKLEHLEIENCINLETL  818 (1153)
T ss_pred             -cccccccccccccchhhccccccccchhhhhccccchheeCCCCCCccc-----cChhhhCCCCCCEEECCCCCCcCee
Confidence             11                               2334444444433222     454 566667777777766 34445


Q ss_pred             CccC--------------------CCCCCCCeEecCCCCCccCCccccCCCCCCEEecccccccccCCCCCC----CcEE
Q 041975          259 PESL--------------------GQLPSLKYLNLEENNFEKIPSNIKQVSKLSLLILDNWKRFLSLPELPC----GSSV  314 (543)
Q Consensus       259 p~~l--------------------~~l~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~L~~~~~l~~lp~lp~----~~~l  314 (543)
                      |..+                    ...++|+.|+|++|.++.+|.++..+++|+.|++++|+.+..+|....    ...+
T Consensus       819 P~~~~L~sL~~L~Ls~c~~L~~~p~~~~nL~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L  898 (1153)
T PLN03210        819 PTGINLESLESLDLSGCSRLRTFPDISTNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETV  898 (1153)
T ss_pred             CCCCCccccCEEECCCCCccccccccccccCEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCee
Confidence            5432                    012456777777777888888899999999999999999998875333    2378


Q ss_pred             eecCCCCCccccCCcccc------------cCCcceeeecccCCCChhhhHHHHHHHHHHHHHHhhhhccccccCCCCCC
Q 041975          315 YARHCTSLETLSNLSTLF------------KPLCQKFDFCNCFKLNRNEVREIVEEALKKIQVLATWWKEQDLEDDHHPP  382 (543)
Q Consensus       315 ~~~~c~~L~~l~~~~~~~------------~~~~~~~~~~~c~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  382 (543)
                      ++.+|++|+.++......            .+....+.|.+|++|    .+++.      ++.            ..  .
T Consensus       899 ~l~~C~~L~~~~l~~~~~~~~~~~~n~~~~~p~~~~l~f~nC~~L----~~~a~------l~~------------~~--~  954 (1153)
T PLN03210        899 DFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFINCFNL----DQEAL------LQQ------------QS--I  954 (1153)
T ss_pred             ecCCCcccccccCCCCchhhhhhcccccccCCchhccccccccCC----Cchhh------hcc------------cc--c
Confidence            899999998776432110            011133578899999    33321      010            00  1


Q ss_pred             CceEEcCCCCCCCCccccCCCcEEE-EEcCCCCCCCCcceeEEEEEeeCCC--CCCCcceeeeeEEEEeCCCCeEEEEEe
Q 041975          383 RGSIWYPGSEIPEWFSFQSMGSSVT-LELPPGWFYNNFVGFALCAIFPEFR--GDTRNLLVDSEFKLKTKDGDWHVATYL  459 (543)
Q Consensus       383 ~~~~~~pg~~iP~Wf~~~~~g~si~-i~lp~~~~~~~~~g~~~c~v~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~  459 (543)
                      ...+++||.++|+||.||+.|++++ |.+|+.|+...|.||++|+|++-..  .......+.+.|.+....|+.+.....
T Consensus       955 ~~~~~l~g~evp~~f~hr~~g~sl~~i~l~~~~~~~~~~~f~~c~v~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~~ 1034 (1153)
T PLN03210        955 FKQLILSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAVVDSESFFIISVSFDIQVCCRFIDRLGNHFDSPYQ 1034 (1153)
T ss_pred             ceEEECCCccCchhccCCcccceeeeeccCCcccCCCccceEEEEEEecCccccCCCceeEEEEEEEECCCCCccccCCC
Confidence            2257899999999999999999998 9999999988899999999994211  112234456667777766765532221


Q ss_pred             ceeecccCCCCCCCCCCeEEEEecCCCc--cC--CCC--CCccEEEEEEEcccccCCCCCeEEEeeeeEEeeecCCC
Q 041975          460 LFVWNEDFGVNSSLESDHVLLGYDFSMD--LD--GLG--GSDKACIQFYIGNYLDKRTEGFDVKKCGAHLIYAQDPS  530 (543)
Q Consensus       460 ~~~~~~~~~~~~~~~sdh~~~~y~~~~~--~~--~~~--~~~~~~~~f~~~~~~~~~~~~~~vk~cGv~l~~~~~~~  530 (543)
                      ...+      ......+|++++... .+  .+  ...  ..+++.++|.|...    ...++||+||||++|+++..
T Consensus      1035 ~~~~------~~~~~~~~l~~~~~~-~~~~~~~~~~~~~~~~~~~~~f~~~~~----~~~~~~~~cg~~~~~~~~~~ 1100 (1153)
T PLN03210       1035 PHVF------SVTKKGSHLVIFDCC-FPLNEDNAPLAELNYDHVDIQFRLTNK----NSQLKLKGCGIRLSEDDSSL 1100 (1153)
T ss_pred             ceeE------eeeccccceEEeccc-ccccccccchhccCCceeeEEEEEecC----CCCeEEEeeeEEEeccCCCc
Confidence            1111      011346777766310 11  11  011  12566677877542    23479999999999976554

syringae 6; Provisional
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF07725 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query543
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 2e-07
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 83/170 (48%), Gaps = 22/170 (12%)
Query: 133 LEELPSSIGNLSRLVTLDLRKCLRLKKVSSSLCN---------LKSLESLYLSGCLKLEK 183
           L  LP+SI +L+RL  L +R C  L ++   L +         L +L+SL L     +  
Sbjct: 139 LRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWT-GIRS 197
Query: 184 LPEEIGNLGSLKNMVANEIAISQVPSSISCLNRVELLSFAGC---KGRPPQMGLKLPILF 240
           LP  I NL +LK++      +S +  +I  L ++E L   GC   +  PP  G + P   
Sbjct: 198 LPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAP--- 254
Query: 241 QSQILENLSLINC-NIIELPESLGQLPSLKYLNLEE-NNFEKIPSNIKQV 288
               L+ L L +C N++ LP  + +L  L+ L+L    N  ++PS I Q+
Sbjct: 255 ----LKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQL 300

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query543
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-35
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-15
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-18
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-13
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-13
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-12
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-09
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  135 bits (341), Expect = 1e-35
 Identities = 55/258 (21%), Positives = 96/258 (37%), Gaps = 45/258 (17%)

Query: 98  DGYPLKTLPSKI---SPEHLVSLEMPNSNIEQLWNDV--------------QLEELPSSI 140
            G  LK     +   +    V+LE+ +  + Q  +                 L ELP ++
Sbjct: 64  TGRALKATADLLEDATQPGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAAGLMELPDTM 123

Query: 141 GNLSRLVTLDLRKCLRLKKVSSSLCNLKSLESLYLSGCLKLEKLPEE---------IGNL 191
              + L TL L +   L+ + +S+ +L  L  L +  C +L +LPE             L
Sbjct: 124 QQFAGLETLTLARN-PLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGL 182

Query: 192 GSLKNMVANEIAISQVPSSISCLNRVELLSFAGCKGR--PPQMGLKLPILFQSQILENLS 249
            +L+++      I  +P+SI+ L  ++ L           P +   L        LE L 
Sbjct: 183 VNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIH-HL------PKLEELD 235

Query: 250 LINCN-IIELPESLGQLPSLKYLNLEE-NNFEKIPSNIKQVSKLSLLILDNWKRFLSLPE 307
           L  C  +   P   G    LK L L++ +N   +P +I ++++L  L L        LP 
Sbjct: 236 LRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPS 295

Query: 308 LPCGSSVYARHCTSLETL 325
           L            +   +
Sbjct: 296 LIA-------QLPANCII 306
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query543
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.93
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.92
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.92
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.92
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.92
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.91
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.91
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.91
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.91
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.91
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.91
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.91
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.91
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.9
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.9
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.9
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.9
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.9
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.9
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.9
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.89
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.89
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.89
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.89
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.89
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.89
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.89
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.88
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.87
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.87
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.87
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.87
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.85
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.85
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.85
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.83
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.82
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.81
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.8
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.8
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.8
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.79
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.78
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.77
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.76
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.75
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.72
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.71
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.7
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.7
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.67
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.67
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.67
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.66
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.66
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.65
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.64
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.63
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.63
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.62
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.55
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.51
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.49
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.48
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.46
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.45
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.44
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.43
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.42
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.39
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.38
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.38
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.36
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.34
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.2
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.2
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.19
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.18
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.17
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.16
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.14
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.14
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.93
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.87
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.87
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.84
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.82
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.7
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.69
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.56
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.56
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.42
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.37
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.14
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.96
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.84
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.8
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.73
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.72
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.69
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.4
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.31
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.18
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=99.95  E-value=4.5e-28  Score=243.16  Aligned_cols=252  Identities=19%  Similarity=0.212  Sum_probs=207.0

Q ss_pred             ccEEEEEeecCCceeeccChHHHhCCCCccEEEEec-CCCCCCcceeeecCCcccccccceEEEECCCCCC-CCCCCC-C
Q 041975           34 EAIEGISLDMSKVKEICMHPSIFTKMHRLRFFKFYN-SISGENRCKVHHVRSMESLFNEQRYFHWDGYPLK-TLPSKI-S  110 (543)
Q Consensus        34 ~~v~~i~L~~s~~~~~~i~~~~f~~l~~Lr~L~l~~-n~~~~~~~~~~~~~~l~~l~~~Lr~L~l~~~~l~-~lp~~~-~  110 (543)
                      ..|+.+.|....+......+.+|.++++|++|++++ |.     ....+|..+..++ +|++|++++|.++ .+|..+ .
T Consensus        50 ~~l~~L~L~~~~l~~~~~~~~~l~~l~~L~~L~L~~~n~-----l~~~~p~~l~~l~-~L~~L~Ls~n~l~~~~p~~~~~  123 (313)
T 1ogq_A           50 YRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINN-----LVGPIPPAIAKLT-QLHYLYITHTNVSGAIPDFLSQ  123 (313)
T ss_dssp             CCEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETT-----EESCCCGGGGGCT-TCSEEEEEEECCEEECCGGGGG
T ss_pred             ceEEEEECCCCCccCCcccChhHhCCCCCCeeeCCCCCc-----ccccCChhHhcCC-CCCEEECcCCeeCCcCCHHHhC
Confidence            678888888777742112356889999999999985 65     5567788888886 8999999999986 777766 7


Q ss_pred             CCCeeEEEcCCCCcccccccccccccCccccCCcCCcEEeccccccCeecCCcccCCC-CCCEEeccCCCCCCcCCcccC
Q 041975          111 PEHLVSLEMPNSNIEQLWNDVQLEELPSSIGNLSRLVTLDLRKCLRLKKVSSSLCNLK-SLESLYLSGCLKLEKLPEEIG  189 (543)
Q Consensus       111 l~~L~~L~L~~n~l~~l~~~~~l~~lp~~l~~l~~L~~L~L~~~~~l~~lp~~i~~l~-~L~~L~Ls~~~~~~~~p~~l~  189 (543)
                      +++|++|+|++|.++        ..+|..++.+++|++|+|++|...+.+|..+.+++ +|++|++++|.+.+.+|..++
T Consensus       124 l~~L~~L~Ls~N~l~--------~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~~~~  195 (313)
T 1ogq_A          124 IKTLVTLDFSYNALS--------GTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFA  195 (313)
T ss_dssp             CTTCCEEECCSSEEE--------SCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGG
T ss_pred             CCCCCEEeCCCCccC--------CcCChHHhcCCCCCeEECcCCcccCcCCHHHhhhhhcCcEEECcCCeeeccCChHHh
Confidence            899999999999886        57888899999999999999876668888888887 899999999888888888888


Q ss_pred             CCCCCceeeccCcccc-ccCCCCCCCCCCcEEEccCcCCCCCCCCCCCCccccCCCCCeEeccCCCCCc-CCccCCCCCC
Q 041975          190 NLGSLKNMVANEIAIS-QVPSSISCLNRVELLSFAGCKGRPPQMGLKLPILFQSQILENLSLINCNIIE-LPESLGQLPS  267 (543)
Q Consensus       190 ~l~~L~~L~l~~~~i~-~lp~~i~~l~~L~~L~L~~~~~~~~~~~~~lp~~~~l~~L~~L~Ls~n~l~~-lp~~l~~l~~  267 (543)
                      .+. |+.|++++|.++ ..|..+..+++|+.|++++|.+...     +|.+..+++|++|++++|++++ +|..+..+++
T Consensus       196 ~l~-L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~-----~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~  269 (313)
T 1ogq_A          196 NLN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFD-----LGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKF  269 (313)
T ss_dssp             GCC-CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCB-----GGGCCCCTTCCEEECCSSCCEECCCGGGGGCTT
T ss_pred             CCc-ccEEECcCCcccCcCCHHHhcCCCCCEEECCCCceeee-----cCcccccCCCCEEECcCCcccCcCChHHhcCcC
Confidence            887 999999999888 5566788889999999999887653     5557778889999999998884 8888888899


Q ss_pred             CCeEecCCCCCc-cCCccccCCCCCCEEecccccccccCC
Q 041975          268 LKYLNLEENNFE-KIPSNIKQVSKLSLLILDNWKRFLSLP  306 (543)
Q Consensus       268 L~~L~Ls~n~l~-~lp~~l~~l~~L~~L~L~~~~~l~~lp  306 (543)
                      |++|+|++|+++ .+|.. ..+++|+.|++++|+.+...|
T Consensus       270 L~~L~Ls~N~l~~~ip~~-~~l~~L~~l~l~~N~~lc~~p  308 (313)
T 1ogq_A          270 LHSLNVSFNNLCGEIPQG-GNLQRFDVSAYANNKCLCGSP  308 (313)
T ss_dssp             CCEEECCSSEEEEECCCS-TTGGGSCGGGTCSSSEEESTT
T ss_pred             CCEEECcCCcccccCCCC-ccccccChHHhcCCCCccCCC
Confidence            999999999888 67754 788888899999888665544
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 543
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.003
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.003
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 53.9 bits (128), Expect = 3e-08
 Identities = 31/249 (12%), Positives = 73/249 (29%), Gaps = 23/249 (9%)

Query: 50  CMHPSIFTKMHRLRFFKFYNSISGENRCKVHHVRSMESLFNEQRYFHWDGYPLKTLPSKI 109
                                   +         S+ +              +  +    
Sbjct: 157 QQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLG 216

Query: 110 SPEHLVSLEMPNSNIEQLWNDVQLEELPSSIGNLSRLVTLDLRKCLRLKKVSSSLCNLKS 169
              +L  L +  + ++             ++ +L+ L  LDL    ++  ++  L  L  
Sbjct: 217 ILTNLDELSLNGNQLKD----------IGTLASLTNLTDLDLANN-QISNLAP-LSGLTK 264

Query: 170 LESLYLSGCLKLEKLPEEIGNLGSLKNMVANEIAISQVPSSISCLNRVELLSFAGCKGRP 229
           L  L L         P       +   +  N++      S++  L  + L  F       
Sbjct: 265 LTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTL-YFNNISDIS 323

Query: 230 PQMGLKLPILFQSQILENLSLINCNIIELPESLGQLPSLKYLNLEENNFEKIPSNIKQVS 289
           P   L          L+ L   N  + ++  SL  L ++ +L+   N    +   +  ++
Sbjct: 324 PVSSLTK--------LQRLFFANNKVSDVS-SLANLTNINWLSAGHNQISDLTP-LANLT 373

Query: 290 KLSLLILDN 298
           +++ L L++
Sbjct: 374 RITQLGLND 382
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query543
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.89
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.86
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.83
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.82
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.82
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.81
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.8
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.77
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.66
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.65
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.63
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.54
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.48
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.47
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.38
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.38
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.27
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.26
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.16
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.08
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.05
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.03
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.0
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.04
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.6
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.35
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.18
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.6
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.31
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.91  E-value=4.1e-25  Score=219.10  Aligned_cols=253  Identities=19%  Similarity=0.192  Sum_probs=211.9

Q ss_pred             ccccEEEEEeecCCceee-ccChHHHhCCCCccEEEEec-CCCCCCcceeeecCCcccccccceEEEECCCCCCCCCCC-
Q 041975           32 GSEAIEGISLDMSKVKEI-CMHPSIFTKMHRLRFFKFYN-SISGENRCKVHHVRSMESLFNEQRYFHWDGYPLKTLPSK-  108 (543)
Q Consensus        32 ~~~~v~~i~L~~s~~~~~-~i~~~~f~~l~~Lr~L~l~~-n~~~~~~~~~~~~~~l~~l~~~Lr~L~l~~~~l~~lp~~-  108 (543)
                      +..+|+.+.|...++... .+ +..+.++++|++|++++ |.     ..+.+|..+..++ +|++|++++|.+..++.. 
T Consensus        48 ~~~~v~~L~L~~~~l~g~~~l-p~~l~~L~~L~~L~Ls~~N~-----l~g~iP~~i~~L~-~L~~L~Ls~N~l~~~~~~~  120 (313)
T d1ogqa_          48 QTYRVNNLDLSGLNLPKPYPI-PSSLANLPYLNFLYIGGINN-----LVGPIPPAIAKLT-QLHYLYITHTNVSGAIPDF  120 (313)
T ss_dssp             SCCCEEEEEEECCCCSSCEEC-CGGGGGCTTCSEEEEEEETT-----EESCCCGGGGGCT-TCSEEEEEEECCEEECCGG
T ss_pred             CcEEEEEEECCCCCCCCCCCC-ChHHhcCccccccccccccc-----ccccccccccccc-ccchhhhcccccccccccc
Confidence            455788888887766422 34 56899999999999986 54     5567899999997 999999999999766554 


Q ss_pred             C-CCCCeeEEEcCCCCcccccccccccccCccccCCcCCcEEeccccccCeecCCcccCCCCC-CEEeccCCCCCCcCCc
Q 041975          109 I-SPEHLVSLEMPNSNIEQLWNDVQLEELPSSIGNLSRLVTLDLRKCLRLKKVSSSLCNLKSL-ESLYLSGCLKLEKLPE  186 (543)
Q Consensus       109 ~-~l~~L~~L~L~~n~l~~l~~~~~l~~lp~~l~~l~~L~~L~L~~~~~l~~lp~~i~~l~~L-~~L~Ls~~~~~~~~p~  186 (543)
                      + .+.+|+++++++|.+.        ..+|.+++++++|+++++++|...+.+|..+..+.++ +.+++++|.+.+..|.
T Consensus       121 ~~~~~~L~~l~l~~N~~~--------~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~  192 (313)
T d1ogqa_         121 LSQIKTLVTLDFSYNALS--------GTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPP  192 (313)
T ss_dssp             GGGCTTCCEEECCSSEEE--------SCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCG
T ss_pred             ccchhhhccccccccccc--------ccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccc
Confidence            4 7899999999999886        6788999999999999999998888899888888776 8899999988888888


Q ss_pred             ccCCCCCCceeeccCcccc-ccCCCCCCCCCCcEEEccCcCCCCCCCCCCCCccccCCCCCeEeccCCCCCc-CCccCCC
Q 041975          187 EIGNLGSLKNMVANEIAIS-QVPSSISCLNRVELLSFAGCKGRPPQMGLKLPILFQSQILENLSLINCNIIE-LPESLGQ  264 (543)
Q Consensus       187 ~l~~l~~L~~L~l~~~~i~-~lp~~i~~l~~L~~L~L~~~~~~~~~~~~~lp~~~~l~~L~~L~Ls~n~l~~-lp~~l~~  264 (543)
                      .++++..+ .+++..+... .+|..+..+++|+.+++.+|.+...     +|.+..+++|+.|+|++|++++ +|..+++
T Consensus       193 ~~~~l~~~-~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~-----~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~  266 (313)
T d1ogqa_         193 TFANLNLA-FVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFD-----LGKVGLSKNLNGLDLRNNRIYGTLPQGLTQ  266 (313)
T ss_dssp             GGGGCCCS-EEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCB-----GGGCCCCTTCCEEECCSSCCEECCCGGGGG
T ss_pred             cccccccc-cccccccccccccccccccccccccccccccccccc-----ccccccccccccccCccCeecccCChHHhC
Confidence            88777655 6888877666 6677788899999999999987664     5668888999999999999995 9999999


Q ss_pred             CCCCCeEecCCCCCc-cCCccccCCCCCCEEecccccccccCC
Q 041975          265 LPSLKYLNLEENNFE-KIPSNIKQVSKLSLLILDNWKRFLSLP  306 (543)
Q Consensus       265 l~~L~~L~Ls~n~l~-~lp~~l~~l~~L~~L~L~~~~~l~~lp  306 (543)
                      +++|++|+|++|+++ .+|. ++++++|+.+++++|+.+...|
T Consensus       267 L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~~l~g~p  308 (313)
T d1ogqa_         267 LKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNKCLCGSP  308 (313)
T ss_dssp             CTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSSEEESTT
T ss_pred             CCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCccccCCC
Confidence            999999999999998 7884 5788999999999998776654
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure